JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

SsdTx3

SKU : BHP21300285

A human KATP (Kir6.2/SUR1) potassium channel blocker

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STS-670, STS-670_0.1 mg, STS-670_0.5 mg, STS-670_1 mg, STS-670_5 mg
Description	A human KATP (Kir6.2/SUR1) potassium channel blocker
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C273H422N74O77S4
Background	SsdTx3 (kappa-scoloptoxin(15)-Ssd3a) is a toxin isolated from the venom of the centipede Scolopendra subspinipes dehaani, a species that inhabits Asia. SsdTx3 was found to be an inhibitor of hKATP channels by blocking the hKir6.2 pore co-expressed with hSUR1. Dose-Response curve of the hKATP channels inhibition revealed that SsdTx3 inhibits hKATP channels with a Kd values of 278nM1.SsdTx belongs to a family of five proteins, discovered so far from a multiple centipede species, that target hKATP channel by blocking the hKir6.2 pore. They have conserved features of four cysteine residues and a P-P segment that contains positively charged residues important for blocking the K+ pore1.ATP-sensitive K+ ion channels (KATP channels) can be found in many different tissues such as pancreatic beta-cells, carried myocytes, skeletal muscle, smooth muscle and brain. KATP channels are responsible for linking between the cell metabolism and the membrane potential and therefore they are critical for the regulation of different cellular pathways2.
Biological Activity	SsdTx3 inhibits hKATP channels with a Kd of
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	6101 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic protein
Accession Number	P0DPV6
Concentration	100 - 500 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: The exact location of the disulfide bridges is currently unknown.
Origin	Scolopendra dehaani (Thai centipede) (Scolopendra subspinipes dehaani)

Synonyms	Kappa-scoloptoxin (15)-Ssd3a, Kappa-SLPTX(15)-Ssd3, Toxin SSD893, k- SLPTX(15)-Ssd3
Gene Id	KCNJ11,ABCC8
Sequence	EVIRKEIPYKKRKFPYKSECRKACATAFTGGDESRIKDVKPGFFKCSCYYSSG-OH
Target	KATP inhibitor

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Ramu, Y. and Lu, Z. Nature Sci. Rep. (2019) 9, 14088. Seino, S. Annu. Rev. Physiol. (1999) 61, 337.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300285-1	STS-670_0.1 mg	0.1 mg	$501		Add to Cart
BHP21300285-2	STS-670_0.5 mg	0.5 mg	$1301		Add to Cart
BHP21300285-3	STS-670_1 mg	1 mg	$2081		Add to Cart
BHP21300285-4	STS-670_5 mg	5 mg	$7277		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.