{"product_id":"kcnj1-kir1-1-blocking-peptide-bhp21300979","title":"KCNJ1\/Kir1.1 Blocking Peptide","description":"\u003ch2\u003eOverview\u003c\/h2\u003e \u003cp\u003e\u003cstrong\u003eKCNJ1\/Kir1.1 Blocking Peptide\u003c\/strong\u003e is a GST fusion protein used in research settings. It is commonly applied as a tool reagent related to \u003cstrong\u003eKCNJ1\u003c\/strong\u003e biology and\/or assay development. It is supplied in Lyophilized powder format to support flexible downstream use in RUO workflows. Researchers commonly pair it with applications such as WB, IHC, CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA.\u003c\/p\u003e \u003ch2\u003eKey elements and design rationale\u003c\/h2\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eQuality attributes:\u003c\/strong\u003e Purity: \u0026gt;95% (SDS-PAGE); Identity\/confirmation: Confirmed by DNA sequence and SDS-PAGE; Lot QC: Western blot analysis..\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eImmunogen context:\u003c\/strong\u003e GST fusion protein with the sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat KCNJ1.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eAntigen preadsorption control:\u003c\/strong\u003e 3 µg fusion protein per 1 µg antibody.\u003c\/li\u003e \u003c\/ul\u003e \u003cp\u003eWhen used as a biochemical or pharmacological tool, results are best interpreted relative to the experimental system (species, expression level, and assay readout) and with appropriate negative and competition-style controls where relevant. This product is intended for research use only.\u003c\/p\u003e \u003ch2\u003eBiological background\u003c\/h2\u003e \u003cp\u003eProtein and peptide reagents are widely used to probe molecular mechanisms, benchmark assay performance, and support reagent validation. Interpretation depends on the assay context (e.g., binding, functional modulation, competition, or detection) and on how closely the reagent’s sequence\/structure matches the biological target in the experimental system.\u003c\/p\u003e \u003ch2\u003eResearch relevance and current trends\u003c\/h2\u003e \u003cul\u003e \u003cli\u003eUsing high-specificity ligands, toxins, and engineered peptides to dissect closely related receptor\/channel subtypes and signaling microdomains.\u003c\/li\u003e\n\u003cli\u003ePairing labeled (e.g., fluorescent) proteins\/peptides with advanced imaging to map surface expression, trafficking, and nanoscale organization.\u003c\/li\u003e\n\u003cli\u003eExpanding rigor in antibody validation, including competition\/preadsorption concepts and orthogonal approaches (genetic, pharmacologic, and biochemical controls).\u003c\/li\u003e \u003c\/ul\u003e \u003ch2\u003eCommon research applications\u003c\/h2\u003e \u003cul\u003e \u003cli\u003eWB: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.\u003c\/li\u003e\n\u003cli\u003eIHC: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.\u003c\/li\u003e\n\u003cli\u003eCBE- Cell-based ELISA: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.\u003c\/li\u003e\n\u003cli\u003eFC- Flow cytometry: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.\u003c\/li\u003e\n\u003cli\u003eICC- Immunocytochemistry: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.\u003c\/li\u003e\n\u003cli\u003eIE- Indirect ELISA: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.\u003c\/li\u003e\n\u003cli\u003eIF- Immunofluorescence: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.\u003c\/li\u003e\n\u003cli\u003eIFC- Indirect flow cytometry: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.\u003c\/li\u003e\n\u003cli\u003eIHC- Immunohistochemistry: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.\u003c\/li\u003e\n\u003cli\u003eIP- Immunoprecipitation: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.\u003c\/li\u003e\n\u003cli\u003eLCI- Live cell imaging: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.\u003c\/li\u003e\n\u003cli\u003eN- Neutralization: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.\u003c\/li\u003e\n\u003cli\u003eAntibody-related use: often referenced as the immunogen for antibody generation (GST fusion protein with the sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat KCNJ1), supporting interpretation of epitope-dependent results.\u003c\/li\u003e\n\u003cli\u003eSpecificity control concept: can support antigen preadsorption-style controls (3 µg fusion protein per 1 µg antibody) as part of an overall validation strategy.\u003c\/li\u003e \u003c\/ul\u003e \u003cp\u003eAcross these use cases, changes in signal or functional readout are generally interpreted as evidence of differences in target abundance, accessibility, or engagement, but alternative explanations (matrix effects, off-target interactions, or assay artifacts) should be considered.\u003c\/p\u003e \u003ch2\u003eNotes for experimental interpretation\u003c\/h2\u003e \u003cul\u003e \u003cli\u003eAssay context matters: binding assays, functional modulation, and detection workflows can yield different readouts even for the same target system.\u003c\/li\u003e\n\u003cli\u003eTarget complexity: closely related family members, splice variants, and post-translational modifications can influence apparent specificity and potency.\u003c\/li\u003e\n\u003cli\u003eMatrix and sample effects: buffer composition, detergents, and biological matrices may alter stability or apparent activity; interpret with appropriate controls.\u003c\/li\u003e\n\u003cli\u003eControl concepts: competition\/preadsorption should be considered alongside orthogonal controls (e.g., genetic perturbation, alternative ligands, or independent antibodies).\u003c\/li\u003e \u003c\/ul\u003e \u003c!-- Sources (internal): - UniProt Knowledgebase (UniProtKB) — UniProt Consortium — https:\/\/www.uniprot.org\/ - NCBI Gene — National Center for Biotechnology Information (NCBI) — https:\/\/www.ncbi.nlm.nih.gov\/gene\/ - NCBI Protein — National Center for Biotechnology Information (NCBI) — https:\/\/www.ncbi.nlm.nih.gov\/protein\/ - PubChem — NIH\/NLM\/NCBI — https:\/\/pubchem.ncbi.nlm.nih.gov\/ - IUPHAR\/BPS Guide to Pharmacology — IUPHAR\/BPS — https:\/\/www.guidetopharmacology.org\/ - RCSB Protein Data Bank (PDB) — RCSB PDB — https:\/\/www.rcsb.org\/ - NCBI Bookshelf — NIH\/NLM — https:\/\/www.ncbi.nlm.nih.gov\/books\/ --\u003e","brand":"Alomone Labs","offers":[{"title":"Default Title","offer_id":53073049846125,"sku":null,"price":0.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0949\/7424\/7277\/files\/APC-001_ept_141.gif?v=1772699962","url":"https:\/\/www.ebiohippo.com\/products\/kcnj1-kir1-1-blocking-peptide-bhp21300979","provider":"BioHippo","version":"1.0","type":"link"}