JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Recombinant Protein

Recombinant Phoneutria nigriventer Omega-ctenitoxin-Pn3a

SKU : BHP10510002

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

CUSABIO TECHONOLOGY LLC

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	CSB-EP305462EUV
Alternative Names	(Omega-CNTX-Pn3a)(Neurotoxin Tx3-4)(Omega-phonetoxin-2A)(Omega-phonetoxin-IIA)(Omega-Ptx-IIA)(PF3)(Phoneutriatoxin 3-4)(Pn3-4A)
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Molecular Weight	15.8 kDa
Relevance	This toxin is a potent and practically irreversible antagonist of both Cav2.1/CACNA1A and Cav2.2/CACNA1B calcium channels, while it displays a partial and rapidly reversible block of Cav2.3/CACNA1E calcium channels and no effect on Cav3/CACNA1 calcium channels. Inhibits glutamate uptake from rat brain synaptosomes by an interaction between cysteines from both glutamate transporter and toxin. Blocks potassium-induced exocytosis of synaptic vesicles in brain cortical synaptosomes with an IC(50) of 1.1 nM. In mice, induces rapid general flaccid paralysis followed by death in 10-30 minutes at dose levels of 5 ug per mouse. In rat brain, inhibits glutamate release, neuronal death and loss of neurotransmission in the hippocampus resulting from ischemia.
Source	E.coli
Endotoxin Level	Not test.
Form	Liquid or Lyophilized powder
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Bioactivity	Not Test
Expression Region	40-115aa
Lead Time	13-23 business days
Organism	Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer)
Protein Length	Full Length of Mature Protein

Uniprot	P81790
Research Area	Others
Sequence	SCINVGDFCDGKKDDCQCCRDNAFCSCSVIFGYKTNCRCEVGTTATSYGICMAKHKCGRQTTCTKPCLSKRCKKNH

Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP10510002	CSB-EP305462EUV	20ug	$388		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.