JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Jingzhaotoxin-V

SKU : BHP21300236

A Potent Inhibitor of NaV Channels and KV4.2 and KV4.3 Channels

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STJ-050, STJ-050_0.1 mg, STJ-050_50 mcg
Description	A Potent Inhibitor of NaV Channels and KV4.2 and KV4.3 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C157H243N47O37S7
Background	Jingzhaotoxin-V is a 29 amino acid peptidyl toxin isolated from the Chilobrachys jingzhao (Chinese earth tiger tarantula) spider1. It significantly inhibits tetrodotoxin-resistant (TTX-R) and tetrodotoxin-sensitive (TTX-S) Na+ channels in adult rat DRG neurons as well as KV4.2 K+ channels expressed in Xenopus laevis oocytes1.It was found that Jingzhaotoxin-V alters the gating properties of Na+ channels by shifting the activation curves to the depolarizing direction and the inactivation curves to the hyperpolarizing direction1. The findings related to this peptide further reinforced the viewpoint that gating-modifier toxins can alter the voltage-dependent gating through the lipid membrane partitioning1.
Biological Activity	Jingzhaotoxin-V inhibits TTX-resistant and TTX-sensitive Na+ channels in DRG neurons. It also highly inhibits KV4.2 and KV4.3 K+ channels and weakly inhibits KV2.1 K+ channels. It has no effect on KV1.2, KV1.3 or KV1.4 K+ channels1,2.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3605.4 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	Q2PAY4
Concentration	5 - 10 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25 Ile29 - C-terminal amidation
Origin	Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)

Synonyms	JzTx-V, beta/kappa-Theraphotoxin-Cg2a, beta/kappa-TRTX-Cg2a, Peptide F8-15.73, Beta-theraphotoxin-Cj2a
Gene Id	KCND2,KCND3,SCN10A,SCN11A,SCN3A,SCN4A,SCN5A,SCN9A
Sequence	YCQKWMWTCDSKRACCEGLRCKLWCRKII-NH2
Target	NaV channels, KV4.2, KV4.3 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Zeng, X.Z. et al. (2007) Toxicon 49, 388. Chen, J. et al. (2008) Cell. Mol. Life Sci. 65, 2431.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300236-1	STJ-050_0.1 mg	0.1 ml	$1118		Add to Cart
BHP21300236-2	STJ-050_50 mcg	50 mcg	$358		Add to Cart
BHP21300236-3	STJ-050_50 mcg	5x50 mcg	$1420		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.