JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

GrTx1

SKU : BHP21300207

A Blocker of NaV and KV11.1 Channels

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STG-250, STG-250_0.1 mg, STG-250_0.25 mg, STG-250_0.5 mg, STG-250_1 mg, STG-250_10 mg, STG-250_5 mg
Description	A Blocker of NaV and KV11.1 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C159H243N45O41S8
Background	beta-theraphotoxin-Gr1a (GrTx1) is a peptidyl toxin originally isolated from the venom of the ''rosean-tarantula'' (Grammostola rosea). GrTx1 has 29 amino-acid residues, compactly folded by three disulfide bridges with a molecular weight of 3697 Da. Sequence analysis reveals that GrTx1 is closely related to other spider toxins reported to affect various distinct ion channel functions1. The toxin inhibits NaV1.1 (IC50 = 0.63 uM), NaV1.2 (IC50= 0.23 uM), NaV1.3 (IC50 = 0.77 uM), NaV1.4 (IC50= 1.29 uM), NaV1.6 (IC50= 0.63 uM), NaV1.7 (IC50= 0.37 uM) and potassium channels KV11.1 (IC50 = 1.2 uM)2.
Biological Activity	GrTx1 is a blocker of voltage-gated Na+ channels and herg1 channels1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3697.5 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P85117
Concentration	20 - 500 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys16, Cys9-Cys21 and Cys15-Cys25
Origin	Grammostola rosea (Chilean rose tarantula) (Grammostola spatulata)

Synonyms	beta-theraphotoxin-Gr1a, beta-TRTX-Gr1a
Gene Id	KCNH2,SCN1A,SCN2A,SCN3A,SCN4A,SCN8A,SCN9A
Sequence	YCQKWMWTCDSKRKCCEDMVCQLWCKKRL-OH
Target	NaV, KV11.1 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Clement, H. et al. (2007) Toxicon 50, 65. Redaelli, E. et al. (2010) J. Biol. Chem. 285, 4130. Redaelli, E. et al. (2010) J. Biol. Chem. 285, 4130.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300207-1	STG-250_0.1 mg	0.1 mg	$154		Add to Cart
BHP21300207-2	STG-250_0.25 mg	0.25 mg	$384		Add to Cart
BHP21300207-3	STG-250_0.5 mg	0.5 mg	$690		Add to Cart
BHP21300207-4	STG-250_1 mg	1 mg	$1241		Add to Cart
BHP21300207-5	STG-250_10 mg	10 mg	$6805		Add to Cart
BHP21300207-6	STG-250_5 mg	5 mg	$4864		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.