<?xml version="1.0" encoding="UTF-8"?>
<urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9" xmlns:image="http://www.google.com/schemas/sitemap-image/1.1">
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-6-il6-active-bhp10516014</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP305249MOV-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin-6 (IL6) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-pyogenes-serotype-m3-arginine-repressor-argr2-bhp10516024</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP316987SMV-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Streptococcus pyogenes serotype M3 Arginine repressor (argR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-autoinducer-2-kinase-lsrk-bhp10516009</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP303534ENV-SDS.jpg?v=1772280360</image:loc>
      <image:title>Recombinant Escherichia coli Autoinducer-2 kinase (lsrK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-vaccinia-virus-cell-surface-binding-protein-opg105-d8l-partial-bhp10516033</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP3211GKL1c7-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Vaccinia virus Cell surface-binding protein OPG105 (D8L), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-flock-house-virus-protein-b2-b2-bhp10516012</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP304757FCA-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Flock house virus Protein B2 (B2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-vibrio-cholerae-serotype-o1-sialidase-nanh-partial-bhp10516018</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP314042VEX-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Vibrio cholerae serotype O1 Sialidase (nanH), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rotavirus-a-outer-capsid-glycoprotein-vp7-bhp10516025</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP318897RGU-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Rotavirus A Outer capsid glycoprotein VP7</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-woodchuck-hepatitis-b-virus-protein-x-x-bhp10516042</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP323774WAWc7-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Woodchuck hepatitis B virus Protein X (X)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-t4-portal-protein-20-bhp10516028</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP320212EDZ_A4_-SDS.jpg?v=1772280362</image:loc>
      <image:title>Recombinant Enterobacteria phage T4 Portal protein (20)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-baboon-endogenous-virus-envelope-glycoprotein-env-partial-bhp10516030</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP320630BAB-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Baboon endogenous virus Envelope glycoprotein (env), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-31-protein-e7-e7-bhp10516046</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP324626HND-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Human papillomavirus 31 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-sp-group-g-immunoglobulin-g-binding-protein-g-spg-partial-bhp10516040</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP322577SNDa0_F19_-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-vivax-circumsporozoite-protein-csp-partial-bhp10516029</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP320279EWW1-SDS.jpg?v=1782434267</image:loc>
      <image:title>Recombinant Plasmodium vivax Circumsporozoite protein (CSP), partial</image:title>
      <image:caption>Recombinant Plasmodium vivax Circumsporozoite protein (CSP), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rhizomucor-miehei-lipase-d250g-bhp10516036</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP321696RDA-SDS_c67aecb4-7c77-4c20-b0b0-a84174cd32d8.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Rhizomucor miehei Lipase (D250G)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tomato-bushy-stunt-virus-rna-silencing-suppressor-p19-orf4-bhp10516031</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP320894TGA-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Tomato bushy stunt virus RNA silencing suppressor p19 (ORF4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-woodchuck-hepatitis-b-virus-protein-x-x-partial-bhp10516041</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP323774WAW1-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Woodchuck hepatitis B virus Protein X (X), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-gibbon-ape-leukemia-virus-envelope-glycoprotein-env-partial-bhp10516037</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP321953GCA-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Gibbon ape leukemia virus Envelope glycoprotein (env), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-francisella-tularensis-subsp-holarctica-17-kda-major-membrane-protein-ftl-0421-bhp10516038</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP322417FCO-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Francisella tularensis subsp. holarctica 17 kDa major membrane protein (FTL_0421)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-emericella-nidulans-class-i-hydrophobin-roda-roda-bhp10516056</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP326791EKF-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Emericella nidulans Class I hydrophobin rodA (rodA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytomegalovirus-viral-transcription-factor-ie2-ul122-partial-bhp10516039</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP322574HWV-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Human cytomegalovirus Viral transcription factor IE2 (UL122), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chlamydia-trachomatis-major-outer-membrane-porin-serovar-h-ompa-bhp10516032</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP321117DSA-SDS.jpg?v=1772280362</image:loc>
      <image:title>Recombinant Chlamydia trachomatis Major outer membrane porin, serovar H (ompA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-proteus-mirabilis-hemolysin-hpma-partial-bhp10516053</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP325826EYYc7-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Proteus mirabilis Hemolysin (hpmA),partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-wolinella-succinogenes-fumarate-reductase-flavoprotein-subunit-frda-bhp10516035</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP321527WBQ_A4_-SDS.jpg?v=1772280368</image:loc>
      <image:title>Recombinant Wolinella succinogenes Fumarate reductase flavoprotein subunit (frdA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-t4-capsid-assembly-protein-gp31-31-bhp10516052</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP325493EDZ-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Enterobacteria phage T4 Capsid assembly protein Gp31 (31)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-autographa-californica-nuclear-polyhedrosis-virus-major-envelope-glycoprotein-gp64-partial-bhp10516048</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP324635ARA1c7-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Autographa californica nuclear polyhedrosis virus Major envelope glycoprotein (GP64), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-atp-dependent-dna-helicase-recq-recq-partial-bhp10516034</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP179794Ba-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Escherichia coli ATP-dependent DNA helicase recQ (recQ), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-chorismate-mutase-chloroplastic-cm1-partial-bhp10516069</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP134794Pl-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Chorismate mutase, chloroplastic (CM1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-type-53-protein-e7-e7-bhp10516060</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP327601HNZ-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Human papillomavirus type 53  Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hydra-vulgaris-annexin-b12-anxb12-bhp10516064</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP329623HXN-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Hydra vulgaris Annexin-B12 (ANXB12)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-t4-large-terminase-protein-17-bhp10516045</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP324619EDZ_A4_-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Enterobacteria phage T4 Large terminase protein (17)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-kinesin-heavy-chain-khc-partial-biotinylated-bhp10516044</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP324608DLUj9-B-SDS.jpg?v=1782434101</image:loc>
      <image:title>Recombinant Drosophila melanogaster Kinesin heavy chain (Khc), partial, Biotinylated</image:title>
      <image:caption>Recombinant Drosophila melanogaster Kinesin heavy chain (Khc), partial, Biotinylated – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-51-protein-e7-e7-bhp10516055</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP326304HNX-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Human papillomavirus 51 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bothrops-jararaca-zinc-metalloproteinase-disintegrin-like-botrocetin-bhp10516049</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP325199BUWa2-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Bothrops jararaca Zinc metalloproteinase-disintegrin-like botrocetin</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-feline-calicivirus-capsid-protein-vp1-partial-bhp10516065</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP329722FAE-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Feline calicivirus Capsid protein VP1, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-crimean-congo-hemorrhagic-fever-virus-nucleoprotein-n-bhp10516062</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP328701CSBc7-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Crimean-Congo hemorrhagic fever virus Nucleoprotein (N)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-saccharomyces-cerevisiae-serine-threonine-protein-phosphatase-pp1-2-glc7-bhp10516079</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP335747SVG-SDS.jpg?v=1772280368</image:loc>
      <image:title>Recombinant Saccharomyces cerevisiae Serine/threonine-protein phosphatase PP1-2 (GLC7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-t4-highly-immunogenic-outer-capsid-protein-hoc-bhp10516043</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP323826EDZ-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Enterobacteria phage T4 Highly immunogenic outer capsid protein (hoc)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hantaan-virus-envelopment-polyprotein-gp-partial-bhp10516051</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP325461HCE1-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Hantaan virus Envelopment polyprotein (GP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacillus-sp-protein-rep-repa-bhp10516059</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP327509BRE-SDS.jpg?v=1772280364</image:loc>
      <image:title>Recombinant Bacillus sp Protein rep (repA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-s-adenosylmethionine-synthase-sams-bhp10516081</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP336704DLU-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Drosophila melanogaster S-adenosylmethionine synthase (Sams)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-cfa-i-fimbrial-subunit-e-cfae-bhp10516061</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP328563ENLa0-SDS.jpg?v=1772280364</image:loc>
      <image:title>Recombinant Escherichia coli CFA/I fimbrial subunit E(cfaE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-35-protein-e7-e7-bhp10516073</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP333231HNH-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Human papillomavirus 35 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-leukemia-virus-gag-polyprotein-gag-partial-bhp10516063</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP329519BKF1-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Bovine leukemia virus Gag polyprotein (gag), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-brassica-napus-cruciferin-cru1-cru1-partial-bhp10516075</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP333802BWD-SDS.jpg?v=1772280368</image:loc>
      <image:title>Recombinant Brassica napus Cruciferin CRU1 (CRU1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-candida-albicans-secreted-aspartic-protease-5-sap5-bhp10516082</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP337319CZD-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Candida albicans Secreted aspartic protease 5 (SAP5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacillus-methanolicus-nad-dependent-methanol-dehydrogenase-mdh-bhp10516066</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP330043BAUc7-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Bacillus methanolicus NAD-dependent methanol dehydrogenase (mdh)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-major-allergen-i-polypeptide-chain-2-ch2-bhp10516057</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP326973CA-SDS.jpg?v=1782242335</image:loc>
      <image:title>Recombinant Cat Major allergen I polypeptide chain 2 (CH2)</image:title>
      <image:caption>Recombinant Cat Major allergen I polypeptide chain 2 (CH2) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudoalteromonas-carrageenovora-kappa-carrageenase-cgka-bhp10516071</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP331841AIA-SDS.jpg?v=1772280364</image:loc>
      <image:title>Recombinant Pseudoalteromonas carrageenovora Kappa-carrageenase (cgkA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-tumor-necrosis-factor-tnf-partial-bhp10516050</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP325438RA-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Rat Tumor necrosis factor (Tnf), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-listeria-monocytogenes-serovar-1-2a-internalin-b-inlb-partial-bhp10516054</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP326188LPY-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Listeria monocytogenes serovar 1/2a Internalin B (inlB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycoplasma-genitalium-uncharacterized-protein-mg281-mg281-partial-bhp10516088</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP341708MLN1c7-SDS.jpg?v=1782434163</image:loc>
      <image:title>Recombinant Mycoplasma genitalium Uncharacterized protein MG281 (MG281), partial</image:title>
      <image:caption>Recombinant Mycoplasma genitalium Uncharacterized protein MG281 (MG281), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-autographa-californica-nuclear-polyhedrosis-virus-major-envelope-glycoprotein-gp64-partial-bhp10516047</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP324635ARA1b1-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Autographa californica nuclear polyhedrosis virus Major envelope glycoprotein (GP64),partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neuronal-vesicle-trafficking-associated-protein-1-nsg1-partial-bhp10516070</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP331662HU-SDS.jpg?v=1772280364</image:loc>
      <image:title>Recombinant Human Neuronal vesicle trafficking-associated protein 1 (NSG1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-30-protein-e7-e7-bhp10516077</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP334189HNC-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Human papillomavirus 30 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-guanine-nucleotide-binding-protein-g-q-subunit-alpha-gnaq-bhp10516090</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP342271HUc7-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Human Guanine nucleotide-binding protein G (q) subunit alpha (GNAQ)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-malus-domestica-1-aminocyclopropane-1-carboxylate-synthase-acs-1-bhp10516087</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP339876MPS-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Malus domestica 1-aminocyclopropane-1-carboxylate synthase (ACS-1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-triticum-aestivum-imidazoleglycerol-phosphate-dehydratase-1-chloroplastic-bhp10516080</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP335890TQN-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Triticum aestivum Imidazoleglycerol-phosphate dehydratase 1, chloroplastic</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-brassica-napus-napin-1a-partial-bhp10516084</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP338607BWD-SDS.jpg?v=1772280375</image:loc>
      <image:title>Recombinant Brassica napus Napin-1A, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-newcastle-disease-virus-hemagglutinin-neuraminidase-hn-partial-bhp10516076</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP334020NCU1-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Newcastle disease virus Hemagglutinin-neuraminidase (HN), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-glycine-max-1-aminocyclopropane-1-carboxylate-synthase-acs1-bhp10516074</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP333613GGV-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Glycine max 1-aminocyclopropane-1-carboxylate synthase (ACS1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tachypleus-tridentatus-clotting-factor-c-partial-bhp10516078</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP335355TAHa0-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Tachypleus tridentatus clotting factor C, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-probable-autotransporter-ypja-ypja-partial-bhp10516100</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP345175ENV-SDS.jpg?v=1772280371</image:loc>
      <image:title>Recombinant Escherichia coli Probable autotransporter YpjA (ypjA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-perilipin-2-plin2-bhp10516083</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP337564MO-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Mouse Perilipin-2 (Plin2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-simian-retrovirus-srv-2-gag-polyprotein-gag-partial-bhp10516096</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP343942SHN-SDS.jpg?v=1772280371</image:loc>
      <image:title>Recombinant Simian retrovirus SRV-2 Gag polyprotein (gag), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bradyrhizobium-sp-chitooligosaccharide-deacetylase-nodb-bhp10516094</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP343474BLKe0-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Bradyrhizobium sp. Chitooligosaccharide deacetylase (nodB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-simian-retrovirus-srv-2-envelope-glycoprotein-env-partial-bhp10516092</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP343164SHO-SDS.jpg?v=1772280368</image:loc>
      <image:title>Recombinant Simian retrovirus SRV-2 Envelope glycoprotein (env), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-candida-albicans-hyphally-regulated-protein-hyr1-partial-bhp10516098</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP344392CZF-SDS.jpg?v=1772280371</image:loc>
      <image:title>Recombinant Candida albicans Hyphally-regulated protein (HYR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycoplasma-genitalium-uncharacterized-protein-mg281-mg281-partial-bhp10516089</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP341708MLN2-SDS.jpg?v=1782434104</image:loc>
      <image:title>Recombinant Mycoplasma genitalium Uncharacterized protein MG281 (MG281), partial</image:title>
      <image:caption>Recombinant Mycoplasma genitalium Uncharacterized protein MG281 (MG281), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-68-protein-e7-e7-bhp10516103</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP346576HOK-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Human papillomavirus 68 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-glycine-max-stress-induced-protein-sam22-pr-10-bhp10516072</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP333215GGV-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Glycine max Stress-induced protein SAM22 (PR-10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-type-26-protein-e7-e7-bhp10516086</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP339739HMW-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Human papillomavirus type 26 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tomato-bushy-stunt-virus-rna-silencing-suppressor-p19-bhp10516099</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP344659TFX-SDS.jpg?v=1772280368</image:loc>
      <image:title>Recombinant Tomato bushy stunt virus RNA silencing suppressor p19</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-70-protein-e7-e7-bhp10516091</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP342705HOQ-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Human papillomavirus 70 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bartonella-henselae-probable-periplasmic-serine-endoprotease-degp-like-htra-bhp10516102</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP345817BSG-SDS.jpg?v=1772280370</image:loc>
      <image:title>Recombinant Bartonella henselae Probable periplasmic serine endoprotease DegP-like (htrA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-endogenous-retrovirus-group-k-member-113-pro-protein-hervk-113-bhp10516106</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP351212HU-SDS.jpg?v=1772280370</image:loc>
      <image:title>Recombinant Human Endogenous retrovirus group K member 113 Pro protein (HERVK_113)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-metallothionein-1-mt1-bhp10516112</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP355875MO-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Mouse Metallothionein-1 (Mt1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pentadiplandra-brazzeana-defensin-like-protein-bhp10516104</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP347673PFG-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Pentadiplandra brazzeana Defensin-like protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-putative-endogenous-retrovirus-group-k-member-11-1-env-polyprotein-ervk11-1-bhp10516105</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP350358HU-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Human Putative endogenous retrovirus group K member 11-1 Env polyprotein (ERVK11-1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-puumala-virus-nucleoprotein-n-bhp10516068</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP331277PXH-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Puumala virus Nucleoprotein (N)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-type-34-protein-e7-e7-bhp10516067</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP330647HNG-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Human papillomavirus type 34 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hla-class-i-histocompatibility-antigen-c-alpha-chain-hla-c-partial-bhp10516058</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP326978HU-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Human HLA class I histocompatibility antigen, C alpha chain (HLA-C), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-salmonella-typhimurium-phase-2-flagellin-fljb-partial-bhp10516101</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP345218SXB-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Salmonella typhimurium Phase 2 flagellin (fljB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bradyrhizobium-sp-chitooligosaccharide-deacetylase-nodb-bhp10516093</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP343474BLK-SDS.jpg?v=1772280368</image:loc>
      <image:title>Recombinant Bradyrhizobium sp. Chitooligosaccharide deacetylase (nodB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-atp-dependent-clp-protease-proteolytic-subunit-clpp-bhp10516107</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP351918SKX-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Staphylococcus aureus ATP-dependent Clp protease proteolytic subunit (clpP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-falciparum-merozoite-surface-protein-2-msp2-partial-bhp10516095</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP343481EWPf0-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Plasmodium falciparum Merozoite surface protein 2 (MSP2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-brassica-napus-napin-1a-partial-bhp10516085</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP338607BWDc7-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Brassica napus Napin-1A, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-tryptophan-trna-ligase-trps-bhp10516109</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP355581ENV-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Escherichia coli Tryptophan--tRNA ligase (trpS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-latent-membrane-protein-1-lmp1-partial-bhp10516113</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP355987EFA1-SDS.jpg?v=1772280370</image:loc>
      <image:title>Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-endogenous-retrovirus-group-k-member-25-env-polyprotein-ervk-25-partial-bhp10516108</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP352224HU1c7-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Human Endogenous retrovirus group K member 25 Env polyprotein (ERVK-25), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-simian-retrovirus-srv-2-gag-pro-polyprotein-pro-partial-bhp10516097</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP344347SHN-SDS.jpg?v=1772280370</image:loc>
      <image:title>Recombinant Simian retrovirus SRV-2 Gag-Pro polyprotein (pro), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-atrax-robustus-delta-hexatoxin-ar1a-bhp10516110</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP355657AVG-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Atrax robustus Delta-hexatoxin-Ar1a</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-insulin-like-growth-factor-i-igf1-bhp10516117</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356436HUc7-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Human Insulin-like growth factor I (IGF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-transcription-termination-factor-rho-rho-bhp10516131</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP166274Ba-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Escherichia coli Transcription termination factor Rho (rho)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-atrax-robustus-delta-hexatoxin-ar1a-bhp10516111</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP355657AVGe0-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Atrax robustus Delta-hexatoxin-Ar1a</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-meromycolate-extension-acyl-carrier-protein-acpm-bhp10516125</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP358590MVZa0-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis Meromycolate extension acyl carrier protein (acpM)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-neisseria-gonorrhoeae-probable-peptidoglycan-d-d-transpeptidase-pena-pena-partial-bhp10516120</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP357310NFZ-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Neisseria gonorrhoeae Probable peptidoglycan D,D-transpeptidase PenA (penA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-nad-kinase-nadk-bhp10516126</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP358949ENV-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Escherichia coli NAD kinase (nadK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-virus-qbeta-capsid-protein-bhp10516114</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356100FQZe0-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Escherichia virus Qbeta Capsid protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-aminoglycoside-3-9-adenylyltransferase-aada-bhp10516130</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360352ENLc7-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Escherichia coli Aminoglycoside (3&apos;&apos;) (9) adenylyltransferase (aadA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-aminoglycoside-3-9-adenylyltransferase-aada-bhp10516129</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360352ENL-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Escherichia coli Aminoglycoside (3&apos;&apos;) (9) adenylyltransferase (aadA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-salmonella-typhimurium-cdp-abequose-synthase-rfbj-bhp10516124</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP358099SXB-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Salmonella typhimurium CDP-abequose synthase (rfbJ)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-small-ribosomal-subunit-protein-us3-rpsc-bhp10516127</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP359038ENVc0-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Escherichia coli Small ribosomal subunit protein uS3 (rpsC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunodeficiency-virus-type-1-group-m-subtype-b-protein-rev-rev-bhp10516115</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356309HKP-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Rev (rev)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-dna-mismatch-repair-protein-muth-muth-bhp10516119</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356924ENV-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Escherichia coli DNA mismatch repair protein mutH (mutH)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-pepsin-a-pga-bhp10516134</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360581PI-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Pig Pepsin A (PGA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mumps-virus-fusion-glycoprotein-f0-f-partial-biotinylated-bhp10516122</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP357683MJK1-B-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Mumps virus Fusion glycoprotein F0 (F), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-simian-retrovirus-srv-1-gag-polyprotein-gag-partial-bhp10516141</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361194SHM-SDS.jpg?v=1772280375</image:loc>
