JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Recombinant Protein

Recombinant Bacillus phage phi29 Histone-like protein p6 (6)

SKU : BHP10514949

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

CUSABIO TECHONOLOGY LLC

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	CSB-EP356118BBC
Alternative Names	Double-stranded DNA-binding protein p6;Gene product 6;gp6;Nucleoid-associated protein p6;Protein p6
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Tag	C-terminal 6xHis-tagged
Molecular Weight	18.9 kDa
Relevance	Histone-like nucleoprotein that binds to the viral dsDNA and responsible for wrapping and compacting the viral DNA about 4-fold. Forms a nucleoprotein complex in which the DNA adopts a right-handed toroidal conformation winding around a protein core. Binds ito most, if not all, the viral genome, although with different affinity, the highest one corresponding to the genome ends. The formation of the nucleoprotein complex at the genome ends, activates the initiation of viral DNA replication. The binding of p6 would recruit the complex formed by the TP and the DNA polymerase to the origin. Protein p6 also represses early transcription from promoter C2, and, together with protein p4, represses transcription from promoters A2b and A2c and activates late transcription from promoter A3. Protein p6 is therefore involved in the early to late transcription switch. The formation of the nucleoprotein complex at the right end of the phage genome where the early promoter C2 is located affects local topology, which may contribute to the promoter repression.
Source	E.coli
Form	Liquid or Lyophilized powder
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Expression Region	1-104aa
Lead Time	13-23 business days
Organism	Bacillus phage phi29 (Bacteriophage phi-29)
Protein Length	Full Length

Uniprot	P03685
Gene Name	6
Research Area	Others
Sequence	MAKMMQREITKTTVNVAKMVMVDGEVQVEQLPSETFVGNLTMEQAQWRMKRKYKGEPVQVVSVEPNTEVYELPVEKFLEVATVRVEKDEDQEEQTEAPEEQVAE

Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.<br />If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity	Greater than 95% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. <br />Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product Manual	<a href="https://www.cusabio.com/msds/12942116/" target="_blank">MSDS</a>

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP10514949	CSB-EP356118BBC	20ug	$306		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.