JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

SpTx-1

SKU : BHP21300287

A human KATP (Kir6.2/SUR1) potassium channel blocker

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STS-800, STS-800_0.1 mg, STS-800_0.5 mg, STS-800_1 mg, STS-800_10 mg, STS-800_5 mg, STS-800_50 mcg
Description	A human KATP (Kir6.2/SUR1) potassium channel blocker
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C286H441N77O80S4
Background	SpTx-1 is a 54 amino acid peptidyl toxin originally isolated from the venom of the centipede, Scolopendra polymorpha. This toxin blocks the adenosine triphosphate (ATP)-sensitive K+ (KATP) channel with a Kd value of 15 nM, primarily by targeting of the pore-forming inwardly rectifying K+ channel (Kir) 6.2 subunit that is coexpressed with the regulatory sulfonylurea receptor 1 (SUR1)1.The KATP channel is a hetero-octameric protein complex, consisting of four Kir6.x pore subunits and four regulatory ATP-binding cassette SURx subunits. The KATP channels are present in many different tissues such as skeletal muscle, smooth muscle, pancreatic beta-cells, cardiomyocytes, and brain. Since these channels are responsible for linking cell metabolism and membrane potential, they are crucial for the regulation of different cellular pathways2. Kir6.x or SUR mutations result in KATP channelopathies, which reflect the physiological roles of these channels, including but not limited to insulin secretion, cardiac protection, neuroprotection, and blood flow regulation3,4.
Biological Activity	SpTx-1 inhibits hKATP channels with a Kd of 15 nM by blocking the hKir6.2 pore1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	6366.4 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Concentration	15 - 50 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: The exact location of the disulfide bridges is currently unknown.
Origin	Scolopendra polymorpha.

Synonyms	SpTx1
Gene Id	KCNJ11,ABCC8
Sequence	ADLIKKKLPFRTRSKFPRKSECVQDCAKAFTNGNKDKIKDVKSEFFSCYCWYEA-OH
Target	hKATP inhibitor, Kir6.2

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Ramu, Y. et al. (2019) Nature Sci. Rep., 9, 14088. Seino, S. (1999) Annu. Rev. Physiol., 61, 337. Zhao, G. et al. (2020) J. Clin. Invest., 130, 1112. Zhao, S. et al. (2021) Brain Res. Bull., 169, 1. Ramu, Y. et al. (2018) J. Gen. Physiol., 150, 969.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300287-1	STS-800_0.1 mg	0.1 mg	$889		Add to Cart
BHP21300287-2	STS-800_0.5 mg	0.5 mg	$2663		Add to Cart
BHP21300287-3	STS-800_1 mg	1 mg	$3731		Add to Cart
BHP21300287-4	STS-800_10 mg	10 mg	$15847		Add to Cart
BHP21300287-5	STS-800_5 mg	5 mg	$11173		Add to Cart
BHP21300287-6	STS-800_50 mcg	50 mcg	$562		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.