JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies / Polyclonal Antibodies

Anti-SARS-CoV-2 ORF8 Antibody

SKU : BHA21003168

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

Boster

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	A33995, A33995-10ug, A33995-Biotin, A33995-Cy3, A33995-Dylight488, A33995-Dylight550, A33995-Dylight594, A33995-FITC, A33995-HRP, A33995-APC, A33995-PE, A33995-iFluor647, A33995-carrier-free
Alternative Names	ORF8 protein
Background	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF8 encodes a viral accessory protein.
Clonality	Polyclonal
Description	Boster Bio Anti-SARS-CoV-2 ORF8 Antibody catalog # A33995. Tested in ELISA applications. This antibody reacts with Human.
Function	Inhibitor of PPP1CA. Has over 1000-fold higher inhibitory activity when phosphorylated, creating a molecular switch for regulating the phosphorylation status of PPP1CA substrates and smooth muscle contraction.
Host	Rabbit
Immunogen Region	AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Isotype	Rabbit IgG
Molecular Weight	140 kDa, 130 kDa, 110 kDa
Reactivity	Human
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Synonyms	ORF8 protein; ORF8; Non-structural protein 8; ns8
Tissue Specificity	Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. .
Note	Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Uniprot	P0DTC8
Gene Id	43740577
Gene Name	8
Subcellular Location	Cytoplasm .

Conjugates	Biotin, Cy3, Dylight488, Dylight550, Dylight594, FITC, HRP, APC, PE, iFluor647, carrier-free

Concentration	Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Form	Lyophilized
Purification	Immunogen affinity purified.
Storage	Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Applications	ELISA
Description	ELISA, 0.001-0.1ug/ml, Human

Reference	1. Gordon DE, et al. Nature, 2020 Jul.<br /><br />2. Gordon DE, et al. Science, 2020 Oct 15. <br /><br />3. Li JY, et al. Virus Res, 2020 Sep. <br /><br />4. Wu F, et al. Nature, 2020 Mar. <br /><br />

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Conjugation	Size	Your price	Quantity
BHA21003168-1	A33995	-	100 ug	$415		Add to Cart
BHA21003168-2	A33995-10ug	Sample	10 ug	$99		Add to Cart
BHA21003168-3	A33995-Biotin	Biotin	100 ug	$615		Add to Cart
BHA21003168-4	A33995-Cy3	Cy3	100 ug	$615		Add to Cart
BHA21003168-5	A33995-Dylight488	Dylight488	100 ug	$615		Add to Cart
BHA21003168-6	A33995-Dylight550	Dylight550	100 ug	$615		Add to Cart
BHA21003168-7	A33995-Dylight594	Dylight594	100 ug	$615		Add to Cart
BHA21003168-8	A33995-FITC	FITC	100 ug	$615		Add to Cart
BHA21003168-9	A33995-HRP	HRP	100 ug	$615		Add to Cart
BHA21003168-10	A33995-APC	APC	100 ug	$715		Add to Cart
BHA21003168-11	A33995-PE	PE	100 ug	$715		Add to Cart
BHA21003168-12	A33995-iFluor647	iFluor647	100 ug	$715		Add to Cart
BHA21003168-13	A33995-carrier-free	carrier-free	100 ug	$415		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.