{"product_id":"p95-nbs1-antibody-bha17105186","title":"p95 NBS1 Antibody","description":"\u003ch2\u003eOverview\u003c\/h2\u003e \u003cp\u003ep95 NBS1 antibody supplied as a antigen affinity purified reagent for WB, IHC-P, ICC in Human, Mouse, Rat samples. This product is a polyclonal (rabbit origin) antibody (host: Rabbit; isotype: Rabbit IgG) intended for research use only. The target is commonly annotated with nuclear localization context, which may inform staining patterns.\u003c\/p\u003e \u003ch2\u003eKey elements and design rationale\u003c\/h2\u003e \u003cul\u003e   \u003cli\u003e\n\u003cstrong\u003eAntibody identity:\u003c\/strong\u003e Polyclonal (rabbit origin); host Rabbit; isotype Rabbit IgG.\u003c\/li\u003e   \u003cli\u003e\n\u003cstrong\u003eFormat and purification:\u003c\/strong\u003e format: Antigen affinity purified; purity: Antigen affinity.\u003c\/li\u003e   \u003cli\u003e\n\u003cstrong\u003eSpecies reactivity (reported):\u003c\/strong\u003e Human, Mouse, Rat.\u003c\/li\u003e   \u003cli\u003e\n\u003cstrong\u003eApplications (listed):\u003c\/strong\u003e WB, IHC-P, ICC.\u003c\/li\u003e   \u003cli\u003e\n\u003cstrong\u003eImmunogen \/ epitope context:\u003c\/strong\u003e Amino acids RKNTELEEWLRQEMEVQNQHAKEESLADDLFR of human p95 NBS1 were used as the immunogen for the p95 NBS1 antibody..\u003c\/li\u003e   \u003cli\u003e\n\u003cstrong\u003eLocalization:\u003c\/strong\u003e Nuclear (annotation-level guidance; cell state and isoforms can shift patterns).\u003c\/li\u003e \u003c\/ul\u003e \u003cp\u003eThese attributes help you align the antibody with the biological question (target state, sample type, and readout) while keeping interpretation grounded in appropriate controls.\u003c\/p\u003e \u003ch2\u003eBiological background\u003c\/h2\u003e \u003cp\u003ep95 NBS1 is the intended antigen for this primary antibody. Reported biological context includes: p95 NBS1, also known as NBS1, NBN or Nibrin, is a protein which in humans is encoded by the NBN gene. Nibrin is a protein associated with the repair of double strand breaks (DSBs) which pose serious damage to a genome. Subcellular localization information (Nuclear) can be useful when interpreting IF\/ICC patterns and selecting compartment-enriched lysates for WB.\u003c\/p\u003e \u003ch2\u003eResearch relevance and current trends\u003c\/h2\u003e \u003cul\u003e   \u003cli\u003eSpatial and single-cell approaches: imaging-based and cytometry workflows increasingly quantify heterogeneity and relocalization rather than only bulk abundance.\u003c\/li\u003e   \u003cli\u003eInteraction-centric biology: IP-based enrichment and proteomics are widely used to define complexes, binding partners, and context-specific interactomes.\u003c\/li\u003e \u003c\/ul\u003e \u003ch2\u003eCommon research applications\u003c\/h2\u003e \u003cul\u003e   \u003cli\u003eWestern blot (WB): compare relative abundance\/isoform patterns across conditions and sample types; band shifts may reflect processing or post-translational modification.\u003c\/li\u003e   \u003cli\u003eIHC-P: commonly used to measure relative target levels or localization changes in the context of the experimental question.\u003c\/li\u003e   \u003cli\u003eImmunocytochemistry (ICC): visualize intracellular distribution and morphology-linked changes in cultured cells.\u003c\/li\u003e \u003c\/ul\u003e \u003cp\u003eAcross these readouts, differences in signal intensity, localization, or complex enrichment are typically interpreted alongside sample-matched controls and independent evidence to distinguish regulation from technical variation.\u003c\/p\u003e \u003ch2\u003eNotes for experimental interpretation\u003c\/h2\u003e \u003cul\u003e   \u003cli\u003eIsoforms, cleavage products, or post-translational modifications can alter apparent molecular weight and subcellular distribution; interpret bands and staining patterns in the context of expected biology and sample preparation.\u003c\/li\u003e   \u003cli\u003eSpecies differences and epitope conservation may affect binding; use matched positive controls and orthogonal evidence when comparing across organisms.\u003c\/li\u003e   \u003cli\u003eControl concepts: include appropriate isotype and secondary-only controls (for imaging), and consider genetic perturbations (knockout\/knockdown\/overexpression) or independent antibodies targeting distinct epitopes to strengthen conclusions.\u003c\/li\u003e \u003c\/ul\u003e \u003cp\u003eEpitope context is defined by the immunogen description; when available, align this with known domains, PTM sites, or family homology to anticipate potential cross-reactivity patterns. As a polyclonal antibody, recognition spans multiple epitopes, which can improve detection across conformations but may broaden background depending on sample context.\u003c\/p\u003e \u003c!-- Sources (internal): - UniProtKB entry (O60934) — UniProt Consortium — https:\/\/www.uniprot.org\/uniprotkb\/O60934\/entry - NCBI Gene search (p95 NBS1) — NCBI — https:\/\/www.ncbi.nlm.nih.gov\/gene\/?term=p95+NBS1 - Ensembl search (p95 NBS1) — Ensembl — https:\/\/www.ensembl.org\/Multi\/Search\/Results?q=p95+NBS1 - PubMed search (p95 NBS1) — NLM — https:\/\/pubmed.ncbi.nlm.nih.gov\/?term=p95+NBS1 - Reactome pathway search (p95 NBS1) — Reactome — https:\/\/reactome.org\/content\/query?q=p95+NBS1 --\u003e","brand":"NSJ Bioreagents","offers":[{"title":"0.5mg\/ml if reconstituted with 0.2ml sterile DI water \/ 100 ug","offer_id":53043295191405,"sku":"R31829","price":449.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0949\/7424\/7277\/files\/get_image_8759937f-9ed8-4399-aaf9-6d12d79e77c4.jpg?v=1771934783","url":"https:\/\/www.ebiohippo.com\/products\/p95-nbs1-antibody-bha17105186","provider":"BioHippo","version":"1.0","type":"link"}