      <image:title>Recombinant Simian retrovirus SRV-1 Gag polyprotein (gag), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hantaan-virus-nucleoprotein-n-bhp10516146</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361470HCB-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Hantaan virus Nucleoprotein (N)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-phospholipase-c-hlb-bhp10516123</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP357824FKZ-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Staphylococcus aureus Phospholipase C (hlb)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-dna-helicase-ii-uvrd-bhp10516137</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360936ENVa0-SDS.jpg?v=1782434124</image:loc>
      <image:title>Recombinant Escherichia coli DNA helicase II (uvrD)</image:title>
      <image:caption>Recombinant Escherichia coli DNA helicase II (uvrD) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-renin-2-ren2-partial-bhp10516136</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP170594m-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Mouse Renin-2 (Ren2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-foot-and-mouth-disease-virus-serotype-o-genome-polyprotein-partial-bhp10516139</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361015FCJ-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Foot-and-mouth disease virus serotype O Genome polyprotein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-capsid-scaffolding-protein-partial-bhp10516138</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360995EFA-SDS.jpg?v=1772280377</image:loc>
      <image:title>Recombinant Epstein-Barr virus Capsid scaffolding protein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-rna-polymerase-sigma-factor-rpod-rpod-bhp10516132</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360419ENV-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Escherichia coli RNA polymerase sigma factor rpoD (rpoD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-low-molecular-weight-protein-tyrosine-phosphatase-wzb-wzb-biotinylated-bhp10516154</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP364465ENV-B-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Escherichia coli Low molecular weight protein-tyrosine-phosphatase Wzb (wzb), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-bovis-immunogenic-protein-mpb70-mpb70-bhp10516151</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP363818MVH-SDS.jpg?v=1772280375</image:loc>
      <image:title>Recombinant Mycobacterium bovis Immunogenic protein MPB70 (mpb70)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-co-chaperonin-groes-groes-bhp10516161</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP404273MON-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bordetella-pertussis-pertussis-toxin-subunit-1-ptxa-biotinylated-bhp10516116</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356423BUA-B-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-schistosoma-japonicum-glutathione-s-transferase-class-mu-26-kda-isozyme-bhp10516121</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP357414SXP-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-lysine-trna-ligase-lyss-bhp10516153</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP364194ENV-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Escherichia coli Lysine--tRNA ligase (lysS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-colicin-ia-cia-626-i-i-asvkvsckasgytftnygmnwvkqapgqglkwmgwqqhyitpltfgagtkveik-bhp10516149</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361926ENLe1_M3_-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Escherichia coli Colicin-Ia (cia) (626:I→I-ASVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGWQQHYITPLTFGAGTKVEIK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-bovis-immunogenic-protein-mpb70-mpb70-biotinylated-bhp10516152</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP363818MVH-B-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Mycobacterium bovis Immunogenic protein MPB70 (mpb70), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-t4-major-capsid-protein-gp23-bhp10516142</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361291EDZ_A4_-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Enterobacteria phage T4 Major capsid protein (gp23)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bunyavirus-snowshoe-hare-envelopment-polyprotein-gp-partial-bhp10516143</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361398BNQ-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Bunyavirus snowshoe hare Envelopment polyprotein (GP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-iron-regulated-surface-determinant-protein-b-isdb-partial-bhp10516162</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP411540FLG-SDS.jpg?v=1772280392</image:loc>
      <image:title>Recombinant Staphylococcus aureus Iron-regulated surface determinant protein B (isdB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-bacterioferritin-bfr-bhp10516155</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP364636ENV-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Escherichia coli Bacterioferritin (bfr)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o17-k52-h18-chorismate-synthase-aroc-bhp10516165</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP486248EOG-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Escherichia coli O17:K52:H18 Chorismate synthase (aroC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-moloney-murine-leukemia-virus-envelope-glycoprotein-env-partial-bhp10516140</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361038MHK-SDS.jpg?v=1772280379</image:loc>
      <image:title>Recombinant Moloney murine leukemia virus Envelope glycoprotein (env), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-angiopoietin-related-protein-4-angptl4-bhp10516163</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP4186MOa0-SDS.jpg?v=1772280379</image:loc>
      <image:title>Recombinant Mouse Angiopoietin-related protein 4 (Angptl4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-falciparum-merozoite-surface-protein-1-msp1-partial-bhp10516144</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361416EWT1-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Plasmodium falciparum Merozoite surface protein 1 (MSP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-porcine-reproductive-and-respiratory-syndrome-virus-glycoprotein-4-gp4-partial-bhp10516160</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP368832PYZ1-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 4 (GP4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycolicibacterium-smegmatis-3-oxosteroid-1-dehydrogenase-ksdd-bhp10516159</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP368051MVXc7-SDS.jpg?v=1772280377</image:loc>
      <image:title>Recombinant Mycolicibacterium smegmatis 3-oxosteroid 1-dehydrogenase (ksdD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-epstein-barr-nuclear-antigen-6-ebna6-partial-bhp10516157</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP365875EFA-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 6 (EBNA6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-syringae-pv-syringae-ice-nucleation-protein-inaz-partial-bhp10516118</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356891PWD-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Pseudomonas syringae pv. syringae Ice nucleation protein (inaZ), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-falciparum-merozoite-surface-protein-1-msp1-partial-bhp10516145</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361416EWT2a0-SDS.jpg?v=1772280400</image:loc>
      <image:title>Recombinant Plasmodium falciparum Merozoite surface protein 1 (MSP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-pepsin-a-pga-bhp10516135</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360581PIb1-SDS.jpg?v=1772280377</image:loc>
      <image:title>Recombinant Pig Pepsin A(PGA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-phage-ms2-capsid-protein-bhp10516158</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP365998ECZd7-SDS.jpg?v=1772280375</image:loc>
      <image:title>Recombinant Escherichia phage MS2 Capsid protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arachis-hypogaea-glycinin-arah3-partial-bhp10516166</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP4900ANE1-SDS.jpg?v=1772280377</image:loc>
      <image:title>Recombinant Arachis hypogaea Glycinin (Arah3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o157-h7-putative-nad-p-h-nitroreductase-ydja-ydja-bhp10516156</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP364881EOD-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Escherichia coli O157:H7 Putative NAD(P)H nitroreductase YdjA (ydjA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-strongyloides-stercoralis-l3nieag-01-l3nie-01-x208y-x221w-partial-bhp10516167</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP4964GLF-SDS.jpg?v=1782434293</image:loc>
      <image:title>Recombinant Strongyloides stercoralis L3NieAg.01 (L3Nie.01) (X208Y,X221W), partial</image:title>
      <image:caption>Recombinant Strongyloides stercoralis L3NieAg.01 (L3Nie.01) (X208Y,X221W), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-alanine-trna-ligase-alas-partial-bhp10516133</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360465ENV-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Escherichia coli Alanine--tRNA ligase (alaS), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-phage-phi6-major-outer-capsid-protein-p8-bhp10516150</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP362169PUV-SDS.jpg?v=1772280375</image:loc>
      <image:title>Recombinant Pseudomonas phage phi6 Major outer capsid protein (P8)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-polypeptide-related-sequence-b-micb-partial-bhp10516175</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5607HU1-SDS.jpg?v=1772280395</image:loc>
      <image:title>Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-polypeptide-related-sequence-b-micb-partial-bhp10516176</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5607HU1a0-SDS.jpg?v=1782434275</image:loc>
      <image:title>Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial</image:title>
      <image:caption>Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-esat-6-like-protein-esxk-esxk-bhp10516172</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP517353MVZ-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis ESAT-6-like protein EsxK (esxK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunodeficiency-virus-type-1-group-m-subtype-c-protein-tat-tat-bhp10516169</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP515530HXB-SDS.jpg?v=1772280393</image:loc>
      <image:title>Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Tat (tat)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-platelet-derived-growth-factor-subunit-b-partial-bhp10516179</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5629PI1-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Pig Platelet-derived growth factor subunit B, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-schizosaccharomyces-pombe-alpha-n-terminal-protein-methyltransferase-1-tae1-bhp10516170</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP515579SXV-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Schizosaccharomyces pombe Alpha N-terminal protein methyltransferase 1 (tae1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-lipocalin-can-f-6-0101-bhp10516164</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP4240DO-SDS.jpg?v=1782434208</image:loc>
      <image:title>Recombinant Dog Lipocalin Can f 6.0101</image:title>
      <image:caption>Recombinant Dog Lipocalin Can f 6.0101 – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-aerobic-respiration-control-protein-arca-arca-bhp10516128</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP359331ENV-SDS.jpg?v=1782434264</image:loc>
      <image:title>Recombinant Escherichia coli Aerobic respiration control protein ArcA (arcA)</image:title>
      <image:caption>Recombinant Escherichia coli Aerobic respiration control protein ArcA (arcA) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pectobacterium-cypripedii-gluconate-2-dehydrogenase-flavoprotein-partial-bhp10516171</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP516466ESR-SDS.jpg?v=1772280377</image:loc>
      <image:title>Recombinant Pectobacterium cypripedii Gluconate 2-dehydrogenase flavoprotein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mitochondrial-processing-peptidase-subunit-alpha-pmpca-bhp10516182</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP606021HU-SDS.jpg?v=1772280384</image:loc>
      <image:title>Recombinant Human Mitochondrial-processing peptidase subunit alpha (PMPCA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-polypeptide-related-sequence-b-micb-partial-bhp10516177</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5607HU2-SDS.jpg?v=1772280379</image:loc>
      <image:title>Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-aquifex-aeolicus-reverse-gyrase-2-rgy2-partial-bhp10516173</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP524126DNV1-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Aquifex aeolicus Reverse gyrase 2 (rgy2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cytosolic-carboxypeptidase-6-agbl4-bhp10516180</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP600702MO-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Mouse Cytosolic carboxypeptidase 6 (Agbl4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-arginine-rich-splicing-factor-9-srsf9-bhp10516196</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP618767HUc7-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Human Serine/arginine-rich splicing factor 9 (SRSF9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-striatin-3-strn3-bhp10516189</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP614388HUd7-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Human Striatin-3 (STRN3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-polypeptide-related-sequence-b-micb-partial-bhp10516178</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5607HU2a0-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-shikimate-kinase-2-arol-bhp10516168</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP513312ENU-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Escherichia coli Shikimate kinase 2 (aroL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-receptor-type-tyrosine-protein-phosphatase-like-n-ptprn-partial-bhp10516187</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP613703HUf3-SDS.jpg?v=1772280387</image:loc>
      <image:title>Recombinant Human Receptor-type tyrosine-protein phosphatase-like N (PTPRN), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hevea-brasiliensis-small-rubber-particle-protein-srpp-bhp10516174</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP530569HWI-SDS.jpg?v=1772280382</image:loc>
      <image:title>Recombinant Hevea brasiliensis Small rubber particle protein (SRPP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-s-phase-kinase-associated-protein-2-skp2-bhp10516184</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP613392HUc7-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Human S-phase kinase-associated protein 2 (SKP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-phosphoenolpyruvate-carboxykinase-gtp-mitochondrial-pck2-bhp10516198</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP619092HU-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Human Phosphoenolpyruvate carboxykinase [GTP], mitochondrial (PCK2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-thioredoxin-reductase-1-cytoplasmic-txnrd1-partial-bhp10516188</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP613705HU-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Human Thioredoxin reductase 1, cytoplasmic (TXNRD1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-forkhead-box-protein-c1-foxc1-bhp10516195</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP618640HUc7-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Human Forkhead box protein C1 (FOXC1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-pyrroline-5-carboxylate-reductase-2-pycr2-bhp10516199</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP619159BO-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Bovine Pyrroline-5-carboxylate reductase 2 (PYCR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-tissue-factor-pathway-inhibitor-tfpi-bhp10516209</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP636742MOW-SDS.jpg?v=1772280384</image:loc>
      <image:title>Recombinant Macaca mulatta Tissue factor pathway inhibitor (TFPI)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudoalteromonas-carrageenovora-lambda-carrageenase-cgla-bhp10516181</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP605219AIA_A4_-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Pseudoalteromonas carrageenovora Lambda-carrageenase (cglA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-caenorhabditis-elegans-transcription-factor-elt-2-elt-2-bhp10516183</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP607427CXY-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Caenorhabditis elegans Transcription factor elt-2 (elt-2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-prunus-persica-uncharacterized-protein-bhp10516208</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6299EZK-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Prunus persica Uncharacterized protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-caspase-8-casp8-partial-bhp10516204</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP621791HUc7-SDS.jpg?v=1772280385</image:loc>
      <image:title>Recombinant Human Caspase-8 (CASP8), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lanosterol-14-alpha-demethylase-cyp51a1-partial-bhp10516191</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP614993HU1-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Human Lanosterol 14-alpha demethylase (CYP51A1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lim-and-sh3-domain-protein-1-lasp1-partial-bhp10516186</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP613523HU1-SDS.jpg?v=1772280384</image:loc>
      <image:title>Recombinant Human LIM and SH3 domain protein 1 (LASP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sequestosome-1-sqstm1-bhp10516192</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP615696HU-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Human Sequestosome-1 (SQSTM1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-angio-associated-migratory-cell-protein-aamp-bhp10516193</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP615711HU-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Human Angio-associated migratory cell protein (AAMP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-secretory-phospholipase-a2-receptor-pla2r1-partial-bhp10516207</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP623780HUc7-SDS.jpg?v=1782237723</image:loc>
      <image:title>Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial</image:title>
      <image:caption>Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-elav-like-protein-1-elavl1-bhp10516197</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP618993HUa0-SDS.jpg?v=1772280382</image:loc>
      <image:title>Recombinant Human ELAV-like protein 1 (ELAVL1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lymphocyte-antigen-6k-ly6k-bhp10516201</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP621061HUa0-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Human Lymphocyte antigen 6K (LY6K)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-clostridioides-difficile-cell-wall-binding-cysteine-protease-cwp84-lytc-12-c116a-partial-bhp10516211</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6373GLX1_M_-SDS.jpg?v=1782433683</image:loc>
      <image:title>Recombinant Clostridioides difficile Cell wall-binding cysteine protease Cwp84 (lytC_12) (C116A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-threonine-protein-kinase-atr-atr-partial-biotinylated-bhp10516205</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP622666HU-B-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Human Serine/threonine-protein kinase ATR (ATR), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-risc-loading-complex-subunit-tarbp2-tarbp2-bhp10516206</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP623007HUa0-SDS.jpg?v=1772280457</image:loc>
      <image:title>Recombinant Human RISC-loading complex subunit TARBP2 (TARBP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-zinc-finger-hit-domain-containing-protein-3-znhit3-bhp10516194</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP618012HU-SDS.jpg?v=1772280379</image:loc>
      <image:title>Recombinant Human Zinc finger HIT domain-containing protein 3 (ZNHIT3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-krueppel-like-factor-5-klf5-bhp10516185</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP613429HUa0-SDS.jpg?v=1782309376</image:loc>
      <image:title>Recombinant Human Krueppel-like factor 5 (KLF5)</image:title>
      <image:caption>Recombinant Human Krueppel-like factor 5 (KLF5) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nadh-dehydrogenase-ubiquinone-1-alpha-subcomplex-subunit-5-ndufa5-bhp10516190</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP614988HU-SDS.jpg?v=1772280384</image:loc>
      <image:title>Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 (NDUFA5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-francisella-tularensis-subsp-lps-assembly-protein-lptd-lptd-partial-bhp10516221</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP642814FCO-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Francisella tularensis subsp LPS-assembly protein lptD (lptD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-deoxyribonuclease-gamma-dnase1l3-bhp10516203</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP621686HUa0-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Human Deoxyribonuclease gamma (DNASE1L3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dual-specificity-protein-phosphatase-4-dusp4-bhp10516200</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP619752HU-SDS.jpg?v=1782434177</image:loc>
      <image:title>Recombinant Human Dual specificity protein phosphatase 4 (DUSP4)</image:title>
      <image:caption>Recombinant Human Dual specificity protein phosphatase 4 (DUSP4) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-clostridioides-difficile-cell-wall-binding-cysteine-protease-cwp84-lytc-12-c116a-partial-bhp10516210</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6373GLX1b0_M_-SDS.jpg?v=1782433679</image:loc>
      <image:title>Recombinant Clostridioides difficile Cell wall-binding cysteine protease Cwp84 (lytC_12) (C116A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-ehrlichia-chaffeensis-co-chaperonin-groes-groes-bhp10516213</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP640331EJS-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-xenopus-laevis-bic-c-protein-bic-c-h140a-s141a-partial-bhp10516218</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6418XBE_M_-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Xenopus laevis Bic-C protein (Bic-C) (H140A,S141A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-receptor-superfamily-member-16-ngfr-partial-biotinylated-bhp10516212</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6393MO1-B-SDS.jpg?v=1772280385</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor receptor superfamily member 16 (Ngfr), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-binding-protein-ikaros-ikzf1-bhp10516202</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP621668HUc7-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Human DNA-binding protein Ikaros (IKZF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-malariae-merozoite-surface-protein-1-msp1-partial-bhp10516226</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6487PMO-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Plasmodium malariae Merozoite surface protein 1 (MSP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-listeria-phage-a511-endolysin-ply511-bhp10516231</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP654324LBAH-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Listeria phage A511 Endolysin (PLY511)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neutrophil-elastase-elane-bhp10516233</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP659740MO-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Mouse Neutrophil elastase (Elane)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-polyubiquitin-14-ubq14-bhp10516234</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP661648DOA-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Polyubiquitin 14 (UBQ14)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-sesamum-indicum-2s-albumin-loc105174067-bhp10516242</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6697SYP-SDS.jpg?v=1782434182</image:loc>
      <image:title>Recombinant Sesamum indicum 2S albumin (LOC105174067)</image:title>
      <image:caption>Recombinant Sesamum indicum 2S albumin (LOC105174067) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-aspergillus-oryzae-probable-pectate-lyase-e-plye-bhp10516228</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP652707DPA-SDS.jpg?v=1772280385</image:loc>
      <image:title>Recombinant Aspergillus oryzae Probable pectate lyase E (plyE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-xenopus-laevis-bic-c-protein-bic-c-partial-bhp10516217</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6418XBE-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Xenopus laevis Bic-C protein (Bic-C), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-scavenger-receptor-cysteine-rich-type-1-protein-m130-cd163-partial-bhp10516227</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP649669PI-SDS.jpg?v=1782434276</image:loc>
      <image:title>Recombinant Pig Scavenger receptor cysteine-rich type 1 protein M130 (CD163), partial</image:title>
      <image:caption>Recombinant Pig Scavenger receptor cysteine-rich type 1 protein M130 (CD163), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-udp-glucuronosyltransferase-3a2-ugt3a2-partial-bhp10516238</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP667485HU-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Human UDP-glucuronosyltransferase 3A2 (UGT3A2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-oryza-sativa-subsp-japonica-os05g0317700-protein-partial-bhp10516236</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6636OFG-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Oryza sativa subsp. japonica Os05g0317700 protein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-transposase-for-transposon-tn5-tnpa-e54k-l372p-bhp10516240</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP669378ENL_M_h9-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Escherichia coli Transposase for transposon Tn5 (tnpA) (E54K,L372P)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-humulus-japonicus-humj1-bhp10516241</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6694HZL-SDS.jpg?v=1782434258</image:loc>
