JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Recombinant Protein

Recombinant Pig Lactadherin (MFGE8)

SKU : BHP10514691

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

CUSABIO TECHONOLOGY LLC

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	CSB-EP013752PI
Alternative Names	MFGM;Milk fat globule-EGF factor 8;MFG-E8;SED1;Sperm surface protein SP47;PP47
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Tag	C-terminal 6xHis-tagged
Molecular Weight	52.6 kDa
Relevance	Contributes to phagocytic removal of apoptotic cells in many tissues. Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction.
Source	E.coli
Form	Liquid or Lyophilized powder
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Expression Region	1-409aa
Lead Time	13-23 business days
Organism	Sus scrofa (Pig)
Protein Length	Full Length

Uniprot	P79385
Gene Name	MFGE8
Research Area	Cardiovascular
Sequence	FSGDFCDSSLCLNGGTCLLDQDPQKPFHCLCPEGFTGLICNETEKGPCFPNPCHNDAECEVIDDAHRGDVFTEYICKCPHGYTGIHCEIICNAPLGMETGAIADFQISASSMHLGFMGLQRWAPELARLHRAGIVNAWTASNYDRNPWIQVNLLRRMRVTGVVTQGASRAGSAEYMKTFKVAYSTDGRKFQFIQGAEESGDKIFMGNLDNSGLKVNLFEVPLEVQYVRLVPIICHRGCTLRFELLGCELSGCAEPLGLKDNTIPNKQITASSFYRTWGLSAFSWYPFYARLDNQGKFNAWTAQSNSASEWLQIDLGSQRRVTGIITQGARDFGHIQYVAAYKVAYSDDGVSWTEYRDQGALEGKIFPGNLDNNSHKKNMFETPFLTRFVRILPVAWHNRITLRVELLGC

Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.<br />If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. <br />Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product Manual	<a href="https://www.cusabio.com/msds/12941819/" target="_blank">MSDS</a>

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP10514691	CSB-EP013752PI	20ug	$256		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.