JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Agitoxin-2-Cys-TAMRA

SKU : BHP21300102

A Novel Marker of KV1.3 K+ Channels

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RTA-420-T, RTA-420-T_1 mcg
Description	A Novel Marker of KV1.3 K+ Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water to high-micromolar concentrations (5 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Molecular Formula	C202H316N58O51S9
Background	Native Agitoxin-2 was originally isolated from the venom of the Israeli scorpion L. quinquestriatus hebraeus.1 Agitoxin-2 inhibits the native KV1.3-like current in cultured microglia and KV1.3 in MLS-9 cells.2 Agitoxin-2 is a potent blocker of the Shaker voltage-gated K+-channels as well as the mammalian homologues of Shaker.1A few recombinant, mutated and labeled toxins have been described in the literature, including the KCa1.1 specific blocker Iberiotoxin (#STI-400) and the KV1 blocker Hongotoxin (#RTH-400).3-4A similar approach was taken by Alomone Labs in producing Agitoxin-2-Cys-TAMRA. A fluorescent dye is attached to a free Cys residue, which replaces Asp in position 20 of the 38 amino acid long peptide. This novel toxin retains the blocking activity of the original toxin and specifically labels living cells expressing KV1.3 channels.
Biological Activity	Agitoxin-2 is a blocker of Shaker voltage-gated K+ channels as well as the mammalian homologues of Shaker. Agitoxin-2-Cys-TAMRA inhibits KV1.3 channels as potently.
Formulation	Lyophilized Powder.
Molecular Weight	4673 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water to high-micromolar concentrations (50 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Source	Modified recombinant protein, E. coli
Concentration	50 pM - 10 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35 Asp20 mutated to a Cys residue (indicated in bold) which was reacted with 5(6)-TAMRA-C5-maleimide.
Origin	Leiurus hebraeus (Hebrew deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

Synonyms	K+ channel toxin alpha-KTx 3.2, AgTx-2, AgTx2
Gene Id	KCNA1, KCNA2, KCNA3, KCNA6
Sequence	GVPINVSCTGSPQCIKPCKCAGMRFGKCMNRKCHCTPK-OH
Target	KV1.3 K+ channels

Country Of Origin	Israel/IL
Storage	Storage After Reconstitution: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.

Applications	Electrophysiology, Fluorescence staining

Reference	Garcia, M.L. et al. (1994) Biochemistry 33, 6834. Cayabyab, F.S. et al. (2000) Eur. J. Neurosci. 12, 1949. Hafidi, A. et al. (2005) Neuroscience 130, 475. Freudenthaler, G. et al. (2002) Histochem. Cell Biol. 117, 197.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300102-1	RTA-420-T_1 mcg	1 mcg	$677		Add to Cart
BHP21300102-2	RTA-420-T_1 mcg	5x1 mcg	$2698		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.