      <image:title>Recombinant Humulus japonicus Humj1</image:title>
      <image:caption>Recombinant Humulus japonicus Humj1 – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-neisseria-gonorrhoeae-ribonuclease-hii-rnhb-bhp10516250</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP682770NGAa0-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Neisseria gonorrhoeae Ribonuclease HII (rnhB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-francisella-tularensis-subsp-holarctica-chaperone-protein-dnak-dnak-partial-bhp10516222</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP644976FCO-SDS.jpg?v=1772280382</image:loc>
      <image:title>Recombinant Francisella tularensis subsp. holarctica Chaperone protein DnaK (dnaK), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-tumor-associated-calcium-signal-transducer-2-tacstd2-partial-bhp10516232</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6581MOV-SDS.jpg?v=1772280387</image:loc>
      <image:title>Recombinant Macaca fascicularis tumor-associated calcium signal transducer 2 (TACSTD2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calcium-binding-protein-39-cab39-bhp10516216</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP640939HU-SDS.jpg?v=1772280396</image:loc>
      <image:title>Recombinant Human Calcium-binding protein 39(CAB39)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-neisseria-gonorrhoeae-glyceraldehyde-3-phosphate-dehydrogenase-gapa-bhp10516224</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6458NGA-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Neisseria gonorrhoeae Glyceraldehyde-3-phosphate dehydrogenase (gapA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycoplasma-hyorhinis-variant-surface-antigen-e-vlpe-bhp10516246</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP673204MLR1-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Mycoplasma hyorhinis Variant surface antigen E (vlpE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-neisseria-gonorrhoeae-ribonuclease-hii-rnhb-bhp10516249</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP682770NGA-SDS.jpg?v=1772280387</image:loc>
      <image:title>Recombinant Neisseria gonorrhoeae Ribonuclease HII (rnhB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-pseudoobscura-pseudoobscura-neutral-ceramidase-cdase-partial-bhp10516223</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP645868DME-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Drosophila pseudoobscura pseudoobscura Neutral ceramidase (CDase), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hexokinase-hkdc1-hkdc1-partial-bhp10516225</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP647983HU-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Human Hexokinase HKDC1 (HKDC1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-danio-rerio-aerolysin-like-protein-loc795232-bhp10516235</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6621DIL-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Danio rerio Aerolysin-like protein (LOC795232)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-2-il2-bhp10516215</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP640916MOV-SDS.jpg?v=1772280385</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin-2 (IL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-artemisia-vulgaris-art-v-2-allergen-art-v-2-bhp10516245</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6719AOH-SDS.jpg?v=1782434213</image:loc>
      <image:title>Recombinant Artemisia vulgaris Art v 2 allergen (art v 2)</image:title>
      <image:caption>Recombinant Artemisia vulgaris Art v 2 allergen (art v 2) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-auxin-responsive-protein-iaa3-iaa3-bhp10516229</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP653623DOA-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Auxin-responsive protein IAA3 (IAA3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-2-5-oligoadenylate-synthase-1-oas1-partial-bhp10516214</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/Cusabio_Protein_Placeholder_eeed8b58-238f-4bc5-8418-e9d00c47e911.jpg?v=1784925933</image:loc>
      <image:title>Recombinant Human 2&apos;-5&apos;-oligoadenylate synthase 1 (OAS1) , partial</image:title>
      <image:caption>Recombinant Human 2&apos;-5&apos;-oligoadenylate synthase 1 (OAS1) , partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-phosphatidylinositol-4-5-bisphosphate-3-kinase-catalytic-subunit-alpha-isoform-pik3ca-k802a-partial-bhp10516244</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6713RA1_M_-SDS.jpg?v=1782433693</image:loc>
      <image:title>Recombinant Rat Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (Pik3ca) (K802A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-aeruginosa-popb-popb-partial-bhp10516256</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6850EZW1-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Pseudomonas aeruginosa PopB (popB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacteroides-gingivalis-major-fimbrial-subunit-protein-type-2-fima-bhp10516252</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP684398PQP-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Bacteroides gingivalis Major fimbrial subunit protein type-2 (fimA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hereditary-hemochromatosis-protein-hfe-partial-bhp10516230</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP653744HUc7-SDS.jpg?v=1782434410</image:loc>
      <image:title>Recombinant Human Hereditary hemochromatosis protein (HFE), partial</image:title>
      <image:caption>Recombinant Human Hereditary hemochromatosis protein (HFE), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-xenopus-laevis-bic-c-protein-bic-c-d166a-partial-bhp10516219</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6418XBE_M1_-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Xenopus laevis Bic-C protein (Bic-C) (D166A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-mas-related-g-protein-coupled-receptor-member-b2-mrgprb2-partial-bhp10516237</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP665973MO1-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Mouse Mas-related G-protein coupled receptor member B2 (Mrgprb2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-adelphocoris-lineolatus-odorant-binding-protein-1-bhp10516264</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6892INR-SDS.jpg?v=1772280387</image:loc>
      <image:title>Recombinant Adelphocoris lineolatus Odorant-binding protein 1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-phosphatidylinositol-4-5-bisphosphate-3-kinase-catalytic-subunit-alpha-isoform-pik3ca-partial-bhp10516243</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6713RA1-SDS.jpg?v=1782242337</image:loc>
      <image:title>Recombinant Rat Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (Pik3ca), partial</image:title>
      <image:caption>Recombinant Rat Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (Pik3ca), part – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516255</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP684467HU6-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-taxus-cuspidata-tubulin-beta-chain-bhp10516239</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6687FTB-SDS.jpg?v=1772280385</image:loc>
      <image:title>Recombinant Taxus cuspidata Tubulin beta chain</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-anopheles-gambiae-agap010489-pa-obp-4-bhp10516262</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6890BZL-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Anopheles gambiae AGAP010489-PA (OBP-4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516253</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP684467HU4-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-osmia-cornuta-odorant-binding-protein-1-bhp10516265</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6893INS-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Osmia cornuta Odorant-binding protein 1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bordetella-pertussis-brka-autotransporter-brka-partial-bhp10516247</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP673803BUA-SDS.jpg?v=1772280385</image:loc>
      <image:title>Recombinant Bordetella pertussis BrkA autotransporter (brkA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-anopheles-gambiae-agap011647-pa-obp1-partial-bhp10516261</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6889BZL-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Anopheles gambiae AGAP011647-PA (Obp1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tetraodon-nigroviridis-n-acetyltaurine-hydrolase-pter-bhp10516251</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP684000TCA-SDS.jpg?v=1782434225</image:loc>
      <image:title>Recombinant Tetraodon nigroviridis N-acetyltaurine hydrolase (pter)</image:title>
      <image:caption>Recombinant Tetraodon nigroviridis N-acetyltaurine hydrolase (pter) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-anopheles-gambiae-agap008055-pa-csp3-bhp10516267</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6895BZL-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Anopheles gambiae AGAP008055-PA (CSP3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-akirin-2-akirin2-bhp10516269</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP690478HU-SDS.jpg?v=1772280409</image:loc>
      <image:title>Recombinant Human Akirin-2 (AKIRIN2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-candida-albicans-exocyst-subunit-sec10-bhp10516268</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6903CZD_A4_-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Candida albicans Exocyst subunit (SEC10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-fprl1-inhibitory-protein-flr-bhp10516220</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP641975SKZ-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Staphylococcus aureus FPRL1 inhibitory protein (flr)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-sitophilus-zeamais-odorant-binding-protein-1-obp1-partial-bhp10516260</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6888INQ-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Sitophilus zeamais Odorant binding protein 1 (OBP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-helicoverpa-armigera-obp7-bhp10516270</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6907HVA-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Helicoverpa armigera OBP7</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-usherin-ush2a-partial-bhp10516276</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7006MOV4-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Macaca fascicularis Usherin (USH2A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-protoporphyrinogen-oxidase-2-chloroplastic-mitochondrial-ppox2-bhp10516272</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6910D0A-SDS.jpg?v=1772280390</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Protoporphyrinogen oxidase 2,chloroplastic/mitochondrial (PPOX2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516254</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP684467HU5-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-uncharacterized-protein-c8orf34-c8orf34-bhp10516248</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP675467HU-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Human Uncharacterized protein C8orf34 (C8orf34)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ump-cmp-kinase-2-mitochondrial-cmpk2-bhp10516257</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP688686HU-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Human UMP-CMP kinase 2, mitochondrial (CMPK2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-norovirus-hu-gii-4-sydney-nsw0514-2012-au-vp1-partial-bhp10516274</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6933IOA-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Norovirus Hu/GII.4/Sydney/NSW0514/2012/AU VP1, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-aeruginosa-lipase-lipc-lipc-bhp10516273</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6920INX-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Pseudomonas aeruginosa Lipase LipC (lipC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-polyadenylate-binding-protein-1-like-pabpc1l-bhp10516281</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP706330HU-SDS.jpg?v=1782434227</image:loc>
      <image:title>Recombinant Human Polyadenylate-binding protein 1-like (PABPC1L)</image:title>
      <image:caption>Recombinant Human Polyadenylate-binding protein 1-like (PABPC1L) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-aeruginosa-type-iii-secretion-system-protein-pcrv-bhp10516271</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6908EZW-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Pseudomonas aeruginosa Type III secretion system protein (pcrV)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cylas-formicarius-odorant-binding-protein-obp1-bhp10516258</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6886INP-SDS.jpg?v=1772280387</image:loc>
      <image:title>Recombinant Cylas formicarius Odorant binding protein (OBP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-stenotrophomonas-maltophilia-dicamba-o-demethylase-oxygenase-component-ddmc-bhp10516284</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7065SLU-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Stenotrophomonas maltophilia Dicamba O-demethylase, oxygenase component (ddmC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-immunodominant-staphylococcal-antigen-b-isab-bhp10516277</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP705184FLB-SDS.jpg?v=1782237724</image:loc>
      <image:title>Recombinant Staphylococcus aureus Immunodominant staphylococcal antigen B (isaB)</image:title>
      <image:caption>Recombinant Staphylococcus aureus Immunodominant staphylococcal antigen B (isaB) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ferm-domain-containing-5-frmd5-bhp10516278</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7056HU-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Human FERM domain containing 5 (FRMD5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-lactobacillus-acidophilus-l-lactate-dehydrogenase-1-ldh1-bhp10516259</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP688817LME-SDS.jpg?v=1772280390</image:loc>
      <image:title>Recombinant Lactobacillus acidophilus L-lactate dehydrogenase 1 (ldh1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ferm-domain-containing-5-frmd5-bhp10516279</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7056HUa0-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Human FERM domain containing 5 (FRMD5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-polyadenylate-binding-protein-1-like-pabpc1l-bhp10516282</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP706330HUc7-SDS.jpg?v=1772280392</image:loc>
      <image:title>Recombinant Human Polyadenylate-binding protein 1-like (PABPC1L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-s100a8-s100a9-heterodimer-protein-bhp10516285</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7076MO-SDS.jpg?v=1772280467</image:loc>
      <image:title>Recombinant Mouse S100a8/S100a9 Heterodimer protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kita-kyushu-lung-cancer-antigen-1-ct83-bhp10516288</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP711093HUc7-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-influenza-a-virus-neuraminidase-na-partial-bhp10516275</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6944IOC-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Influenza A virus Neuraminidase (NA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neurogenic-differentiation-factor-1-neurod1-bhp10516300</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720182MOc7-SDS.jpg?v=1772280467</image:loc>
      <image:title>Recombinant Mouse Neurogenic differentiation factor 1 (Neurod1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-diaphorina-citri-general-odorant-binding-protein-3-loc103507602-bhp10516266</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6894INT-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Diaphorina citri General odorant-binding protein 3 (LOC103507602)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-replication-initiation-protein-repa-partial-bhp10516283</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP706568ENL-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Replication initiation protein (repA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-nad-dependent-protein-deacylase-sirtuin-5-mitochondrial-sirt5-bhp10516293</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP715034RA-SDS.jpg?v=1772280470</image:loc>
      <image:title>Recombinant Rat NAD-dependent protein deacylase sirtuin-5, mitochondrial (Sirt5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ferm-domain-containing-5-frmd5-bhp10516280</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7056HUb0-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Human FERM domain containing 5 (FRMD5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-heat-shock-protein-hsp-90-alpha-hsp90aa1-bhp10516286</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP709080MOV-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Macaca fascicularis Heat shock protein HSP 90-alpha (HSP90AA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-anopheles-gambiaea-gap001409-pa-obp-3-bhp10516263</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6891BZL-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Anopheles gambiaeA GAP001409-PA (OBP-3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-versican-core-protein-vcan-partial-bhp10516303</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720284MOc7-SDS.jpg?v=1772280465</image:loc>
      <image:title>Recombinant Mouse Versican core protein (Vcan), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-neisseria-gonorrhoeae-ribonuclease-h-rnha-bhp10516287</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP710864NGA-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Neisseria gonorrhoeae Ribonuclease H (rnhA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-yarrowia-lipolytica-atp-citrate-synthase-bhp10516304</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7206YAP-SDS.jpg?v=1772280392</image:loc>
      <image:title>Recombinant Yarrowia lipolytica ATP citrate synthase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c-type-natriuretic-peptide-nppc-bhp10516291</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP713991MO-SDS.jpg?v=1772280393</image:loc>
      <image:title>Recombinant Mouse C-type natriuretic peptide (Nppc)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-semaphorin-4b-sema4b-partial-bhp10516292</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP714012MOb1-SDS.jpg?v=1772280392</image:loc>
      <image:title>Recombinant Mouse Semaphorin-4B (Sema4b), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-d-3-phosphoglycerate-dehydrogenase-phgdh-bhp10516296</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP717226MO-SDS.jpg?v=1782237912</image:loc>
      <image:title>Recombinant Mouse D-3-phosphoglycerate dehydrogenase (Phgdh)</image:title>
      <image:caption>Recombinant Mouse D-3-phosphoglycerate dehydrogenase (Phgdh) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-twinkle-homolog-protein-chloroplastic-mitochondrial-bhp10516308</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7209DOAb1-SDS.jpg?v=1772280408</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Twinkle homolog protein, chloroplastic/mitochondrial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pisum-sativum-gibberellin-3-beta-dioxygenase-1-le-bhp10516294</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7159HZY-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Pisum sativum Gibberellin 3-beta-dioxygenase 1 (LE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neurogenic-differentiation-factor-1-neurod1-m114a-h115a-bhp10516301</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720182MO_M4_c7-SDS.jpg?v=1772280410</image:loc>
      <image:title>Recombinant Mouse Neurogenic differentiation factor 1 (Neurod1)(M114A,H115A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-desert-hedgehog-protein-dhh-partial-bhp10516302</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720251MO-SDS.jpg?v=1772280393</image:loc>
      <image:title>Recombinant Mouse Desert hedgehog protein (Dhh), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-udp-glucuronosyltransferase-2b7-ugt2b7-partial-bhp10516311</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP723476RA1-SDS.jpg?v=1772280396</image:loc>
      <image:title>Recombinant Rat UDP-glucuronosyltransferase 2B7 (Ugt2b7), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alanine-trna-ligase-mitochondrial-aars2-partial-bhp10516290</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP711453HU3-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Human Alanine--tRNA ligase, mitochondrial (AARS2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transcription-intermediary-factor-1-beta-trim28-partial-bhp10516297</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP717259MO-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Mouse Transcription intermediary factor 1-beta (Trim28), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-leukocyte-associated-immunoglobulin-like-receptor-1-lair1-partial-bhp10516298</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7188CA2-SDS.jpg?v=1772280392</image:loc>
      <image:title>Recombinant Cat Leukocyte associated immunoglobulin like receptor 1 (LAIR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-e3-sumo-protein-ligase-siz1-siz1-bhp10516309</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP721197DOA_F3_-SDS.jpg?v=1772280393</image:loc>
      <image:title>Recombinant Arabidopsis thaliana E3 SUMO-protein ligase SIZ1 (SIZ1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sarcoplasmic-endoplasmic-reticulum-calcium-atpase-3-atp2a3-partial-bhp10516315</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP727334MO-SDS.jpg?v=1782434221</image:loc>
      <image:title>Recombinant Mouse Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (Atp2a3), partial</image:title>
      <image:caption>Recombinant Mouse Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (Atp2a3), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-phosphatidylserine-decarboxylase-proenzyme-1-mitochondrial-psd1-bhp10516305</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7207DOA_A4_-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Phosphatidylserine decarboxylase proenzyme 1, mitochondrial (PSD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-proepiregulin-ereg-partial-bhp10516317</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP730741MO-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Mouse Proepiregulin (Ereg), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-sodium-channel-protein-type-10-subunit-alpha-scn10a-partial-bhp10516325</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP737100RA-SDS.jpg?v=1772280396</image:loc>
      <image:title>Recombinant Rat Sodium channel protein type 10 subunit alpha (Scn10a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-adenosine-receptor-a2a-adora2a-partial-bhp10516299</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720158MO1-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Mouse Adenosine receptor A2a (Adora2a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-danio-rerio-e3-ubiquitin-protein-ligase-trim33-trim33-partial-bhp10516313</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP724971DIL-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Danio rerio E3 ubiquitin-protein ligase TRIM33 (trim33), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-serum-paraoxonase-lactonase-3-pon3-bhp10516324</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP737067MOb1-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Mouse Serum paraoxonase/lactonase 3 (Pon3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-serum-paraoxonase-lactonase-3-pon3-bhp10516323</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP737067MO-SDS.jpg?v=1772280409</image:loc>
      <image:title>Recombinant Mouse Serum paraoxonase/lactonase 3 (Pon3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pongo-abelii-dyslexia-associated-protein-kiaa0319-like-protein-kiaa0319l-partial-bhp10516322</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP735876PYX-SDS.jpg?v=1782242335</image:loc>
      <image:title>Recombinant Pongo abelii Dyslexia-associated protein KIAA0319-like protein (Kiaa0319l), partial</image:title>
      <image:caption>Recombinant Pongo abelii Dyslexia-associated protein KIAA0319-like protein (Kiaa0319l), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-coxiella-burnetii-uncharacterized-protein-bhp10516319</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7319DXP-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Coxiella burnetii Uncharacterized protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-histone-lysine-n-methyltransferase-ezh2-ezh2-partial-bhp10516310</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP723402MO1-SDS.jpg?v=1772280393</image:loc>
      <image:title>Recombinant Mouse Histone-lysine N-methyltransferase EZH2 (Ezh2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-meteorin-like-protein-metrnl-bhp10516318</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP731035HUc7-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Human Meteorin-like protein (METRNL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-yarrowia-lipolytica-atp-citrate-synthase-bhp10516312</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7247YAP-SDS.jpg?v=1772280393</image:loc>
      <image:title>Recombinant Yarrowia lipolytica ATP citrate synthase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-lin-28-homolog-b-lin28b-bhp10516329</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP741049HU-SDS.jpg?v=1772280467</image:loc>
      <image:title>Recombinant Human Protein lin-28 homolog B (LIN28B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-polymerase-gamma-2-polgamma2-partial-bhp10516306</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7208DOA1-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Polymerase gamma 2 (POLGAMMA2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-cbfa2t1-runx1t1-bhp10516314</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP726765HUc7-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Human Protein CBFA2T1 (RUNX1T1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-fasciculation-and-elongation-protein-zeta-2-fez2-bhp10516330</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP744236MO-SDS.jpg?v=1772280395</image:loc>
      <image:title>Recombinant Mouse Fasciculation and elongation protein zeta-2 (Fez2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-myosin-regulatory-light-polypeptide-9-myl9-x69y-bhp10516326</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP737335RA-SDS.jpg?v=1772280398</image:loc>
      <image:title>Recombinant Rat Myosin regulatory light polypeptide 9 (Myl9) (X69Y)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alanine-trna-ligase-mitochondrial-aars2-partial-bhp10516289</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP711453HU2-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Human Alanine--tRNA ligase, mitochondrial (AARS2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-protease-inhibitor-kazal-type-6-spink6-bhp10516331</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/Cusabio_Protein_Placeholder_5e5e4aa3-a5e9-4f10-84a0-9846b1c050ad.jpg?v=1784925932</image:loc>
      <image:title>Recombinant Human Serine protease inhibitor Kazal-type 6 (SPINK6)</image:title>
      <image:caption>Recombinant Human Serine protease inhibitor Kazal-type 6 (SPINK6) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glycerophosphocholine-cholinephosphodiesterase-enpp6-enpp6-partial-bhp10516328</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/Cusabio_Protein_Placeholder_8a3999df-86ce-47d0-bddd-7d7759444440.jpg?v=1784925933</image:loc>
      <image:title>Recombinant Human Glycerophosphocholine cholinephosphodiesterase ENPP6 (ENPP6), partial</image:title>
