JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Recombinant Protein

Recombinant Human Cell surface glycoprotein CD200 receptor 1 (CD200R1), partial

SKU : BHP10512932

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

CUSABIO TECHONOLOGY LLC

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	CSB-EP851547HU1
Alternative Names	CD200 cell surface glycoprotein receptor;Cell surface glycoprotein OX2 receptor 1
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Tag	N-terminal 6xHis-KSI-tagged
Molecular Weight	26.7 kDa
Relevance	Inhibitory receptor for the CD200/OX2 cell surface glycoprotein. Limits inflammation by inhibiting the expression of pro-inflammatory molecules including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to selected stimuli. Also binds to HHV-8 K14 viral CD200 homolog with identical affinity and kinetics as the host CD200.
Source	E.coli
Form	Liquid or Lyophilized powder
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Expression Region	226-325aa
Lead Time	13-23 business days
Organism	Homo sapiens (Human)
Protein Length	Partial

Uniprot	Q8TD46
Gene Name	CD200R1
Research Area	Cardiovascular
Sequence	SLYIELLPVPGAKKSAKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTESTPVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL

Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product Manual	MSDS

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP10512932	CSB-EP851547HU1	20ug	$306		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.