JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Recombinant Protein

Recombinant Human ADP/ATP translocase 3 (SLC25A6), partial

SKU : BHP10510724

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

CUSABIO TECHONOLOGY LLC

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	CSB-EP021520HU1
Alternative Names	(ADP,ATP carrier protein 3)(ADP,ATP carrier protein, isoform T2)(ANT 2)(Adenine nucleotide translocator 3)(ANT 3)(Solute carrier family 25 member 6)
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Tag	N-terminal 6xHis-KSI-tagged
Molecular Weight	20.2 kDa
Relevance	ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell . Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane . In addition to its ADP:ATP antiporter activity, also involved in mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity . Plays a role in mitochondrial uncoupling by acting as a proton transporter: proton transport uncouples the proton flows via the electron transport chain and ATP synthase to reduce the efficiency of ATP production and cause mitochondrial thermogenesis . Proton transporter activity is inhibited by ADP:ATP antiporter activity, suggesting that SLC25A6/ANT3 acts as a master regulator of mitochondrial energy output by maintaining a delicate balance between ATP production (ADP:ATP antiporter activity) and thermogenesis (proton transporter activity) . Proton transporter activity requires free fatty acids as cofactor, but does not transport it . Also plays a key role in mPTP opening, a non-specific pore that enables free passage of the mitochondrial membranes to solutes of up to 1.5 kDa, and which contributes to cell death . It is however unclear if SLC25A6/ANT3 constitutes a pore-forming component of mPTP or regulates it .
Source	E.coli
Endotoxin Level	Not test.
Form	Liquid or Lyophilized powder
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Bioactivity	Not Test
Expression Region	232-272aa
Lead Time	3-7 business days
Organism	Homo sapiens (Human)
Protein Length	Partial

Uniprot	P12236
Gene Name	SLC25A6
Research Area	Cell Biology
Sequence	DTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFK

Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP10510724	CSB-EP021520HU1	20ug	$306		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.