      <image:caption>Recombinant Human Glycerophosphocholine cholinephosphodiesterase ENPP6 (ENPP6), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pisum-sativum-gibberellin-3-beta-dioxygenase-1-le-a229t-bhp10516295</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7159HZY_M_-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Pisum sativum Gibberellin 3-beta-dioxygenase 1 (LE) (A229T)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nadh-cytochrome-b5-reductase-2-cyb5r2-bhp10516327</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/Cusabio_Protein_Placeholder_491975a8-8e60-4b9a-8f11-ab03e304700a.jpg?v=1784925935</image:loc>
      <image:title>Recombinant Human NADH-cytochrome b5 reductase 2 (CYB5R2)</image:title>
      <image:caption>Recombinant Human NADH-cytochrome b5 reductase 2 (CYB5R2) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-containing-protein-9-lrrc9-partial-bhp10516333</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP744412HU1-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Human Leucine-rich repeat-containing protein 9 (LRRC9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-galectin-lgals3-bhp10516316</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7276BO-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Bovine Galectin (LGALS3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cardiotrophin-1-ctf1-bhp10516321</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP733705MO-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Mouse Cardiotrophin-1 (Ctf1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-xanthomonas-albilineans-peptidoglycan-d-d-transpeptidase-ftsi-ftsi-partial-bhp10516338</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7461GYO-SDS.jpg?v=1772280398</image:loc>
      <image:title>Recombinant Xanthomonas albilineans Peptidoglycan D,D-transpeptidase FtsI (ftsI), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-oxaloacetate-tautomerase-fahd1-mitochondrial-fahd1-bhp10516343</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP750807HU-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Human Oxaloacetate tautomerase FAHD1, mitochondrial (FAHD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-ppe-family-immunogenic-protein-ppe68-ppe68-bhp10516341</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP748521MVZ-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis PPE family immunogenic protein PPE68 (PPE68)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-tissue-kallikrein-klk5-partial-bhp10516337</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7460PI-SDS.jpg?v=1772280395</image:loc>
      <image:title>Recombinant Pig tissue kallikrein (KLK5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-riemerella-anatipestifer-ra-ch-1-outer-membrane-receptor-for-ferrienterochelin-and-colicins-b739-1416-partial-bhp10516340</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7483-SDS.jpg?v=1772280465</image:loc>
      <image:title>Recombinant Riemerella anatipestifer RA-CH-1 Outer membrane receptor for ferrienterochelin and colicins (B739_1416), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-tissue-kallikrein-klk5-partial-bhp10516335</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7444DO-SDS.jpg?v=1772280395</image:loc>
      <image:title>Recombinant Dog tissue kallikrein (KLK5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-protease-serine-7-tmprss7-partial-bhp10516336</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP745764HU-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Human Transmembrane protease serine 7 (TMPRSS7), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-isoaspartyl-peptidase-l-asparaginase-asrgl1-partial-bhp10516349</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP755484HU-SDS.jpg?v=1772280396</image:loc>
      <image:title>Recombinant Human Isoaspartyl peptidase/L-asparaginase (ASRGL1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lysophospholipase-d-gdpd3-gdpd3-partial-bhp10516352</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP759171HU-SDS.jpg?v=1772280396</image:loc>
      <image:title>Recombinant Human Lysophospholipase D GDPD3 (GDPD3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-twinkle-homolog-protein-chloroplastic-mitochondrial-bhp10516307</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7209DOA-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Twinkle homolog protein, chloroplastic/mitochondrial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterocloster-bolteae-90a9-penicillin-binding-protein-2-partial-bhp10516345</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7508IPY-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Enterocloster bolteae 90A9 Penicillin-binding protein 2, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterocloster-bolteae-90a9-penicillin-binding-protein-1a-partial-bhp10516342</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7506IPY-SDS.jpg?v=1772280398</image:loc>
      <image:title>Recombinant Enterocloster bolteae 90A9 Penicillin-binding protein 1A, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-type-lectin-domain-family-4-member-g-clec4g-partial-bhp10516332</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP744269HU-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Human C-type lectin domain family 4 member G (CLEC4G), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-serine-threonine-protein-phosphatase-2a-65-kda-regulatory-subunit-a-alpha-isoform-ppp2r1a-bhp10516351</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP758842MO-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Mouse Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (Ppp2r1a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tubulin-alpha-1a-chain-tuba1a-bhp10516348</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP754656HUc7-SDS.jpg?v=1782434389</image:loc>
      <image:title>Recombinant Human Tubulin alpha-1A chain (TUBA1A)</image:title>
      <image:caption>Recombinant Human Tubulin alpha-1A chain (TUBA1A) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-oxaloacetate-tautomerase-fahd1-mitochondrial-fahd1-bhp10516344</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP750807HUc7-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Human Oxaloacetate tautomerase FAHD1, mitochondrial (FAHD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-oxidative-demethylase-alkbh2-alkbh2-bhp10516353</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP761219HUf0-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Human DNA oxidative demethylase ALKBH2 (ALKBH2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-rho-guanine-nucleotide-exchange-factor-18-arhgef18-partial-bhp10516334</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP744417HU-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Human Rho guanine nucleotide exchange factor 18 (ARHGEF18), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-xanthomonas-albilineans-cyclic-guanylate-specific-phosphodiesterase-partial-bhp10516347</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7543GYO-SDS.jpg?v=1772280398</image:loc>
      <image:title>Recombinant Xanthomonas albilineans cyclic-guanylate-specific phosphodiesterase, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bartonella-quintana-dihydrolipoyllysine-residue-succinyltransferase-component-of-2-oxoglutarate-dehydrogenase-complex-sucb-bhp10516346</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP753259BSH-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Bartonella quintana Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (sucB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-arylsulfatase-k-arsk-bhp10516354</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP764940HU-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Human Arylsulfatase K (ARSK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-induced-myeloid-leukemia-cell-differentiation-protein-mcl-1-mcl1-partial-bhp10516358</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP768742HU-SDS.jpg?v=1782434419</image:loc>
      <image:title>Recombinant Human Induced myeloid leukemia cell differentiation protein Mcl-1(MCL1), partial</image:title>
      <image:caption>Recombinant Human Induced myeloid leukemia cell differentiation protein Mcl-1(MCL1), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cmrf35-like-molecule-5-cd300ld-partial-biotinylated-bhp10516350</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP757797HU1-B-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Human CMRF35-like molecule 5 (CD300LD), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-serine-threonine-protein-kinase-nek5-nek5-bhp10516357</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP766517MO-SDS.jpg?v=1772280396</image:loc>
      <image:title>Recombinant Mouse Serine/threonine-protein kinase Nek5 (Nek5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-coxiella-burnetii-lps-assembly-protein-lptd-lptd-partial-bhp10516360</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP769349DXP-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Coxiella burnetii LPS-assembly protein lptD (lptD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-rna-binding-protein-nova-1-nova1-bhp10516362</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP772155RA-SDS.jpg?v=1772280413</image:loc>
      <image:title>Recombinant Rat RNA-binding protein Nova-1 (Nova1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nucleoplasmin-2-npm2-bhp10516365</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP774790HU-SDS.jpg?v=1772280428</image:loc>
      <image:title>Recombinant Human Nucleoplasmin-2 (NPM2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-coxiella-burnetii-uncharacterized-protein-bhp10516320</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7320DXP-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Coxiella burnetii Uncharacterized protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-putida-probable-hth-type-transcriptional-regulator-ttgr-ttgr-bhp10516366</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP801612FGB-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Pseudomonas putida Probable HTH-type transcriptional regulator ttgR (ttgR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-66-protein-e7-e7-bhp10516359</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP768853HDAS-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Human papillomavirus 66 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-adm2-adm2-partial-bhp10516368</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP801808HUc7-SDS.jpg?v=1772280415</image:loc>
      <image:title>Recombinant Human Protein ADM2 (ADM2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-nepenthes-gracilis-aspartic-proteinase-nepenthesin-2-nep2-bhp10516356</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP765721NBAV_A4_-SDS.jpg?v=1772280400</image:loc>
      <image:title>Recombinant Nepenthes gracilis Aspartic proteinase nepenthesin-2 (nep2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ran-binding-protein-3-like-ranbp3l-bhp10516369</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP803130HU-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Human Ran-binding protein 3-like (RANBP3L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-dihydropteridine-reductase-qdpr-bhp10516372</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP803943MO-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Mouse Dihydropteridine reductase (Qdpr)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fbxw7-and-skp1-heterodimer-protein-bhp10516339</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7463HUe1-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Human FBXW7&amp;SKP1 Heterodimer Protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-lama-glama-interleukin-2-il2-bhp10516361</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP769693LBSa0-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Lama glama Interleukin-2 (IL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-uroplakin-3b-upk3b-partial-bhp10516363</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP773940MO-SDS.jpg?v=1782434210</image:loc>
      <image:title>Recombinant Mouse Uroplakin-3b (Upk3b), partial</image:title>
      <image:caption>Recombinant Mouse Uroplakin-3b (Upk3b), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-adm2-adm2-partial-bhp10516367</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP801808HU-SDS.jpg?v=1772280417</image:loc>
      <image:title>Recombinant Human Protein ADM2 (ADM2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lon-protease-homolog-2-peroxisomal-lonp2-partial-bhp10516370</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP803134HU1-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Human Lon protease homolog 2, peroxisomal (LONP2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-perilipin-5-plin5-bhp10516376</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP804867MO-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Mouse Perilipin-5 (Plin5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ly6-plaur-domain-containing-protein-1-lypd1-bhp10516374</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP804823MO-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Mouse Ly6/PLAUR domain-containing protein 1 (Lypd1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sh3-and-cysteine-rich-domain-containing-protein-3-stac3-bhp10516378</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP805368MO-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Mouse SH3 and cysteine-rich domain-containing protein 3 (Stac3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-stenotrophomonas-maltophilia-dtdp-glucose-4-6-dehydratase-rmlb-bhp10516355</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7649SLU-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Stenotrophomonas maltophilia dTDP-glucose 4,6-dehydratase (rmlB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-artemisia-vulgaris-profilin-1-bhp10516381</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP808446AOH-SDS.jpg?v=1782434373</image:loc>
      <image:title>Recombinant Artemisia vulgaris Profilin-1</image:title>
      <image:caption>Recombinant Artemisia vulgaris Profilin-1 – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-alanine-trna-ligase-cytoplasmic-aars1-bhp10516373</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP804328MO_A4_-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Mouse Alanine--tRNA ligase, cytoplasmic (Aars1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-chondroitin-synthase-kfoc-bhp10516387</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP817141ENL-SDS.jpg?v=1772280403</image:loc>
      <image:title>Recombinant Escherichia coli Chondroitin synthase (kfoC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bbsome-complex-member-bbs1-bbs1-biotinylated-bhp10516399</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP836736HU-B-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Human BBSome complex member BBS1 (BBS1), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-transferrin-receptor-protein-1-tfrc-partial-bhp10516384</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP816838PIc7-SDS.jpg?v=1772280468</image:loc>
      <image:title>Recombinant Pig Transferrin receptor protein 1 (TFRC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-filamin-a-flna-partial-bhp10516375</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP804854MO-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Mouse Filamin-A (Flna), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-dedicator-of-cytokinesis-protein-2-dock2-partial-bhp10516379</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP806486MO-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Mouse Dedicator of cytokinesis protein 2 (Dock2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nacht-lrr-and-pyd-domains-containing-protein-3-nlrp3-partial-bhp10516391</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP822275HU1c7-SDS.jpg?v=1772280420</image:loc>
      <image:title>Recombinant Human NACHT, LRR and PYD domains-containing protein 3 (NLRP3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sodium-glucose-cotransporter-2-slc5a2-partial-bhp10516390</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP821656MO-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Mouse Sodium/glucose cotransporter 2 (Slc5a2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-solute-carrier-family-22-member-12-slc22a12-partial-bhp10516380</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP806534MO-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Mouse Solute carrier family 22 member 12 (Slc22a12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-naja-atra-acidic-phospholipase-a2-2-bhp10516400</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP838600NFG-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Naja atra Acidic phospholipase A2 2</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lysosomal-phospholipase-a-and-acyltransferase-pla2g15-bhp10516389</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP818760HU-SDS.jpg?v=1772280400</image:loc>
      <image:title>Recombinant Human Lysosomal phospholipase A and acyltransferase (PLA2G15)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-high-affinity-copper-uptake-protein-1-slc31a1-partial-bhp10516383</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP814304MO1-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Mouse High affinity copper uptake protein 1 (Slc31a1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-rnf130-rnf130-partial-bhp10516371</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP803148HU-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase RNF130 (RNF130), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-platanus-acerifolia-putative-invertase-inhibitor-bhp10516388</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP818103PGAT-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Platanus acerifolia Putative invertase inhibitor</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-zea-mays-transcription-factor-teosinte-branched-1-tb1-bhp10516396</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP835951ZAX-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Zea mays Transcription factor TEOSINTE BRANCHED 1 (TB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-porcine-epidemic-diarrhea-virus-spike-glycoprotein-s-partial-bhp10516413</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP849611PPW-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Porcine epidemic diarrhea virus Spike glycoprotein (S), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-mutans-serotype-c-udp-n-acetylmuramoyl-l-alanyl-d-glutamate-l-lysine-ligase-mure-bhp10516382</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP813565FMR-SDS.jpg?v=1772280400</image:loc>
      <image:title>Recombinant Streptococcus mutans serotype c UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L-lysine ligase (murE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-glutathione-specific-gamma-glutamylcyclotransferase-1-chac1-bhp10516402</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP840285MO-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Mouse Glutathione-specific gamma-glutamylcyclotransferase 1 (Chac1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-salmonella-typhi-secreted-effector-protein-pipb2-pipb2-bhp10516405</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP841656SWW-SDS.jpg?v=1772280403</image:loc>
      <image:title>Recombinant Salmonella typhi Secreted effector protein pipB2 (pipB2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-histone-acetyltransferase-kat5-kat5-partial-bhp10516395</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP178494h-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Human Histone acetyltransferase KAT5 (KAT5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-comm-domain-containing-protein-9-commd9-bhp10516386</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP816989MOa0-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Mouse COMM domain-containing protein 9 (Commd9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alpha-protein-kinase-1-alpk1-partial-bhp10516398</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP836286HU-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Human Alpha-protein kinase 1 (ALPK1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-extracellular-serine-threonine-protein-kinase-fam20c-fam20c-bhp10516385</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP816901HU-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Human Extracellular serine/threonine protein kinase FAM20C (FAM20C)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-patatin-like-phospholipase-domain-containing-protein-2-pnpla2-bhp10516397</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP836180HUc7-SDS.jpg?v=1772280411</image:loc>
      <image:title>Recombinant Human Patatin-like phospholipase domain-containing protein 2 (PNPLA2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nacht-lrr-and-pyd-domains-containing-protein-3-nlrp3-c279a-partial-bhp10516392</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP822275HU7_M1_-SDS.jpg?v=1772280405</image:loc>
      <image:title>Recombinant Human NACHT, LRR and PYD domains-containing protein 3 (NLRP3) (C279A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kynurenine-alpha-aminoadipate-aminotransferase-mitochondrial-aadat-bhp10516408</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP843276HUd8-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (AADAT)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-placenta-expressed-transcript-1-protein-plet1-bhp10516417</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP851843MOa0-SDS.jpg?v=1772280421</image:loc>
      <image:title>Recombinant Mouse Placenta-expressed transcript 1 protein (Plet1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-abscisic-acid-receptor-pyl1-pyl1-partial-bhp10516393</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP141574pl-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Abscisic acid receptor PYL1 (PYL1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-co-chaperonin-groes-groes-bhp10516394</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP832069FSGf0-SDS.jpg?v=1772280474</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cerebellin-4-cbln4-bhp10516377</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP805305MO-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Mouse Cerebellin-4 (Cbln4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-latent-transforming-growth-factor-beta-binding-protein-4-ltbp4-partial-bhp10516416</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP850788HU-SDS.jpg?v=1772280405</image:loc>
      <image:title>Recombinant Human Latent-transforming growth factor beta-binding protein 4 (LTBP4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-caspase-10-casp10-partial-bhp10516401</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP838815HU-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Human Caspase-10 (CASP10), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-roundabout-homolog-3-robo3-partial-bhp10516411</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP846671HUb1-SDS.jpg?v=1772280469</image:loc>
      <image:title>Recombinant Human Roundabout homolog 3 (ROBO3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-and-transmembrane-domain-containing-protein-2-lrtm2-partial-bhp10516412</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/Cusabio_Protein_Placeholder_e06c293b-2b91-408c-bf75-d05f74146f88.jpg?v=1784925933</image:loc>
      <image:title>Recombinant Human Leucine-rich repeat and transmembrane domain-containing protein 2 (LRTM2), partial</image:title>
      <image:caption>Recombinant Human Leucine-rich repeat and transmembrane domain-containing protein 2 (LRTM2), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-nuclear-receptor-binding-factor-2-nrbf2-bhp10516404</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP840834MO-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Mouse Nuclear receptor-binding factor 2 (Nrbf2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-f-box-like-wd-repeat-containing-protein-ebi-ebi-partial-bhp10516415</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP850198DLU1-SDS.jpg?v=1782434262</image:loc>
      <image:title>Recombinant Drosophila melanogaster F-box-like/WD repeat-containing protein ebi (ebi), partial</image:title>
      <image:caption>Recombinant Drosophila melanogaster F-box-like/WD repeat-containing protein ebi (ebi), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interferon-inducible-protein-aim2-aim2-bhp10516409</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP845977MO-SDS.jpg?v=1782434422</image:loc>
      <image:title>Recombinant Mouse Interferon-inducible protein AIM2 (Aim2)</image:title>
      <image:caption>Recombinant Mouse Interferon-inducible protein AIM2 (Aim2) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ubiquitin-fusion-degradation-protein-1-homolog-ufd1l-bhp10516406</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP842166HUf0-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Human Ubiquitin fusion degradation protein 1 homolog (UFD1L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-wnt-9a-wnt9a-bhp10516403</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP840305MOd7-SDS.jpg?v=1782434406</image:loc>
      <image:title>Recombinant Mouse Protein Wnt-9a (Wnt9a)</image:title>
      <image:caption>Recombinant Mouse Protein Wnt-9a (Wnt9a) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-repair-endonuclease-xpf-ercc4-partial-bhp10516414</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP849795HU-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Human DNA repair endonuclease XPF (ERCC4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-scavenger-receptor-class-f-member-2-scarf2-partial-bhp10516407</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP842678HU-SDS.jpg?v=1782434573</image:loc>
      <image:title>Recombinant Human Scavenger receptor class F member 2 (SCARF2), partial</image:title>
      <image:caption>Recombinant Human Scavenger receptor class F member 2 (SCARF2), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-placenta-expressed-transcript-1-protein-plet1-bhp10516418</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP851843MOc7-SDS.jpg?v=1772280479</image:loc>
      <image:title>Recombinant Mouse Placenta-expressed transcript 1 protein (Plet1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-3-ketoacyl-coa-thiolase-a-peroxisomal-acaa1a-bhp10516422</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP852843MO-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Mouse 3-ketoacyl-CoA thiolase A, peroxisomal (Acaa1a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-f-box-only-protein-17-fbxo17-bhp10516423</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP853409HU-SDS.jpg?v=1772280475</image:loc>
      <image:title>Recombinant Human F-box only protein 17 (FBXO17)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-roundabout-homolog-3-robo3-partial-bhp10516410</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP846671HU-SDS.jpg?v=1782433693</image:loc>
      <image:title>Recombinant Human Roundabout homolog 3 (ROBO3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dep-domain-containing-protein-1b-depdc1b-bhp10516419</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP851968HU-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Human DEP domain-containing protein 1B (DEPDC1B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kelch-like-protein-32-klhl32-bhp10516424</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP853471HU-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Human Kelch-like protein 32 (KLHL32)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-reston-ebolavirus-pre-small-secreted-glycoprotein-gp-partial-bhp10516421</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP852740RCI-SDS.jpg?v=1782434493</image:loc>
      <image:title>Recombinant Reston ebolavirus Pre-small/secreted glycoprotein (GP), partial</image:title>
      <image:caption>Recombinant Reston ebolavirus Pre-small/secreted glycoprotein (GP), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516431</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU6-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516429</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU4b0-SDS.jpg?v=1772280408</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o157-h7-fmn-dependent-nadh-quinone-oxidoreductase-azor-bhp10516420</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP852031EOD-SDS.jpg?v=1772280410</image:loc>
      <image:title>Recombinant Escherichia coli O157:H7 FMN-dependent NADH:quinone oxidoreductase (azoR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-motif-chemokine-17-ccl17-biotinylated-bhp10516427</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856406HU-B-SDS.jpg?v=1772280422</image:loc>
      <image:title>Recombinant Human C-C motif chemokine 17 (CCL17), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sarcosine-dehydrogenase-mitochondrial-sardh-partial-bhp10516439</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP857487MO-SDS.jpg?v=1772280417</image:loc>
      <image:title>Recombinant Mouse Sarcosine dehydrogenase, mitochondrial (Sardh), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sarcosine-dehydrogenase-mitochondrial-sardh-partial-bhp10516440</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP857487MOb1-SDS.jpg?v=1772280407</image:loc>
      <image:title>Recombinant Mouse Sarcosine dehydrogenase, mitochondrial (Sardh), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prohibitin-2-phb2-partial-bhp10516446</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859937HU2c7-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Human Prohibitin-2 (PHB2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516433</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU7b0-SDS.jpg?v=1772280415</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-mucosal-pentraxin-mptx-bhp10516425</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP854496MO-SDS.jpg?v=1772280409</image:loc>
      <image:title>Recombinant Mouse Mucosal pentraxin (Mptx)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ef-hand-domain-containing-protein-d2-efhd2-bhp10516437</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856907HU-SDS.jpg?v=1772280478</image:loc>
      <image:title>Recombinant Human EF-hand domain-containing protein D2 (EFHD2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-proheparin-binding-egf-like-growth-factor-hbegf-partial-bhp10516438</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP857429MO-SDS.jpg?v=1772280407</image:loc>
      <image:title>Recombinant Mouse Proheparin-binding EGF-like growth factor (Hbegf), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516434</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU8-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-paramecium-bursaria-chlorella-virus-1-mrna-capping-enzyme-a103r-bhp10516364</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP774574ERU-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Paramecium bursaria Chlorella virus 1 mRNA-capping enzyme (A103R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prohibitin-2-phb2-bhp10516447</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859937HUc7-SDS.jpg?v=1772280408</image:loc>
      <image:title>Recombinant Human Prohibitin-2 (PHB2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-pectinesterase-inhibitor-1-pmei1-bhp10516455</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP862828DOA-SDS.jpg?v=1772280411</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Pectinesterase inhibitor 1 (PMEI1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-mucolipin-1-mcoln1-partial-bhp10516444</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859533MO1-SDS.jpg?v=1772280408</image:loc>
      <image:title>Recombinant Mouse Mucolipin-1 (Mcoln1) , partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calcium-uptake-protein-1-mitochondrial-micu1-bhp10516449</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP860652HU_A4_F_-SDS.jpg?v=1772280408</image:loc>
      <image:title>Recombinant Human Calcium uptake protein 1, mitochondrial (MICU1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calcineurin-b-homologous-protein-1-chp1-bhp10516450</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP860773HU-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Human Calcineurin B homologous protein 1 (CHP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-selenide-water-dikinase-2-sephs2-u60s-bhp10516442</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859104HU-SDS.jpg?v=1772280413</image:loc>
      <image:title>Recombinant Human Selenide, water dikinase 2 (SEPHS2) (U60S)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516432</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU7-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prohibitin-2-phb2-partial-bhp10516445</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859937HU2-SDS.jpg?v=1772280409</image:loc>
      <image:title>Recombinant Human Prohibitin-2 (PHB2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dehydrogenase-reductase-sdr-family-member-4-dhrs4-partial-bhp10516451</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861137HU1-SDS.jpg?v=1772280410</image:loc>
      <image:title>Recombinant Human Dehydrogenase/reductase SDR family member 4 (DHRS4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516428</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU4-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prohibitin-2-phb2-bhp10516448</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859937HUd7-SDS.jpg?v=1772280425</image:loc>
      <image:title>Recombinant Human Prohibitin-2 (PHB2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-arginine-n-methyltransferase-1-prmt1-partial-bhp10516443</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859113HU1c7-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Human Protein arginine N-methyltransferase 1 (PRMT1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516430</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU5-SDS.jpg?v=1772280414</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-syntaxin-17-stx17-partial-bhp10516454</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861508MO1-SDS.jpg?v=1772280409</image:loc>
      <image:title>Recombinant Mouse Syntaxin-17 (Stx17), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516435</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU8b0-SDS.jpg?v=1772280422</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-69-protein-e7-e7-bhp10516459</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP864306HOL-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Human papillomavirus 69 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-calcitonin-gene-related-peptide-2-calcb-bhp10516441</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP857503MO-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Mouse Calcitonin gene-related peptide 2 (Calcb)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ly-6-neurotoxin-like-protein-1-lynx1-bhp10516452</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861187HU-SDS.jpg?v=1772280482</image:loc>
      <image:title>Recombinant Human Ly-6/neurotoxin-like protein 1 (LYNX1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516436</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU9-SDS.jpg?v=1772280405</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-tweety-homolog-1-ttyh1-partial-bhp10516465</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867139HU1-SDS.jpg?v=1772280435</image:loc>
      <image:title>Recombinant Human Protein tweety homolog 1 (TTYH1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-salmonella-typhi-outer-membrane-protein-a-ompa-partial-bhp10516426</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP164794Ba-SDS.jpg?v=1772280419</image:loc>
      <image:title>Recombinant Salmonella typhi Outer membrane protein A (ompA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sphingosine-1-phosphate-receptor-5-s1pr5-partial-bhp10516464</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867132HU1-SDS.jpg?v=1772280410</image:loc>
      <image:title>Recombinant Human Sphingosine 1-phosphate receptor 5 (S1PR5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tlr-adapter-interacting-with-slc15a4-on-the-lysosome-tasl-bhp10516466</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867184HU-SDS.jpg?v=1772280424</image:loc>
      <image:title>Recombinant Human TLR adapter interacting with SLC15A4 on the lysosome (TASL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-taste-receptor-type-2-member-14-tas2r14-partial-bhp10516470</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP868362HU1-SDS.jpg?v=1772280413</image:loc>
      <image:title>Recombinant Human Taste receptor type 2 member 14 (TAS2R14), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-interleukin-13-il13-bhp10516469</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP868226DOc7-SDS.jpg?v=1772280411</image:loc>
      <image:title>Recombinant Dog Interleukin-13 (IL13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-angiopoietin-related-protein-2-angptl2-bhp10516461</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP865621MO-SDS.jpg?v=1772280431</image:loc>
      <image:title>Recombinant Mouse Angiopoietin-related protein 2 (Angptl2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-transferrin-receptor-protein-1-tfrc-partial-bhp10516462</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867082DO-SDS.jpg?v=1772280412</image:loc>
      <image:title>Recombinant Dog Transferrin receptor protein 1 (TFRC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-zobellia-galactanivorans-iota-carrageenase-cgia-bhp10516456</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP863702ZAAQ-SDS.jpg?v=1772280410</image:loc>
      <image:title>Recombinant Zobellia galactanivorans Iota-carrageenase (cgiA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-egl-nine-homolog-1-egln1-bhp10516458</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP863932HU_A4_c7-SDS.jpg?v=1772280426</image:loc>
      <image:title>Recombinant Human Egl nine homolog 1 (EGLN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-repressor-of-rna-polymerase-iii-transcription-maf1-homolog-maf1-g236r-bhp10516472</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP872421HU-SDS.jpg?v=1772280424</image:loc>
      <image:title>Recombinant Human Repressor of RNA polymerase III transcription MAF1 homolog (MAF1) (G236R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-notechis-scutatus-scutatus-acidic-phospholipase-a2-hte-bhp10516474</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP874028NHT-SDS.jpg?v=1772280411</image:loc>
      <image:title>Recombinant Notechis scutatus scutatus Acidic phospholipase A2 HTe</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ferroptosis-suppressor-protein-1-aifm2-partial-bhp10516475</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP874794HU-SDS.jpg?v=1772280411</image:loc>
      <image:title>Recombinant Human Ferroptosis suppressor protein 1 (AIFM2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pseudouridylate-synthase-pus7l-pus7l-bhp10516463</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867121HU-SDS.jpg?v=1772280422</image:loc>
      <image:title>Recombinant Human Pseudouridylate synthase PUS7L (PUS7L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rickettsia-conorii-outer-membrane-protein-b-ompb-partial-bhp10516468</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867765RMS-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-nodamura-virus-protein-b2-b2-bhp10516490</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP881266NED-SDS.jpg?v=1772280418</image:loc>
      <image:title>Recombinant Nodamura virus Protein B2 (B2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cytochrome-c1-heme-protein-mitochondrial-cyc1-partial-bhp10516480</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP875175MO1a0-SDS.jpg?v=1772280494</image:loc>
      <image:title>Recombinant Mouse Cytochrome c1, heme protein, mitochondrial (Cyc1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cytochrome-c1-heme-protein-mitochondrial-cyc1-partial-bhp10516479</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP875175MO1-SDS.jpg?v=1772280484</image:loc>
      <image:title>Recombinant Mouse Cytochrome c1, heme protein, mitochondrial (Cyc1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bartonella-henselae-type-iv-secretion-system-protein-virb4-virb4-partial-bhp10516471</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP870829BSG-SDS.jpg?v=1772280419</image:loc>
      <image:title>Recombinant Bartonella henselae Type IV secretion system protein virB4 (virB4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ly-6-neurotoxin-like-protein-1-lynx1-bhp10516453</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861187HU_F_-SDS.jpg?v=1772280426</image:loc>
      <image:title>Recombinant Human Ly-6/neurotoxin-like protein 1 (LYNX1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-adhesion-g-protein-coupled-receptor-l3-adgrl3-partial-bhp10516467</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867185HU-SDS.jpg?v=1772280477</image:loc>
      <image:title>Recombinant Human Adhesion G protein-coupled receptor L3 (ADGRL3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cyclin-dependent-kinase-12-cdk12-partial-bhp10516494</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882147HU-SDS.jpg?v=1772280422</image:loc>
      <image:title>Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-rna-guanine-n7-methyltransferase-activating-subunit-ramac-bhp10516476</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP874806HU-SDS.jpg?v=1772280431</image:loc>
      <image:title>Recombinant Human RNA guanine-N7 methyltransferase activating subunit (RAMAC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dedicator-of-cytokinesis-protein-5-dock5-partial-bhp10516481</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP875689HU-SDS.jpg?v=1772280426</image:loc>
      <image:title>Recombinant Human Dedicator of cytokinesis protein 5 (DOCK5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-complement-c1q-tumor-necrosis-factor-related-protein-6-c1qtnf6-partial-bhp10516477</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/Cusabio_Protein_Placeholder_9d6bc009-9ab4-4fe9-9997-d83575d2e40b.jpg?v=1784925934</image:loc>
      <image:title>Recombinant Human Complement C1q tumor necrosis factor-related protein 6 (C1QTNF6), partial</image:title>
      <image:caption>Recombinant Human Complement C1q tumor necrosis factor-related protein 6 (C1QTNF6), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-resistin-like-alpha-retnla-bhp10516485</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP880616MO-SDS.jpg?v=1772280418</image:loc>
      <image:title>Recombinant Mouse Resistin-like alpha (Retnla)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcription-factor-coe3-ebf3-bhp10516487</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/Cusabio_Protein_Placeholder_52401f11-8a90-4d7f-9196-70338be87ff6.jpg?v=1784925933</image:loc>
      <image:title>Recombinant Human Transcription factor COE3 (EBF3)</image:title>
      <image:caption>Recombinant Human Transcription factor COE3 (EBF3) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-egl-nine-homolog-1-egln1-bhp10516457</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP863932HU_A4_-SDS.jpg?v=1772280410</image:loc>
      <image:title>Recombinant Human Egl nine homolog 1 (EGLN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-yth-domain-containing-family-protein-1-ythdf1-bhp10516478</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP874843HUc7-SDS.jpg?v=1772280413</image:loc>
      <image:title>Recombinant Human YTH domain-containing family protein 1 (YTHDF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cysteine-rich-protein-2-binding-protein-kat14-bhp10516488</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP880995HUc7-SDS.jpg?v=1782434336</image:loc>
      <image:title>Recombinant Human Cysteine-rich protein 2-binding protein (KAT14)</image:title>
      <image:caption>Recombinant Human Cysteine-rich protein 2-binding protein (KAT14) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ras-gtpase-activating-like-protein-iqgap1-iqgap1-partial-bhp10516492</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP881333MO-SDS.jpg?v=1772280437</image:loc>
      <image:title>Recombinant Mouse Ras GTPase-activating-like protein IQGAP1 (Iqgap1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-protease-serine-4-tmprss4-partial-bhp10516460</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP865122HUc7-SDS.jpg?v=1772280428</image:loc>
      <image:title>Recombinant Human Transmembrane protease serine 4 (TMPRSS4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sh3-and-multiple-ankyrin-repeat-domains-protein-3-shank3-partial-bhp10516483</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP880134HU-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Human SH3 and multiple ankyrin repeat domains protein 3 (SHANK3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibronectin-type-iii-domain-containing-protein-4-fndc4-partial-bhp10516473</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP872504HU-SDS.jpg?v=1772280429</image:loc>
      <image:title>Recombinant Human Fibronectin type III domain-containing protein 4 (FNDC4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-turtle-homolog-a-igsf9-partial-bhp10516497</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882181HUc7-SDS.jpg?v=1772280493</image:loc>
      <image:title>Recombinant Human Protein turtle homolog A (IGSF9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transient-receptor-potential-cation-channel-subfamily-v-member-4-trpv4-partial-bhp10516489</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP881015HU-SDS.jpg?v=1772280413</image:loc>
      <image:title>Recombinant Human Transient receptor potential cation channel subfamily V member 4 (TRPV4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-golgi-associated-plant-pathogenesis-related-protein-1-glipr2-partial-bhp10516486</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP880974HU1-SDS.jpg?v=1772280491</image:loc>
      <image:title>Recombinant Human Golgi-associated plant pathogenesis-related protein 1 (GLIPR2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neudesin-nenf-bhp10516484</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP880396MO-SDS.jpg?v=1772280495</image:loc>
      <image:title>Recombinant Mouse Neudesin (Nenf)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cyclin-dependent-kinase-12-cdk12-partial-bhp10516496</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882147HUc7-SDS.jpg?v=1772280418</image:loc>
      <image:title>Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-matrix-metalloproteinase-17-mmp17-bhp10516498</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882605MO-SDS.jpg?v=1772280421</image:loc>
      <image:title>Recombinant Mouse Matrix metalloproteinase-17 (Mmp17)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-coatomer-subunit-beta-copb1-bhp10516491</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP881306MO_A4_-SDS.jpg?v=1772280417</image:loc>
      <image:title>Recombinant Mouse Coatomer subunit beta (Copb1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lim-domain-containing-protein-1-limd1-bhp10516502</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP883381HUc7-SDS.jpg?v=1772280414</image:loc>
      <image:title>Recombinant Human LIM domain-containing protein 1 (LIMD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-three-prime-repair-exonuclease-2-trex2-bhp10516500</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882612MO-SDS.jpg?v=1772280416</image:loc>
      <image:title>Recombinant Mouse Three prime repair exonuclease 2 (Trex2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-wnt-10a-wnt10a-bhp10516508</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP884424HU-SDS.jpg?v=1772280437</image:loc>
      <image:title>Recombinant Human Protein Wnt-10a (WNT10A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-serpin-zx-bhp10516517</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP886615DOA-SDS.jpg?v=1772280428</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Serpin-ZX</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cyclin-dependent-kinase-12-cdk12-partial-bhp10516495</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882147HUb0-SDS.jpg?v=1772280429</image:loc>
      <image:title>Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lim-domain-containing-protein-1-limd1-bhp10516501</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP883381HU-SDS.jpg?v=1772280421</image:loc>
      <image:title>Recombinant Human LIM domain-containing protein 1 (LIMD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-matrix-remodeling-associated-protein-5-mxra5-partial-bhp10516512</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP885702HU-SDS.jpg?v=1772280415</image:loc>
      <image:title>Recombinant Human Matrix-remodeling-associated protein 5 (MXRA5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sulfide-quinone-oxidoreductase-mitochondrial-sqor-bhp10516499</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882609MO_A4_-SDS.jpg?v=1772280419</image:loc>
      <image:title>Recombinant Mouse Sulfide:quinone oxidoreductase, mitochondrial (Sqor)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nadph-dependent-diflavin-oxidoreductase-1-ndor1-bhp10516503</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP883387HU-SDS.jpg?v=1772280416</image:loc>
      <image:title>Recombinant Human NADPH-dependent diflavin oxidoreductase 1 (NDOR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-membrane-spanning-4-domains-subfamily-a-member-12-ms4a12-partial-bhp10516513</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP885756HU1-SDS.jpg?v=1772280442</image:loc>
      <image:title>Recombinant Human Membrane-spanning 4-domains subfamily A member 12 (MS4A12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-mis18-alpha-mis18a-bhp10516514</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP885766HU-SDS.jpg?v=1772280415</image:loc>
      <image:title>Recombinant Human Protein Mis18-alpha (MIS18A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-elongator-complex-protein-3-elp3-bhp10516510</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP884499HU-SDS.jpg?v=1772280479</image:loc>
      <image:title>Recombinant Human Elongator complex protein 3 (ELP3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mini-chromosome-maintenance-complex-binding-protein-mcmbp-bhp10516482</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP880100HU-SDS.jpg?v=1772280482</image:loc>
      <image:title>Recombinant Human Mini-chromosome maintenance complex-binding protein (MCMBP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-voltage-dependent-t-type-calcium-channel-subunit-alpha-1i-cacna1i-partial-bhp10516515</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP885788HU-SDS.jpg?v=1772280414</image:loc>
      <image:title>Recombinant Human Voltage-dependent T-type calcium channel subunit alpha-1I (CACNA1I), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-containing-g-protein-coupled-receptor-4-lgr4-partial-bhp10516504</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP883618HU-SDS.jpg?v=1772280415</image:loc>
      <image:title>Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 4 (LGR4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-gastrokine-1-gkn1-bhp10516507</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP883911MOf4-SDS.jpg?v=1782434307</image:loc>
      <image:title>Recombinant Mouse Gastrokine-1 (Gkn1)</image:title>
      <image:caption>Recombinant Mouse Gastrokine-1 (Gkn1) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-acyl-coenzyme-a-thioesterase-2-mitochondrial-acot2-bhp10516516</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP886188MO-SDS.jpg?v=1772280416</image:loc>
      <image:title>Recombinant Mouse Acyl-coenzyme A thioesterase 2, mitochondrial (Acot2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tsc22-domain-family-protein-4-tsc22d4-bhp10516525</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887652MO-SDS.jpg?v=1782242336</image:loc>
      <image:title>Recombinant Mouse TSC22 domain family protein 4 (Tsc22d4)</image:title>
      <image:caption>Recombinant Mouse TSC22 domain family protein 4 (Tsc22d4) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neuronal-acetylcholine-receptor-subunit-alpha-9-chrna9-partial-biotinylated-bhp10516518</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887022HU-B-SDS.jpg?v=1772280421</image:loc>
      <image:title>Recombinant Human Neuronal acetylcholine receptor subunit alpha-9 (CHRNA9), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-and-immune-response-regulator-tcim-bhp10516493</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882079HUc7-SDS.jpg?v=1772280420</image:loc>
      <image:title>Recombinant Human Transcriptional and immune response regulator (TCIM)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-type-lectin-domain-family-7-member-a-clec7a-partial-bhp10516505</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP883623HU-SDS.jpg?v=1772280414</image:loc>
      <image:title>Recombinant Human C-type lectin domain family 7 member A (CLEC7A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-and-transmembrane-domain-containing-protein-1-lrtm1-partial-bhp10516511</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/Cusabio_Protein_Placeholder_974f77ca-c29f-4b9e-b7b2-e0bd323bcf6e.jpg?v=1784925937</image:loc>
      <image:title>Recombinant Human Leucine-rich repeat and transmembrane domain-containing protein 1 (LRTM1), partial</image:title>
      <image:caption>Recombinant Human Leucine-rich repeat and transmembrane domain-containing protein 1 (LRTM1), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-testis-expressed-protein-101-tex101-bhp10516520</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887155HU-SDS.jpg?v=1772280415</image:loc>
      <image:title>Recombinant Human Testis-expressed protein 101(TEX101)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-complement-factor-h-related-protein-5-cfhr5-partial-bhp10516506</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/Cusabio_Protein_Placeholder_86849b4d-19a3-4678-8ec5-6b21f17a5f93.jpg?v=1784925934</image:loc>
      <image:title>Recombinant Human Complement factor H-related protein 5 (CFHR5), partial</image:title>
      <image:caption>Recombinant Human Complement factor H-related protein 5 (CFHR5), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-20-receptor-subunit-alpha-il20ra-partial-bhp10516519</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887035HU-SDS.jpg?v=1772280421</image:loc>
      <image:title>Recombinant Human Interleukin-20 receptor subunit alpha (IL20RA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-fam234a-fam234a-partial-bhp10516527</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887949HU-SDS.jpg?v=1772280429</image:loc>
      <image:title>Recombinant Human Protein FAM234A (FAM234A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-lim-domain-and-actin-binding-protein-1-lima1-bhp10516526</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887660MO-SDS.jpg?v=1782434328</image:loc>
      <image:title>Recombinant Mouse LIM domain and actin-binding protein 1 (Lima1)</image:title>
      <image:caption>Recombinant Mouse LIM domain and actin-binding protein 1 (Lima1) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-nadh-cytochrome-b5-reductase-3-cyb5r3-bhp10516524</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887597MO-SDS.jpg?v=1772280420</image:loc>
      <image:title>Recombinant Mouse NADH-cytochrome b5 reductase 3 (Cyb5r3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-histamine-h4-receptor-hrh4-partial-bhp10516528</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887972HU1a0-SDS.jpg?v=1772280484</image:loc>
      <image:title>Recombinant Human Histamine H4 receptor (HRH4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-charged-multivesicular-body-protein-4b-chmp4b-bhp10516529</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887976HUc7-SDS.jpg?v=1772280417</image:loc>
      <image:title>Recombinant Human Charged multivesicular body protein 4b (CHMP4B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-guanylate-binding-protein-3-gbp3-bhp10516509</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP884435HU-SDS.jpg?v=1782434289</image:loc>
      <image:title>Recombinant Human Guanylate-binding protein 3 (GBP3)</image:title>
      <image:caption>Recombinant Human Guanylate-binding protein 3 (GBP3) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mrg-morf4l-binding-protein-mrgbp-bhp10516531</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP889117HU-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Human MRG/MORF4L-binding protein (MRGBP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-chip-stub1-bhp10516538</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP892480HUe1-SDS.jpg?v=1772280427</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase CHIP (STUB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mitotic-spindle-assembly-checkpoint-protein-mad1-mad1l1-bhp10516548</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP897310HU-SDS.jpg?v=1772280424</image:loc>
      <image:title>Recombinant Human Mitotic spindle assembly checkpoint protein MAD1 (MAD1L1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-thermotoga-maritima-5-methylthioadenosine-s-adenosylhomocysteine-deaminase-mtad-bhp10516543</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP895804TNJ-SDS.jpg?v=1772280419</image:loc>
      <image:title>Recombinant Thermotoga maritima 5-methylthioadenosine/S-adenosylhomocysteine deaminase (mtaD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ly-6-neurotoxin-like-protein-1-lynx1-bhp10516540</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP893432MO-SDS.jpg?v=1772280425</image:loc>
      <image:title>Recombinant Mouse Ly-6/neurotoxin-like protein 1 (Lynx1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-f-box-only-protein-2-fbxo2-bhp10516536</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP892326HUf0-SDS.jpg?v=1772280496</image:loc>
      <image:title>Recombinant Human F-box only protein 2 (FBXO2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-eif5-mimic-protein-1-bzw2-bhp10516545</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP896544HUf0-SDS.jpg?v=1772280486</image:loc>
      <image:title>Recombinant Human eIF5-mimic protein 1 (BZW2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-chip-stub1-bhp10516537</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP892480HU-SDS.jpg?v=1772280419</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase CHIP (STUB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c-x-c-motif-chemokine-14-cxcl14-bhp10516539</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP093194m-SDS.jpg?v=1772280418</image:loc>
      <image:title>Recombinant Mouse C-X-C motif chemokine 14 (Cxcl14)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-wap-four-disulfide-core-domain-protein-2-wfdc2-bhp10516523</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887573MO-SDS.jpg?v=1772280417</image:loc>
      <image:title>Recombinant Mouse WAP four-disulfide core domain protein 2 (Wfdc2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sulfiredoxin-1-srxn1-partial-bhp10516521</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887163HU-SDS.jpg?v=1772280428</image:loc>
      <image:title>Recombinant Human Sulfiredoxin-1 (SRXN1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-annexin-a1-anxa1-bhp10516557</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001836HU-SDS.jpg?v=1772280436</image:loc>
      <image:title>Recombinant Human Annexin A1 (ANXA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serum-amyloid-p-component-apcs-bhp10516559</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001898HU-SDS.jpg?v=1772280436</image:loc>
      <image:title>Recombinant Human Serum amyloid P-component (APCS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-keratin-type-i-cytoskeletal-17-krt17-bhp10516533</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP889547MO-SDS.jpg?v=1772280416</image:loc>
      <image:title>Recombinant Mouse Keratin, type I cytoskeletal 17 (Krt17)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ribonuclease-3-drosha-partial-bhp10516530</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP889096HU-SDS.jpg?v=1772280418</image:loc>
      <image:title>Recombinant Human Ribonuclease 3 (DROSHA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hepatitis-e-virus-genotype-3-pro-secreted-protein-orf2-orf2-partial-bhp10516549</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP897430HHAM-SDS.jpg?v=1772280422</image:loc>
      <image:title>Recombinant Hepatitis E virus genotype 3 Pro-secreted protein ORF2 (ORF2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hbs1-like-protein-hbs1l-bhp10516546</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP896718HU-SDS.jpg?v=1772280436</image:loc>
      <image:title>Recombinant Human HBS1-like protein (HBS1L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-disintegrin-and-metalloproteinase-domain-containing-protein-10-adam10-partial-bhp10516555</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001273HU1-SDS.jpg?v=1772280420</image:loc>
      <image:title>Recombinant Human Disintegrin and metalloproteinase domain-containing protein 10 (ADAM10), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-recq-like-dna-helicase-blm-blm-k24a-partial-bhp10516575</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002715HU1_M_d7-SDS.jpg?v=1772280438</image:loc>
      <image:title>Recombinant Human RecQ-like DNA helicase BLM (BLM) (K24A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-anaphase-promoting-complex-subunit-5-anapc5-partial-bhp10516535</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP892130HU1-SDS.jpg?v=1772280419</image:loc>
      <image:title>Recombinant Human Anaphase-promoting complex subunit 5 (ANAPC5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-apolipoprotein-c-i-apoc1-bhp10516563</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001930RAd7-SDS.jpg?v=1772280422</image:loc>
      <image:title>Recombinant Rat Apolipoprotein C-I(Apoc1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-apolipoprotein-e-apoe-bhp10516565</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001936HUd9-SDS.jpg?v=1772280441</image:loc>
      <image:title>Recombinant Human Apolipoprotein E (APOE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-bone-morphogenetic-protein-6-bmp6-bhp10516580</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002742MO-SDS.jpg?v=1772280424</image:loc>
      <image:title>Recombinant Mouse Bone morphogenetic protein 6 (Bmp6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tartrate-resistant-acid-phosphatase-type-5-acp5-bhp10516550</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001178HU-SDS.jpg?v=1772280425</image:loc>
      <image:title>Recombinant Human Tartrate-resistant acid phosphatase type 5 (ACP5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ubiquitin-carboxyl-terminal-hydrolase-15-usp15-partial-bhp10516544</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP896515HU-SDS.jpg?v=1782434229</image:loc>
      <image:title>Recombinant Human Ubiquitin carboxyl-terminal hydrolase 15 (USP15), partial</image:title>
      <image:caption>Recombinant Human Ubiquitin carboxyl-terminal hydrolase 15 (USP15), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-small-ribosomal-subunit-protein-us10m-mrps10-bhp10516542</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP894684DLUc7-SDS.jpg?v=1772280422</image:loc>
      <image:title>Recombinant Drosophila melanogaster Small ribosomal subunit protein uS10m (mRpS10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cynomolgus-monkey-activin-receptor-type-2a-acvr2a-partial-active-bhp10516554</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001260HU1d9-SDS.jpg?v=1772280419</image:loc>
      <image:title>Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-potassium-transporting-atpase-subunit-beta-atp4b-partial-bhp10516569</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002343HU-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-recq-like-dna-helicase-blm-blm-k24a-partial-bhp10516574</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002715HU1_M_-SDS.jpg?v=1772280421</image:loc>
      <image:title>Recombinant Human RecQ-like DNA helicase BLM (BLM) (K24A),partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kit-ligand-kitlg-partial-active-bhp10516568</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002061HU1i9-SDS.jpg?v=1772280422</image:loc>
      <image:title>Recombinant Human Kit ligand (KITLG), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-trim15-trim15-bhp10516522</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887181HU-SDS.jpg?v=1772280415</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase TRIM15 (TRIM15)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-probetacellulin-btc-partial-bhp10516582</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002853MO-SDS.jpg?v=1772280429</image:loc>
      <image:title>Recombinant Mouse Probetacellulin (Btc), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-apolipoprotein-e-apoe-active-bhp10516564</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001936HU-SDS.jpg?v=1772280438</image:loc>
      <image:title>Recombinant Human Apolipoprotein E (APOE) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-v-type-proton-atpase-subunit-c-1-atp6v1c1-bhp10516571</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002399HUd9-SDS.jpg?v=1772280499</image:loc>
      <image:title>Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-androgen-induced-gene-1-protein-aig1-partial-bhp10516532</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP130644h-SDS.jpg?v=1772280432</image:loc>
      <image:title>Recombinant Human Androgen-induced gene 1 protein (AIG1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ddb1-and-cul4-associated-factor-1-dcaf1-partial-bhp10516547</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP896722HU1c7-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Human DDB1-and CUL4-associated factor 1 (DCAF1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-recq-like-dna-helicase-blm-blm-partial-bhp10516572</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002715HU1-SDS.jpg?v=1772280424</image:loc>
      <image:title>Recombinant Human RecQ-like DNA helicase BLM (BLM), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-bone-morphogenetic-protein-15-bmp15-bhp10516576</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002735MO-SDS.jpg?v=1772280427</image:loc>
      <image:title>Recombinant Mouse Bone morphogenetic protein 15 (Bmp15)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-bone-morphogenetic-protein-7-bmp7-bhp10516581</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002744MO-SDS.jpg?v=1772280425</image:loc>
      <image:title>Recombinant Mouse Bone morphogenetic protein 7 (Bmp7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-v-type-proton-atpase-subunit-c-1-atp6v1c1-bhp10516570</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002399HU-SDS.jpg?v=1772280420</image:loc>
      <image:title>Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-bone-morphogenetic-protein-2-bmp2-bhp10516577</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002736MO-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Mouse Bone morphogenetic protein 2 (Bmp2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-protein-shoc-2-shoc2-partial-bhp10516534</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP891468HU1-SDS.jpg?v=1772280419</image:loc>
      <image:title>Recombinant Human Leucine-rich repeat protein SHOC-2 (SHOC2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-b-lymphocyte-antigen-cd19-cd19-partial-biotinylated-bhp10516589</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004888HUk7-B-SDS.jpg?v=1772280436</image:loc>
      <image:title>Recombinant Human B-lymphocyte antigen CD19 (CD19), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-complement-c5-c5-active-bhp10516584</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP003995HU_A4_-SDS.jpg?v=1772280426</image:loc>
      <image:title>Recombinant Human Complement C5 (C5) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ox-2-membrane-glycoprotein-cd200-partial-bhp10516591</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004895HU1-SDS.jpg?v=1772280429</image:loc>
      <image:title>Recombinant Human OX-2 membrane glycoprotein (CD200), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-amyloid-beta-precursor-protein-app-partial-bhp10516567</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001950HU5-SDS.jpg?v=1782434233</image:loc>
      <image:title>Recombinant Human Amyloid-beta precursor protein (APP), partial</image:title>
      <image:caption>Recombinant Human Amyloid-beta precursor protein (APP), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-amyloid-beta-precursor-protein-app-partial-bhp10516566</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001950HU4d9-SDS.jpg?v=1772280424</image:loc>
      <image:title>Recombinant Human Amyloid-beta precursor protein (APP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-campath-1-antigen-cd52-nanoparticle-active-bhp10516606</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004943HUd7-SDS.jpg?v=1772280427</image:loc>
      <image:title>Recombinant Human CAMPATH-1 antigen (CD52)-Nanoparticle (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-t-cell-surface-glycoprotein-cd4-cd4-partial-bhp10516599</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004935MO1-SDS.jpg?v=1772280451</image:loc>
      <image:title>Recombinant Mouse T-cell surface glycoprotein CD4 (Cd4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-actin-related-protein-2-3-complex-subunit-1b-arpc1b-bhp10516541</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP894373MO-SDS.jpg?v=1772280425</image:loc>
      <image:title>Recombinant Mouse Actin-related protein 2/3 complex subunit 1B (Arpc1b)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-receptor-superfamily-member-5-cd40-partial-active-bhp10516600</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004936MO1-SDS.jpg?v=1772280428</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor receptor superfamily member 5 (Cd40), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-bone-morphogenetic-protein-2-bmp2-bhp10516578</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002736MOr13-SDS.jpg?v=1772280494</image:loc>
      <image:title>Recombinant Mouse Bone morphogenetic protein 2 (Bmp2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-signal-transducer-cd24-cd24-partial-nanoparticle-bhp10516592</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004902HUb0-SDS.jpg?v=1772280431</image:loc>
      <image:title>Recombinant Human Signal transducer CD24 (CD24), partial-Nanoparticle</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leukocyte-surface-antigen-cd47-cd47-partial-biotinylated-bhp10516603</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004940HUk7-B-SDS.jpg?v=1772280504</image:loc>
      <image:title>Recombinant Human Leukocyte surface antigen CD47 (CD47), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cell-adhesion-molecule-ceacam5-ceacam5-e398k-biotinylated-bhp10516613</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005165HU_M_-B-SDS.jpg?v=1772280500</image:loc>
      <image:title>Recombinant Human Cell adhesion molecule CEACAM5 (CEACAM5) (E398K), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hematopoietic-progenitor-cell-antigen-cd34-cd34-partial-bhp10516594</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004926HU-SDS.jpg?v=1772280425</image:loc>
      <image:title>Recombinant Human Hematopoietic progenitor cell antigen CD34 (CD34), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-butyrophilin-subfamily-3-member-a1-btn3a1-partial-bhp10516583</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002873HU-SDS.jpg?v=1772280446</image:loc>
      <image:title>Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cd44-antigen-cd44-partial-bhp10516601</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004938HU2-SDS.jpg?v=1772280502</image:loc>
      <image:title>Recombinant Human CD44 antigen (CD44), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-t-cell-surface-glycoprotein-cd3-epsilon-chain-cd3e-partial-bhp10516598</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004931MOd7-SDS.jpg?v=1772280502</image:loc>
      <image:title>Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain (Cd3e), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-lymphocyte-activation-antigen-cd80-cd80-partial-biotinylated-bhp10516608</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004959HU1-B-SDS.jpg?v=1772280427</image:loc>
      <image:title>Recombinant Human T-lymphocyte activation antigen CD80 (CD80), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-surface-glycoprotein-cd8-alpha-chain-cd8a-partial-active-bhp10516609</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004966HUd7-SDS.jpg?v=1772280442</image:loc>
      <image:title>Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cadherin-16-cdh16-partial-bhp10516611</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005041MO-SDS.jpg?v=1772280431</image:loc>
      <image:title>Recombinant Mouse Cadherin-16 (Cdh16), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-recq-like-dna-helicase-blm-blm-partial-bhp10516573</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002715HU1d7-SDS.jpg?v=1772280424</image:loc>
      <image:title>Recombinant Human RecQ-like DNA helicase BLM (BLM), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-bone-morphogenetic-protein-4-bmp4-bhp10516579</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002740MO-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Mouse Bone morphogenetic protein 4 (Bmp4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leukocyte-antigen-cd37-cd37-partial-bhp10516596</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004928HU1-SDS.jpg?v=1772280427</image:loc>
      <image:title>Recombinant Human Leukocyte antigen CD37 (CD37), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-activin-receptor-type-1b-acvr1b-partial-bhp10516553</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001258HU-SDS.jpg?v=1772280496</image:loc>
      <image:title>Recombinant Human Activin receptor type-1B (ACVR1B), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-clarin-1-clrn1-partial-bhp10516626</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005583HU1r13-SDS.jpg?v=1772280433</image:loc>
      <image:title>Recombinant Human Clarin-1 (CLRN1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-specific-surface-glycoprotein-cd28-cd28-partial-bhp10516593</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004913HU1d7-SDS.jpg?v=1772280502</image:loc>
      <image:title>Recombinant Human T-cell-specific surface glycoprotein CD28 (CD28), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-monocyte-differentiation-antigen-cd14-cd14-partial-active-bhp10516588</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004879HU1-SDS.jpg?v=1772280438</image:loc>
      <image:title>Recombinant Human Monocyte differentiation antigen CD14 (CD14), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-chromogranin-a-chga-partial-bhp10516616</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005344HU1-SDS.jpg?v=1782434381</image:loc>
      <image:title>Recombinant Human Chromogranin-A (CHGA), partial</image:title>
      <image:caption>Recombinant Human Chromogranin-A (CHGA), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-clusterin-clu-active-bhp10516627</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005595HUd7-SDS.jpg?v=1772280431</image:loc>
      <image:title>Recombinant Human Clusterin (CLU) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-chromogranin-a-chga-partial-bhp10516618</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005344HU3-SDS.jpg?v=1772280451</image:loc>
      <image:title>Recombinant Human Chromogranin-A (CHGA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytokine-receptor-like-factor-2-crlf2-partial-active-bhp10516632</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005983HUd9-SDS.jpg?v=1772280498</image:loc>
      <image:title>Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-surface-antigen-cd2-cd2-partial-bhp10516590</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004894HUd9-SDS.jpg?v=1772280443</image:loc>
      <image:title>Recombinant Human T-cell surface antigen CD2 (CD2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-chymotrypsinogen-b2-ctrb2-bhp10516637</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006180HU-SDS.jpg?v=1772280440</image:loc>
      <image:title>Recombinant Human Chymotrypsinogen B2 (CTRB2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cell-adhesion-molecule-ceacam4-ceacam4-partial-bhp10516612</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005164HU-SDS.jpg?v=1782434560</image:loc>
      <image:title>Recombinant Human Cell adhesion molecule CEACAM4 (CEACAM4), partial</image:title>
      <image:caption>Recombinant Human Cell adhesion molecule CEACAM4 (CEACAM4), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cd9-antigen-cd9-partial-bhp10516610</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004969HU1-SDS.jpg?v=1772280444</image:loc>
      <image:title>Recombinant Human CD9 antigen (CD9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-t-cell-surface-glycoprotein-cd5-cd5-partial-biotinylated-bhp10516605</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004942MOk7-B-SDS.jpg?v=1772280503</image:loc>
      <image:title>Recombinant Mouse T-cell surface glycoprotein CD5 (Cd5), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-chromogranin-a-chga-bhp10516615</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005344HU-SDS.jpg?v=1772280449</image:loc>
      <image:title>Recombinant Human Chromogranin-A (CHGA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-chromogranin-a-chga-partial-bhp10516617</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005344HU2-SDS.jpg?v=1772280447</image:loc>
      <image:title>Recombinant Human Chromogranin-A (CHGA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-granulocyte-macrophage-colony-stimulating-factor-csf2-bhp10516635</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006045MO-SDS.jpg?v=1772280449</image:loc>
      <image:title>Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-collagen-alpha-1-iii-chain-col3a1-partial-bhp10516629</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005740HU3-SDS.jpg?v=1772280515</image:loc>
      <image:title>Recombinant Human Collagen alpha-1(III) chain (COL3A1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-annexin-a1-anxa1-bhp10516558</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001836MO-SDS.jpg?v=1772280436</image:loc>
      <image:title>Recombinant Mouse Annexin A1 (Anxa1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-surface-glycoprotein-cd3-epsilon-chain-cd3e-partial-biotinylated-bhp10516597</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004931HUk7-B-SDS.jpg?v=1772280443</image:loc>
      <image:title>Recombinant Human T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-dystrophin-dmd-partial-bhp10516643</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006963MO-SDS.jpg?v=1772280436</image:loc>
      <image:title>Recombinant Mouse Dystrophin (Dmd), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-endothelin-1-edn1-partial-bhp10516645</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007400MO-SDS.jpg?v=1772280434</image:loc>
      <image:title>Recombinant Mouse Endothelin-1 (Edn1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ciliary-neurotrophic-factor-cntf-bhp10516628</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005683HUd9-SDS.jpg?v=1772280504</image:loc>
      <image:title>Recombinant Human Ciliary neurotrophic factor (CNTF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-granulocyte-colony-stimulating-factor-csf3-bhp10516636</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006049HU_F2_-SDS.jpg?v=1772280445</image:loc>
      <image:title>Recombinant Human Granulocyte colony-stimulating factor (CSF3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cathepsin-b-ctsb-bhp10516638</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006185HU3-SDS.jpg?v=1772280500</image:loc>
      <image:title>Recombinant Human Cathepsin B (CTSB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cathepsin-d-ctsd-active-bhp10516639</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006187HU_A4_-SDS.jpg?v=1772280435</image:loc>
      <image:title>Recombinant Human Cathepsin D (CTSD) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ephrin-a5-efna5-partial-bhp10516649</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007464HU1-SDS.jpg?v=1772280508</image:loc>
      <image:title>Recombinant Human Ephrin-A5 (EFNA5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-epidermal-growth-factor-receptor-egfr-partial-bhp10516651</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007479HUr8-SDS.jpg?v=1772280433</image:loc>
      <image:title>Recombinant Human Epidermal growth factor receptor (EGFR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-macrophage-colony-stimulating-factor-1-receptor-csf1r-partial-active-bhp10516634</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006044MO-SDS.jpg?v=1772280502</image:loc>
      <image:title>Recombinant Mouse Macrophage colony-stimulating factor 1 receptor (Csf1r), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tissue-factor-f3-partial-bhp10516660</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007928HU2d9-SDS.jpg?v=1772280505</image:loc>
      <image:title>Recombinant Human Tissue factor (F3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-erythropoietin-receptor-epor-partical-bhp10516656</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007744HU1d9-SDS.jpg?v=1772280449</image:loc>
      <image:title>Recombinant Human Erythropoietin receptor (EPOR), partical</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-endothelin-1-edn1-partial-bhp10516646</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007400MOr13-SDS.jpg?v=1772280434</image:loc>
      <image:title>Recombinant Mouse Endothelin-1 (Edn1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-epithelial-cell-adhesion-molecule-epcam-partial-active-bhp10516652</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007717HU-SDS.jpg?v=1772280441</image:loc>
      <image:title>Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-erythropoietin-epo-bhp10516655</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007743HUd9-SDS.jpg?v=1772280445</image:loc>
      <image:title>Recombinant Human Erythropoietin (EPO)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-delta-homolog-1-dlk1-partial-active-bhp10516642</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006945HUd7-SDS.jpg?v=1772280433</image:loc>
      <image:title>Recombinant Human Protein delta homolog 1 (DLK1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-endothelin-2-edn2-partial-bhp10516647</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007401MO-SDS.jpg?v=1772280433</image:loc>
      <image:title>Recombinant Mouse Endothelin-2 (Edn2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-macrophage-colony-stimulating-factor-1-receptor-csf1r-partial-active-bhp10516633</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006044HUd7-SDS.jpg?v=1772280503</image:loc>
      <image:title>Recombinant Human Macrophage colony-stimulating factor 1 receptor (CSF1R), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-coagulation-factor-ix-f9-partial-bhp10516664</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007936HU3c9-SDS.jpg?v=1772280449</image:loc>
      <image:title>Recombinant Human Coagulation factor IX (F9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-complement-factor-d-cfd-active-bhp10516614</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005271HU-SDS.jpg?v=1772280433</image:loc>
      <image:title>Recombinant Human Complement factor D(CFD) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-coagulation-factor-xi-f11-bhp10516659</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007916MO_A4_-SDS.jpg?v=1772280449</image:loc>
      <image:title>Recombinant Mouse Coagulation factor XI  (F11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ephrin-type-a-receptor-2-epha2f-partial-active-bhp10516654</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007722HUd7-SDS.jpg?v=1772280451</image:loc>
      <image:title>Recombinant Human Ephrin type-A receptor 2 (EPHA2F), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytokine-receptor-like-factor-2-crlf2-partial-biotinylated-active-bhp10516631</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005983HU-B-SDS.jpg?v=1772280431</image:loc>
      <image:title>Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial, Biotinylated (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-epidermal-growth-factor-receptor-egfr-partial-bhp10516650</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007479HUr4-SDS.jpg?v=1772280437</image:loc>
      <image:title>Recombinant Human Epidermal growth factor receptor (EGFR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-high-affinity-immunoglobulin-epsilon-receptor-subunit-alpha-fcer1a-partial-bhp10516667</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008532MO1-SDS.jpg?v=1772280436</image:loc>
      <image:title>Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-low-affinity-immunoglobulin-gamma-fc-region-receptor-iii-a-fcgr3a-f176v-partial-biotinylated-active-bhp10516668</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008543HU1_M_k7-B-SDS.jpg?v=1772280441</image:loc>
      <image:title>Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A) (F176V), partial, Biotinylated (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-coagulation-factor-x-f10-partial-bhp10516658</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007915HU2-SDS.jpg?v=1772280439</image:loc>
      <image:title>Recombinant Human Coagulation factor X (F10), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-epithelial-cell-adhesion-molecule-tacstd1-partial-bhp10516653</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007717MOW-SDS.jpg?v=1772280451</image:loc>
      <image:title>Recombinant Macaca mulatta Epithelial cell adhesion molecule (TACSTD1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-chitinase-3-like-protein-1-chi3l1-active-bhp10516619</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005346HU-SDS.jpg?v=1772280432</image:loc>
      <image:title>Recombinant Human Chitinase-3-like protein 1 (CHI3L1) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-coagulation-factor-ix-f9-partial-bhp10516662</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007936HU2d9-SDS.jpg?v=1772280451</image:loc>
      <image:title>Recombinant Human Coagulation factor IX (F9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prolyl-endopeptidase-fap-fap-partial-active-bhp10516665</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008424HU-SDS.jpg?v=1772280451</image:loc>
      <image:title>Recombinant Human Prolyl endopeptidase FAP (FAP), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytokine-receptor-like-factor-2-crlf2-partial-active-bhp10516630</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005983HU-SDS.jpg?v=1772280433</image:loc>
      <image:title>Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-coagulation-factor-x-f10-partial-bhp10516657</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007915HU1-SDS.jpg?v=1772280433</image:loc>
      <image:title>Recombinant Human Coagulation factor X (F10), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-fibroblast-growth-factor-1-fgf1-bhp10516669</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008615MO-SDS.jpg?v=1772280441</image:loc>
      <image:title>Recombinant Mouse Fibroblast growth factor 1 (Fgf1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-6-fas-partial-bhp10516666</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008433HU-SDS.jpg?v=1772280451</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 6 (FAS), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-receptor-3-fgfr3-partial-active-bhp10516681</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008646HU_F2_-SDS.jpg?v=1772280444</image:loc>
      <image:title>Recombinant Human Fibroblast growth factor receptor 3 (FGFR3), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dipeptidyl-peptidase-4-dpp4-partial-bhp10516644</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007139HU1d7-SDS.jpg?v=1772280449</image:loc>
      <image:title>Recombinant Human Dipeptidyl peptidase 4 (DPP4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-receptor-2-fgfr2-partial-active-bhp10516673</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008645HU1-SDS.jpg?v=1772280510</image:loc>
      <image:title>Recombinant Human Fibroblast growth factor receptor 2 (FGFR2), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-surface-glycoprotein-cd5-cd5-partial-active-bhp10516604</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004942HU1-SDS.jpg?v=1772280428</image:loc>
      <image:title>Recombinant Human T-cell surface glycoprotein CD5 (CD5), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-coagulation-factor-ix-f9-partial-bhp10516663</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007936HU3-SDS.jpg?v=1772280434</image:loc>
      <image:title>Recombinant Human Coagulation factor IX (F9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-receptor-2-fgfr2-partial-bhp10516676</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008645HU2_F3_-SDS.jpg?v=1772280448</image:loc>
      <image:title>Recombinant Human Fibroblast growth factor receptor 2 (FGFR2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-fibroblast-growth-factor-8-fgf8-bhp10516671</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008637MOd7-SDS.jpg?v=1772280442</image:loc>
      <image:title>Recombinant Mouse Fibroblast growth factor 8 (Fgf8)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-receptor-3-fgfr3-partial-active-bhp10516679</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008646HU-SDS.jpg?v=1772280442</image:loc>
      <image:title>Recombinant Human Fibroblast growth factor receptor 3 (FGFR3), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-fibroblast-growth-factor-9-fgf9-bhp10516672</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008638MO-SDS.jpg?v=1772280442</image:loc>
      <image:title>Recombinant Mouse Fibroblast growth factor 9 (Fgf9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ephrin-a1-efna1-active-bhp10516648</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007460HU-SDS.jpg?v=1772280450</image:loc>
      <image:title>Recombinant Human Ephrin-A1 (EFNA1) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fms-related-tyrosine-kinase-3-ligand-flt3lg-partial-bhp10516683</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008734HU1-SDS.jpg?v=1772280438</image:loc>
      <image:title>Recombinant Human Fms-related tyrosine kinase 3 ligand (FLT3LG), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-coagulation-factor-ix-f9-partial-bhp10516661</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007936HU2-SDS.jpg?v=1772280434</image:loc>
      <image:title>Recombinant Human Coagulation factor IX (F9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-receptor-2-fgfr2-partial-bhp10516675</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008645HU2-SDS.jpg?v=1772280503</image:loc>
      <image:title>Recombinant Human Fibroblast growth factor receptor 2(FGFR2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-fibroblast-growth-factor-receptor-2-fgfr2-partial-active-bhp10516678</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008645MO1_F2_-SDS.jpg?v=1772280441</image:loc>
      <image:title>Recombinant Mouse Fibroblast growth factor receptor 2 (Fgfr2), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-fibroblast-growth-factor-21-fgf21-bhp10516670</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008627MO-SDS.jpg?v=1772280436</image:loc>
      <image:title>Recombinant Mouse Fibroblast growth factor 21 (Fgf21)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-receptor-2-fgfr2-partial-active-bhp10516677</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008645HU_F3_-SDS.jpg?v=1772280450</image:loc>
      <image:title>Recombinant Human Fibroblast growth factor receptor 2 (FGFR2), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-receptor-4-fgfr4-partial-bhp10516682</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008648HU1-SDS.jpg?v=1772280438</image:loc>
      <image:title>Recombinant Human Fibroblast growth factor receptor 4 (FGFR4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-receptor-3-fgfr3-partial-active-bhp10516680</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008646HU1_F2_-SDS.jpg?v=1772280451</image:loc>
      <image:title>Recombinant Human Fibroblast growth factor receptor 3 (FGFR3), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-receptor-2-fgfr2-partial-active-bhp10516674</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008645HU1_F3_-SDS.jpg?v=1772280451</image:loc>
      <image:title>Recombinant Human Fibroblast growth factor receptor 2 (FGFR2), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glyceraldehyde-3-phosphate-dehydrogenase-gapdh-biotinylated-bhp10516684</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009232HU_A4_-B-SDS.jpg?v=1772294668</image:loc>
      <image:title>Recombinant Human Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glycophorin-a-gypa-partial-bhp10516693</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP010074HU-SDS.jpg?v=1772294583</image:loc>
      <image:title>Recombinant Human Glycophorin-A (GYPA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gastric-inhibitory-polypeptide-gip-partial-bhp10516690</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009434HU1-SDS.jpg?v=1772294587</image:loc>
      <image:title>Recombinant Human Gastric inhibitory polypeptide (GIP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hepatitis-a-virus-cellular-receptor-2-havcr2-partial-bhp10516694</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP010145HU1d7-SDS.jpg?v=1772294585</image:loc>
      <image:title>Recombinant Human Hepatitis A virus cellular receptor 2 (HAVCR2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glutathione-peroxidase-3-gpx3-u73c-bhp10516692</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009868HU-SDS.jpg?v=1772294669</image:loc>
      <image:title>Recombinant Human Glutathione peroxidase 3 (GPX3) (U73C)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interferon-alpha-beta-receptor-2-ifnar2-biotinylated-bhp10516702</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011047MOj8-B-SDS.jpg?v=1772294654</image:loc>
      <image:title>Recombinant Mouse Interferon alpha/beta receptor 2 (Ifnar2), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-alpha-beta-receptor-2-ifnar2-partial-bhp10516701</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011047HUd7-SDS.jpg?v=1772294580</image:loc>
      <image:title>Recombinant Human Interferon alpha/beta receptor 2 (IFNAR2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glypican-3-gpc3-partial-active-bhp10516691</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009705HU1-SDS.jpg?v=1772294596</image:loc>
      <image:title>Recombinant Human Glypican-3 (GPC3), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interferon-beta-ifnb1-bhp10516706</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011048MOVd9-SDS.jpg?v=1772294582</image:loc>
      <image:title>Recombinant Macaca fascicularis Interferon beta (IFNB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-hexim1-hexim1-bhp10516695</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP010318HU-SDS.jpg?v=1772294580</image:loc>
      <image:title>Recombinant Human Protein HEXIM1 (HEXIM1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gtp-binding-protein-gem-gem-bhp10516688</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009362HU-SDS.jpg?v=1772294581</image:loc>
      <image:title>Recombinant Human GTP-binding protein GEM (GEM)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-alpha-beta-receptor-1-ifnar1-partial-bhp10516700</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011046HUd7-SDS.jpg?v=1772294583</image:loc>
      <image:title>Recombinant Human Interferon alpha/beta receptor 1 (IFNAR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-2-il-2-biotinylated-bhp10516733</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011629HUk7-B-SDS.jpg?v=1772294597</image:loc>
      <image:title>Recombinant Human Interleukin-2 (IL-2), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-growth-differentiation-factor-11-gdf11-bhp10516686</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009344MO-SDS.jpg?v=1772294579</image:loc>
      <image:title>Recombinant Mouse Growth/differentiation factor 11 (Gdf11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gdnf-family-receptor-alpha-1-gfra1-bhp10516689</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009379HU1-SDS.jpg?v=1772294668</image:loc>
      <image:title>Recombinant Human GDNF family receptor alpha-1 (GFRA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-interferon-gamma-ifng-biotinylated-bhp10516711</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011050MOWk7-B-SDS.jpg?v=1772294683</image:loc>
      <image:title>Recombinant Macaca mulatta Interferon gamma (IFNG), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interferon-gamma-receptor-1-ifngr1-partial-bhp10516715</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011051MO-SDS.jpg?v=1772294668</image:loc>
      <image:title>Recombinant Mouse Interferon gamma receptor 1 (Ifngr1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-9-il9-bhp10516749</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011675HU-SDS.jpg?v=1772294578</image:loc>
      <image:title>Recombinant Human Interleukin-9 (IL9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-intercellular-adhesion-molecule-1-icam1-partial-active-bhp10516697</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP010949HU-SDS.jpg?v=1772294597</image:loc>
      <image:title>Recombinant Human Intercellular adhesion molecule 1 (ICAM1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-gamma-ifng-biotinylated-bhp10516708</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011050HU1k7-B-SDS.jpg?v=1772294601</image:loc>
      <image:title>Recombinant Human Interferon gamma (IFNG), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-hexokinase-2-hk2-partial-bhp10516696</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP010469MO-SDS.jpg?v=1772294586</image:loc>
      <image:title>Recombinant Mouse Hexokinase-2 (Hk2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-gamma-receptor-1-ifngr1-partial-bhp10516714</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011051HU1d7-SDS.jpg?v=1772294599</image:loc>
      <image:title>Recombinant Human Interferon gamma receptor 1 (IFNGR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-interferon-beta-ifnb1-bhp10516707</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011048RA-SDS.jpg?v=1772294661</image:loc>
      <image:title>Recombinant Rat Interferon beta (Ifnb1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-insulin-like-growth-factor-1-igf1-bhp10516716</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011086MOd9-SDS.jpg?v=1772294579</image:loc>
      <image:title>Recombinant Mouse Insulin-like growth factor 1 (Igf1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-11-il11-bhp10516721</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011583HU-SDS.jpg?v=1772294587</image:loc>
      <image:title>Recombinant Human Interleukin-11 (IL11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glycylpeptide-n-tetradecanoyltransferase-1-nmt1-bhp10516789</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015900HU-SDS.jpg?v=1772294592</image:loc>
      <image:title>Recombinant Human Glycylpeptide N-tetradecanoyltransferase 1 (NMT1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-immunoglobulin-heavy-constant-epsilon-ighe-partial-bhp10516719</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011153MO1-SDS.jpg?v=1772294595</image:loc>
      <image:title>Recombinant Mouse Immunoglobulin heavy constant epsilon (IGHE), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kallikrein-2-klk2-bhp10516756</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012453HU-SDS.jpg?v=1772294591</image:loc>
      <image:title>Recombinant Human Kallikrein-2 (KLK2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-insulin-like-growth-factor-ii-igf2-e30r-f43l-s63p-bhp10516718</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011088HU_A4_M_-SDS.jpg?v=1772294584</image:loc>
      <image:title>Recombinant Human Insulin-like growth factor II (IGF2) (E30R, F43L, S63P)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-procollagen-c-endopeptidase-enhancer-2-pcolce2-bhp10516797</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017632HU-SDS.jpg?v=1772294582</image:loc>
      <image:title>Recombinant Human Procollagen C-endopeptidase enhancer 2 (Pcolce2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-channel-protein-type-1-subunit-alpha-scn1a-partial-bhp10516815</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP020834HU-SDS.jpg?v=1772294592</image:loc>
      <image:title>Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-inactive-tyrosine-protein-kinase-transmembrane-receptor-ror1-ror1-partial-biotinylated-active-bhp10516813</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP020067HU1k7-B-SDS.jpg?v=1772294603</image:loc>
      <image:title>Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial, Biotinylated (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interferon-beta-ifnb1-bhp10516705</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011048MO-SDS.jpg?v=1772294587</image:loc>
      <image:title>Recombinant Mouse Interferon beta (Ifnb1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mast-stem-cell-growth-factor-receptor-kit-kit-partial-active-bhp10516753</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012375HU1-SDS.jpg?v=1772294584</image:loc>
      <image:title>Recombinant Human Mast/stem cell growth factor receptor Kit (KIT), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-1-beta-il1b-bhp10516726</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011614HUc9-SDS.jpg?v=1772294673</image:loc>
      <image:title>Recombinant Human Interleukin-1 beta (IL1B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-legumain-lgmn-active-bhp10516765</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012903HU_A4_-SDS.jpg?v=1772294586</image:loc>
      <image:title>Recombinant Human Legumain (LGMN) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-insulin-receptor-insr-partial-active-bhp10516752</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011753HU_F2_-SDS.jpg?v=1772294583</image:loc>
      <image:title>Recombinant Human Insulin receptor (INSR), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-growth-differentiation-factor-9-gdf9-bhp10516687</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009352MO-SDS.jpg?v=1772294580</image:loc>
      <image:title>Recombinant Mouse Growth/differentiation factor 9 (Gdf9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-galectin-3-lgals3-bhp10516760</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012887HU_A4_-SDS.jpg?v=1772294614</image:loc>
      <image:title>Recombinant Human Galectin-3 (LGALS3)</image:title>
      <image:caption>0</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-inhibin-beta-b-chain-inhbb-bhp10516750</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011720MO-SDS.jpg?v=1772294599</image:loc>
      <image:title>Recombinant Mouse Inhibin beta B chain (Inhbb)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-beta-ifnb1-bhp10516704</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011048HUr13-SDS.jpg?v=1772294583</image:loc>
      <image:title>Recombinant Human Interferon beta (IFNB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-2-il2-active-bhp10516734</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011629MOd9-SDS.jpg?v=1772294580</image:loc>
      <image:title>Recombinant Mouse Interleukin-2 (Il2) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-galectin-9-lgals9-w309a-bhp10516764</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012895HU_F_M_-SDS.jpg?v=1772294602</image:loc>
      <image:title>Recombinant Human Galectin-9 (LGALS9)(W309A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-interferon-gamma-ifng-active-bhp10516710</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011050MOW-SDS.jpg?v=1772294580</image:loc>
      <image:title>Recombinant Macaca mulatta Interferon gamma (IFNG) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-urokinase-plasminogen-activator-surface-receptor-plaur-partial-biotinylated-bhp10516805</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP018122HU1-B-SDS.jpg?v=1772294660</image:loc>
      <image:title>Recombinant Human Urokinase plasminogen activator surface receptor (PLAUR), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-1-receptor-type-1-il1r1-partial-bhp10516728</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011621HU1-SDS.jpg?v=1782434396</image:loc>
      <image:title>Recombinant Human Interleukin-1 receptor type 1 (IL1R1), partial</image:title>
      <image:caption>Recombinant Human Interleukin-1 receptor type 1 (IL1R1), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-galectin-9-lgals9-partial-bhp10516762</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012895HU1b0-SDS.jpg?v=1772294592</image:loc>
      <image:title>Recombinant Human Galectin-9 (LGALS9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-natural-cytotoxicity-triggering-receptor-1-ncr1-partial-bhp10516786</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015549HU-SDS.jpg?v=1772294603</image:loc>
      <image:title>Recombinant Human Natural cytotoxicity triggering receptor 1(NCR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-icos-ligand-icoslg-partial-bhp10516698</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP010958HU1d9-SDS.jpg?v=1772294599</image:loc>
      <image:title>Recombinant Human ICOS ligand (ICOSLG), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-alpha-beta-receptor-1-ifnar1-partial-bhp10516699</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011046HU1-SDS.jpg?v=1772294660</image:loc>
      <image:title>Recombinant Human Interferon alpha/beta receptor 1 (IFNAR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-urokinase-plasminogen-activator-surface-receptor-plaur-partial-bhp10516806</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP018122MO-SDS.jpg?v=1772294584</image:loc>
      <image:title>Recombinant Mouse Urokinase plasminogen activator surface receptor (Plaur), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-polypeptide-related-sequence-b-micb-partial-active-bhp10516778</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013813HUd7-SDS.jpg?v=1772294585</image:loc>
      <image:title>Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-interleukin-2-il2-bhp10516737</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011629RAd9-SDS.jpg?v=1772294605</image:loc>
      <image:title>Recombinant Rat Interleukin-2 (Il2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-1-receptor-antagonist-protein-il1rn-bhp10516732</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011628HU-SDS.jpg?v=1772294671</image:loc>
      <image:title>Recombinant Human Interleukin-1 receptor antagonist protein (IL1RN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-33-il33-partial-bhp10516742</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011656HU1c9-SDS.jpg?v=1772294661</image:loc>
      <image:title>Recombinant Human Interleukin-33 (IL33), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-procollagen-c-endopeptidase-enhancer-2-pcolce2-bhp10516798</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017632MO-SDS.jpg?v=1772294596</image:loc>
      <image:title>Recombinant Mouse Procollagen C-endopeptidase enhancer 2 (Pcolce2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-interferon-gamma-ifng-bhp10516712</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011050MOWr12-SDS.jpg?v=1772294668</image:loc>
      <image:title>Recombinant Macaca mulatta Interferon gamma (IFNG)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gtpase-nras-nras-bhp10516793</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP016070HU-SDS.jpg?v=1772294673</image:loc>
      <image:title>Recombinant Human GTPase NRas (NRAS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-containing-g-protein-coupled-receptor-5-lgr5-partial-bhp10516769</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012906HUd7-SDS.jpg?v=1772294658</image:loc>
      <image:title>Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5) , partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-beta-ifnb1-bhp10516703</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011048HU-SDS.jpg?v=1772294599</image:loc>
      <image:title>Recombinant Human Interferon beta (IFNB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-3-receptor-subunit-alpha-il3ra-partial-bhp10516743</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011658HU1-SDS.jpg?v=1772294668</image:loc>
      <image:title>Recombinant Human Interleukin-3 receptor subunit alpha (IL3RA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-kit-ligand-kitlg-partial-bhp10516755</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012376MO1d9-SDS.jpg?v=1772294580</image:loc>
      <image:title>Recombinant Mouse Kit ligand (Kitlg), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-1-beta-il1b-biotinylated-bhp10516727</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011614MO-B-SDS.jpg?v=1772294670</image:loc>
      <image:title>Recombinant Mouse Interleukin-1 beta (Il1b), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-urokinase-type-plasminogen-activator-plau-active-bhp10516804</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP018121MO-SDS.jpg?v=1772294581</image:loc>
      <image:title>Recombinant Mouse Urokinase-type plasminogen activator (Plau) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-syndecan-1-sdc1-partial-bhp10516816</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP020888HUd7-SDS.jpg?v=1772294585</image:loc>
      <image:title>Recombinant Human Syndecan-1 (SDC1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-galectin-9-lgals9-bhp10516763</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012895HU_F_-SDS.jpg?v=1772294677</image:loc>
      <image:title>Recombinant Human Galectin-9 (LGALS9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glucocorticoid-receptor-nr3c1-partial-bhp10516792</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP016059HU1-SDS.jpg?v=1772294596</image:loc>
      <image:title>Recombinant Human Glucocorticoid receptor (NR3C1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lim-domain-kinase-1-limk1-bhp10516771</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012952HU-SDS.jpg?v=1772294582</image:loc>
      <image:title>Recombinant Human LIM domain kinase 1 (LIMK1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-insulin-like-growth-factor-2-igf2-partial-bhp10516717</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011088HU-HPLC.jpg?v=1782433714</image:loc>
      <image:title>Recombinant Human Insulin-like growth factor 2 (IGF2), partial</image:title>
      <image:caption>Recombinant Human Insulin-like growth factor 2 (IGF2), partial – Figure 2 of 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-7-il7-bhp10516746</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011669HU-SDS.jpg?v=1772294583</image:loc>
      <image:title>Recombinant Human Interleukin-7 (IL7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nucleosome-assembly-protein-1-like-1-nap1l1-bhp10516783</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015441HUd9-SDS.jpg?v=1772294668</image:loc>
      <image:title>Recombinant Human Nucleosome assembly protein 1-like 1 (NAP1L1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-synaptic-vesicle-glycoprotein-2c-sv2c-partial-bhp10516839</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022980HUd7-SDS.jpg?v=1772294609</image:loc>
      <image:title>Recombinant Human Synaptic vesicle glycoprotein 2C（SV2C), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-polypeptide-related-sequence-a-mica-partial-bhp10516777</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013806HU-SDS.jpg?v=1782242340</image:loc>
      <image:title>Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial</image:title>
      <image:caption>Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial – Figure 1 of 3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-1-receptor-type-1-il1r1-partial-biotinylated-bhp10516729</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011621HU1-B-SDS.jpg?v=1772294667</image:loc>
      <image:title>Recombinant Human Interleukin-1 receptor type 1 (IL1R1), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gtpase-nras-nras-bhp10516794</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP016070HUk6-SDS.jpg?v=1772294601</image:loc>
      <image:title>Recombinant Human GTPase NRas (NRAS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-melanotransferrin-meltf-active-bhp10516775</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013754HU1-SDS.jpg?v=1772294602</image:loc>
      <image:title>Recombinant Human Melanotransferrin (MELTF) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leukocyte-immunoglobulin-like-receptor-subfamily-a-member-4-lilra4-partial-bhp10516770</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012936HU1-SDS.jpg?v=1772294652</image:loc>
      <image:title>Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 4 (LILRA4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nucleosome-assembly-protein-1-like-1-nap1l1-bhp10516782</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015441HU-SDS.jpg?v=1772294616</image:loc>
      <image:title>Recombinant Human Nucleosome assembly protein 1-like 1 (NAP1L1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neural-cell-adhesion-molecule-l1-l1cam-partial-active-bhp10516759</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012704MO-SDS.jpg?v=1772294660</image:loc>
      <image:title>Recombinant Mouse Neural cell adhesion molecule L1 (L1cam), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atrial-natriuretic-peptide-receptor-1-npr1-partial-bhp10516790</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP016023HUd7-SDS.jpg?v=1772294587</image:loc>
      <image:title>Recombinant Human Atrial natriuretic peptide receptor 1 (NPR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-interleukin-2-receptor-subunit-beta-il2rb-partial-bhp10516738</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011650RA1-SDS.jpg?v=1772294583</image:loc>
      <image:title>Recombinant Rat Interleukin-2 receptor subunit beta (Il2rb), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-midkine-mdk-bhp10516774</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013624MO-SDS.jpg?v=1772294586</image:loc>
      <image:title>Recombinant Mouse Midkine(Mdk)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-slam-family-member-7-slamf7-partial-active-bhp10516819</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021369HU-SDS.jpg?v=1772294672</image:loc>
      <image:title>Recombinant Human SLAM family member 7 (SLAMF7), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-insulin-receptor-insr-partial-active-bhp10516751</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011753HU-SDS.jpg?v=1772294597</image:loc>
      <image:title>Recombinant Human Insulin receptor (INSR), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-legumain-lgmn-active-bhp10516766</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012903MO1-SDS.jpg?v=1772294586</image:loc>
      <image:title>Recombinant Mouse Legumain (Lgmn) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-matrix-metalloproteinase-9-mmp9-bhp10516779</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP014679HU_A4_-SDS.jpg?v=1782433701</image:loc>
      <image:title>Recombinant Human Matrix metalloproteinase-9 (MMP9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-1-receptor-type-1-il1r1-partial-bhp10516730</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011621MO1-SDS.jpg?v=1772294670</image:loc>
      <image:title>Recombinant Mouse Interleukin-1 receptor type 1 (Il1r1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-18-receptor-accessory-protein-il18rap-partial-bhp10516725</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011611HU1-SDS.jpg?v=1772294604</image:loc>
      <image:title>Recombinant Human Interleukin-18 receptor accessory protein (IL18RAP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-somatostatin-sst-partial-bhp10516833</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022723HU-SDS.jpg?v=1772294660</image:loc>
      <image:title>Recombinant Human Somatostatin (SST), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-natural-cytotoxicity-triggering-receptor-3-ncr3-partial-active-bhp10516788</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015551MOV1j8-SDS.jpg?v=1772294586</image:loc>
      <image:title>Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3 (NCR3), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-3-receptor-subunit-alpha-il3ra-partial-bhp10516744</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011658HU1d7-SDS.jpg?v=1772294588</image:loc>
      <image:title>Recombinant Human Interleukin-3 receptor subunit alpha (IL3RA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-interferon-gamma-ifng-bhp10516713</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011050RA-SDS.jpg?v=1772294580</image:loc>
      <image:title>Recombinant Rat Interferon gamma (Ifng)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-12-subunit-beta-il12b-bhp10516722</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011587HUr16-SDS.jpg?v=1772294582</image:loc>
      <image:title>Recombinant Human Interleukin-12 subunit beta (IL12B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-legumain-lgmn-active-bhp10516767</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012903MOV1-SDS.jpg?v=1772294599</image:loc>
      <image:title>Recombinant Macaca fascicularis Legumain (LGMN) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-signal-transducer-and-activator-of-transcription-6-stat6-partial-bhp10516837</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022816HU2-SDS.jpg?v=1772294580</image:loc>
      <image:title>Recombinant Human Signal transducer and activator of transcription 6 (STAT6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-indian-hedgehog-protein-ihh-partial-bhp10516720</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011569MO-SDS.jpg?v=1772294599</image:loc>
      <image:title>Recombinant Mouse Indian hedgehog protein (Ihh), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alpha-synuclein-snca-bhp10516824</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021912HU-SDS.jpg?v=1772294596</image:loc>
      <image:title>Recombinant Human Alpha-synuclein (SNCA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-keratin-type-i-cytoskeletal-18-krt18-partial-bhp10516758</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012519HUd9-SDS.jpg?v=1772294602</image:loc>
      <image:title>Recombinant Human Keratin, type I cytoskeletal 18 (KRT18), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cell-surface-glycoprotein-muc18-mcam-partial-active-bhp10516773</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013563HU1-SDS.jpg?v=1772294584</image:loc>
      <image:title>Recombinant Human Cell surface glycoprotein MUC18 (MCAM), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-osteopontin-spp1-partial-bhp10516831</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022603MOd7-SDS.jpg?v=1772294656</image:loc>
      <image:title>Recombinant Mouse Osteopontin (Spp1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-osteopontin-spp1-active-bhp10516829</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022603HU-SDS.jpg?v=1772294579</image:loc>
      <image:title>Recombinant Human Osteopontin (SPP1) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-synaptic-vesicle-glycoprotein-2c-sv2c-partial-bhp10516838</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022980HU-SDS.jpg?v=1772294586</image:loc>
      <image:title>Recombinant Human Synaptic vesicle glycoprotein 2C（SV2C), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-placenta-growth-factor-pgf-bhp10516803</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017854HU_F2_-SDS.jpg?v=1772294651</image:loc>
      <image:title>Recombinant Human Placenta growth factor (PGF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-natural-cytotoxicity-triggering-receptor-3-ncr3-partial-bhp10516787</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015551HU1d7-SDS.jpg?v=1772294660</image:loc>
      <image:title>Recombinant Human Natural cytotoxicity triggering receptor 3 (NCR3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-amino-acid-transporter-heavy-chain-slc3a2-slc3a2-partial-active-bhp10516821</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021640HU1-SDS.jpg?v=1772294599</image:loc>
      <image:title>Recombinant Human Amino acid transporter heavy chain SLC3A2 (SLC3A2), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-33-il33-partial-biotinylated-bhp10516741</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011656HU1-B-SDS.jpg?v=1772294581</image:loc>
      <image:title>Recombinant Human Interleukin-33 (IL33), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-7-receptor-subunit-alpha-il7r-partial-bhp10516747</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011670HU1d9-SDS.jpg?v=1772294584</image:loc>
      <image:title>Recombinant Human Interleukin-7 receptor subunit alpha (IL7R), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-platelet-derived-growth-factor-receptor-alpha-pdgfra-partial-active-bhp10516799</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017712HU1-SDS.jpg?v=1772294664</image:loc>
      <image:title>Recombinant Human Platelet-derived growth factor receptor alpha (PDGFRA), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-mast-stem-cell-growth-factor-receptor-kit-kit-partial-bhp10516754</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012375MO1-SDS.jpg?v=1772294661</image:loc>
      <image:title>Recombinant Mouse Mast/stem cell growth factor receptor Kit (Kit), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-parathyroid-hormone-pth-active-bhp10516808</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP018987MOV-SDS.jpg?v=1772294585</image:loc>
      <image:title>Recombinant Macaca fascicularis Parathyroid hormone (PTH) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-32-il32-bhp10516739</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011655HU_F2_-SDS.jpg?v=1772294585</image:loc>
      <image:title>Recombinant Human Interleukin-32 (IL32)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-maltase-glucoamylase-mgam-partial-bhp10516776</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013772HU_A4_-SDS.jpg?v=1772294584</image:loc>
      <image:title>Recombinant Human Maltase-glucoamylase（MGAM), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-platelet-derived-growth-factor-receptor-beta-pdgfrb-partial-active-bhp10516801</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017713HU1-SDS.jpg?v=1772294595</image:loc>
      <image:title>Recombinant Human Platelet-derived growth factor receptor beta (PDGFRB), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-interleukin-2-il2-bhp10516735</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011629MOW-SDS.jpg?v=1772294584</image:loc>
      <image:title>Recombinant Macaca mulatta Interleukin-2 (IL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-rnf43-rnf43-partial-bhp10516812</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP019892HU-SDS.jpg?v=1772294600</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase RNF43 (RNF43), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-6-receptor-subunit-alpha-il6r-partial-bhp10516745</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011665HUb0-SDS.jpg?v=1772294596</image:loc>
      <image:title>Recombinant Human Interleukin-6 receptor subunit alpha (IL6R), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcription-factor-sox-1-sox1-bhp10516825</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022417HU-SDS.jpg?v=1772294585</image:loc>
      <image:title>Recombinant Human Transcription factor SOX-1 (SOX1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-proto-oncogene-tyrosine-protein-kinase-receptor-ret-ret-partial-active-bhp10516809</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP019572HU-SDS.jpg?v=1772294581</image:loc>
      <image:title>Recombinant Human Proto-oncogene tyrosine-protein kinase receptor Ret (RET), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-slit-homolog-2-protein-slit2-partial-bhp10516822</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021768HU-SDS.jpg?v=1772294584</image:loc>
      <image:title>Recombinant Human Slit homolog 2 protein (SLIT2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transcription-factor-sox-2-sox2-bhp10516826</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022426MO-SDS.jpg?v=1772294579</image:loc>
      <image:title>Recombinant Mouse Transcription factor SOX-2 (Sox2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-oncostatin-m-osm-bhp10516795</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017260MO-SDS.jpg?v=1772294580</image:loc>
      <image:title>Recombinant Mouse Oncostatin-M (Osm)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-1-receptor-like-1-il1rl1-partial-active-bhp10516731</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011626HU-SDS.jpg?v=1772294623</image:loc>
      <image:title>Recombinant Human Interleukin-1 receptor-like 1 (IL1RL1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atrial-natriuretic-peptide-receptor-1-npr1-partial-bhp10516791</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP016023HUd9-SDS.jpg?v=1772294598</image:loc>
      <image:title>Recombinant Human Atrial natriuretic peptide receptor 1 (NPR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-13-receptor-subunit-alpha-1-il13ra1-partial-bhp10516724</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011591MO1-SDS.jpg?v=1772294666</image:loc>
      <image:title>Recombinant Mouse Interleukin-13 receptor subunit alpha-1 (Il13ra1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interferon-gamma-ifng-biotinylated-bhp10516709</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011050MOk7-B-SDS.jpg?v=1772294588</image:loc>
      <image:title>Recombinant Mouse Interferon gamma (Ifng), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-platelet-derived-growth-factor-receptor-alpha-pdgfra-partial-bhp10516800</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017712MO-SDS.jpg?v=1772294593</image:loc>
      <image:title>Recombinant Mouse Platelet-derived growth factor receptor alpha (Pdgfra), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leukosialin-spn-partial-bhp10516828</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022590HU-SDS.jpg?v=1772294664</image:loc>
      <image:title>Recombinant Human Leukosialin (SPN), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nkg2-d-type-ii-integral-membrane-protein-klrk1-partial-bhp10516757</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012474HU2-SDS.jpg?v=1772294581</image:loc>
      <image:title>Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sorcin-sri-bhp10516832</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022665MO-SDS.jpg?v=1772294594</image:loc>
      <image:title>Recombinant Mouse Sorcin (Sri)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-proto-oncogene-tyrosine-protein-kinase-receptor-ret-ret-partial-bhp10516810</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP019572HUd9-SDS.jpg?v=1772294580</image:loc>
      <image:title>Recombinant Human Proto-oncogene tyrosine-protein kinase receptor Ret (RET), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-interleukin-2-il2-bhp10516736</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011629RA-SDS.jpg?v=1772294649</image:loc>
      <image:title>Recombinant Rat Interleukin-2 (Il2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-osteopontin-spp1-partial-bhp10516830</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022603MO-SDS.jpg?v=1772294594</image:loc>
      <image:title>Recombinant Mouse Osteopontin (Spp1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-33-il33-partial-bhp10516740</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011656HU1-SDS.jpg?v=1772294670</image:loc>
      <image:title>Recombinant Human Interleukin-33 (IL33), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-probable-global-transcription-activator-snf2l2-smarca2-partial-bhp10516823</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021799HU4-SDS.jpg?v=1772294582</image:loc>
      <image:title>Recombinant Human Probable global transcription activator SNF2L2 (SMARCA2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-nicotinamide-phosphoribosyltransferase-nampt-bhp10516781</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015422MO-SDS.jpg?v=1772294585</image:loc>
      <image:title>Recombinant Mouse Nicotinamide phosphoribosyltransferase (Nampt)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-somatostatin-sst-bhp10516834</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022723HU_A4_-SDS.jpg?v=1772294605</image:loc>
      <image:title>Recombinant Human Somatostatin (SST)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-melanoma-associated-antigen-2-magea2-magea2b-bhp10516772</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013327HU-SDS.jpg?v=1772294597</image:loc>
      <image:title>Recombinant Human Melanoma-associated antigen 2 (MAGEA2; MAGEA2B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neural-cell-adhesion-molecule-1-ncam1-partial-active-bhp10516785</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015511HU2-SDS.jpg?v=1772294671</image:loc>
      <image:title>Recombinant Human Neural cell adhesion molecule 1 (NCAM1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-resistin-retn-bhp10516811</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP019573MO-SDS.jpg?v=1772294584</image:loc>
      <image:title>Recombinant Mouse Resistin (Retn)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-napsin-a-napsa-bhp10516784</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015452MO_A4_-SDS.jpg?v=1772294669</image:loc>
      <image:title>Recombinant Mouse Napsin-A (Napsa)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcription-factor-sox-3-sox3-bhp10516827</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022429HU-SDS.jpg?v=1772294599</image:loc>
      <image:title>Recombinant Human Transcription factor SOX-3 (SOX3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-13-receptor-subunit-alpha-1-il13ra1-partial-active-bhp10516723</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011591HU1-SDS.jpg?v=1772294599</image:loc>
      <image:title>Recombinant Human Interleukin-13 receptor subunit alpha-1 (IL13RA1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-galectin-9-lgals9-partial-biotinylated-bhp10516761</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012895HU1-B-SDS.jpg?v=1772294582</image:loc>
      <image:title>Recombinant Human Galectin-9 (LGALS9), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alpha-1-antichymotrypsin-serpina3-bhp10516817</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021059HU-SDS.jpg?v=1772294593</image:loc>
      <image:title>Recombinant Human Alpha-1-antichymotrypsin (SERPINA3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-signal-regulatory-protein-beta-1-sirpb1-partial-bhp10516818</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021335HUd7-SDS.jpg?v=1772294658</image:loc>
      <image:title>Recombinant Human Signal-regulatory protein beta-1 (SIRPB1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytochrome-c-oxidase-subunit-1-mt-co1-partial-bhp10516780</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015072HU-SDS.jpg?v=1772294617</image:loc>
      <image:title>Recombinant Human Cytochrome c oxidase subunit 1 (MT-CO1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-paired-box-protein-pax-8-pax8-partial-active-bhp10516796</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017494HU2-SDS.jpg?v=1772294596</image:loc>
      <image:title>Recombinant Human Paired box protein Pax-8 (PAX8), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transaldolase-taldo1-bhp10516840</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023112HU-SDS.jpg?v=1782434477</image:loc>
      <image:title>Recombinant Human Transaldolase (TALDO1)</image:title>
      <image:caption>Recombinant Human Transaldolase (TALDO1) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protransforming-growth-factor-alpha-tgfa-partial-bhp10516843</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023445MOd7-SDS.jpg?v=1772294673</image:loc>
      <image:title>Recombinant Mouse Protransforming growth factor alpha (Tgfa), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protransforming-growth-factor-alpha-tgfa-partial-bhp10516842</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023445MO-SDS.jpg?v=1772294602</image:loc>
      <image:title>Recombinant Mouse Protransforming growth factor alpha (Tgfa), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transforming-growth-factor-beta-3-proprotein-tgfb3-partial-bhp10516847</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023449MO-SDS.jpg?v=1772294607</image:loc>
      <image:title>Recombinant Mouse Transforming growth factor beta-3 proprotein (Tgfb3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-parathyroid-hormone-pth-active-bhp10516807</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP018987HU-SDS.jpg?v=1772294597</image:loc>
      <image:title>Recombinant Human Parathyroid hormone (PTH) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transforming-growth-factor-beta-3-proprotein-tgfb3-bhp10516846</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023449HU2-SDS.jpg?v=1772294615</image:loc>
      <image:title>Recombinant Human Transforming growth factor beta-3 proprotein (TGFB3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serotransferrin-tf-bhp10516841</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023412HUd7-SDS.jpg?v=1772294657</image:loc>
      <image:title>Recombinant Human Serotransferrin (TF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-tnf-partial-active-bhp10516854</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023955MO2-SDS.jpg?v=1772294594</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor (Tnf), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transforming-growth-factor-beta-1-proprotein-tgfb1-bhp10516844</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023446HU_A4_c9-SDS.jpg?v=1772294608</image:loc>
      <image:title>Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tgf-beta-receptor-type-2-tgfbr2-partial-bhp10516848</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023452HU2d7-SDS.jpg?v=1772294659</image:loc>
      <image:title>Recombinant Human TGF-beta receptor type-2 (TGFBR2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-10a-tnfrsf10a-partial-bhp10516856</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023964HU1-SDS.jpg?v=1772294675</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 10A (TNFRSF10A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transforming-growth-factor-beta-1-proprotein-tgfb1-partial-bhp10516845</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023446MO-SDS.jpg?v=1772294594</image:loc>
      <image:title>Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-tumor-necrosis-factor-tnf-partial-active-bhp10516855</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023955MOW-SDS.jpg?v=1772294591</image:loc>
      <image:title>Recombinant Macaca mulatta Tumor necrosis factor (TNF), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-receptor-superfamily-member-4-tnfrsf4-bhp10516861</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023981MO-SDS.jpg?v=1772294610</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-placenta-growth-factor-pgf-bhp10516802</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017854HU_F1_-SDS.jpg?v=1772294674</image:loc>
      <image:title>Recombinant Human Placenta growth factor (PGF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-tnf-partial-bhp10516852</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023955HU-SDS.jpg?v=1772294658</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor (TNF), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-ligand-superfamily-member-4-tnfsf4-partial-bhp10516864</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023994MO1-SDS.jpg?v=1772294670</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-insulin-like-growth-factor-binding-protein-3-receptor-tmem219-partial-bhp10516851</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023813HU-SDS.jpg?v=1772294593</image:loc>
      <image:title>Recombinant Human Insulin-like growth factor-binding protein 3 receptor (TMEM219), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-tnf-partial-biotinylated-bhp10516853</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023955HUk7-B-SDS.jpg?v=1772294613</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor (TNF), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-triggering-receptor-expressed-on-myeloid-cells-2-trem2-partial-bhp10516865</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP024405MOd7-SDS.jpg?v=1772294593</image:loc>
      <image:title>Recombinant Mouse Triggering receptor expressed on myeloid cells 2 (Trem2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-tyrosine-protein-kinase-receptor-tyro3-tyro3-partial-bhp10516872</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP025396RA-SDS.jpg?v=1772294606</image:loc>
      <image:title>Recombinant Rat Tyrosine-protein kinase receptor TYRO3 (Tyro3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-transthyretin-ttr-bhp10516869</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP025270BO-SDS.jpg?v=1772294607</image:loc>
      <image:title>Recombinant Bovine Transthyretin (TTR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-transthyretin-ttr-bhp10516870</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP025270BOc7-SDS.jpg?v=1772294677</image:loc>
      <image:title>Recombinant Bovine Transthyretin (TTR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-ligand-superfamily-member-4-tnfsf4-partial-bhp10516863</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023994HU1b0-SDS.jpg?v=1772294595</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-17-tnfrsf17-partial-active-bhp10516858</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023974HU1h8-SDS.jpg?v=1772294596</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-tumor-necrosis-factor-receptor-superfamily-member-1a-tnfrsf1a-partial-bhp10516860</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023977RA-SDS.jpg?v=1772294608</image:loc>
      <image:title>Recombinant Rat Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-17-tnfrsf17-partial-active-bhp10516857</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023974HU1d7-SDS.jpg?v=1772294595</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-zona-pellucida-sperm-binding-protein-3-zp3-bhp10516881</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP027121CA-SDS.jpg?v=1772294603</image:loc>
      <image:title>Recombinant Cat Zona pellucida sperm-binding protein 3 (ZP3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-receptor-superfamily-member-1a-tnfrsf1a-partial-bhp10516859</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/Cusabio_Protein_Placeholder_0a80405b-0235-437f-bd53-e2110c4c89c1.jpg?v=1784925933</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a), partial</image:title>
      <image:caption>Recombinant Mouse Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a), partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-wnt-10a-wnt10a-bhp10516875</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP026129MO-SDS.jpg?v=1772294604</image:loc>
      <image:title>Recombinant Mouse Protein Wnt-10a (Wnt10a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-heterogeneous-nuclear-ribonucleoproteins-a2-b1-hnrnpa2b1-partial-bhp10516885</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP2576HU1-SDS.jpg?v=1772294594</image:loc>
      <image:title>Recombinant Human Heterogeneous nuclear ribonucleoproteins A2/B1 (HNRNPA2B1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-ligand-superfamily-member-12-tnfsf12-partial-bhp10516862</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023987MO1-SDS.jpg?v=1772294617</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor ligand superfamily member 12 (Tnfsf12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunodeficiency-virus-type-1-group-m-subtype-b-gag-polyprotein-gag-partial-bhp10516891</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP319413HKY1-SDS.jpg?v=1772294684</image:loc>
      <image:title>Recombinant Human immunodeficiency virus type 1 group M subtype B Gag polyprotein (gag), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-4-il4-bhp10516886</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP301281MOV-SDS.jpg?v=1772294602</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin-4 (IL4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-regakine-1-bhp10516888</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP307300BO-SDS.jpg?v=1772294602</image:loc>
      <image:title>Recombinant Bovine Regakine-1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-coactivator-yap1-yap1-bhp10516880</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP026244HU-SDS.jpg?v=1772294669</image:loc>
      <image:title>Recombinant Human Transcriptional coactivator YAP1 (YAP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-vaccinia-virus-protein-opg190-opg190-partial-bhp10516890</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP312446VAI-SDS.jpg?v=1772294610</image:loc>
      <image:title>Recombinant Vaccinia virus Protein OPG190 (OPG190), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-zona-pellucida-sperm-binding-protein-3-zp3-bhp10516882</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP027121CAd7-SDS.jpg?v=1772294676</image:loc>
      <image:title>Recombinant Cat Zona pellucida sperm-binding protein 3 (ZP3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-vaccinia-virus-soluble-interferon-gamma-receptor-opg193-opg193-bhp10516894</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP322719VAA-SDS.jpg?v=1772294603</image:loc>
      <image:title>Recombinant Vaccinia virus Soluble interferon gamma receptor OPG193 (OPG193)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nkg2-e-type-ii-integral-membrane-protein-klrc3-partial-bhp10516884</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP2309HU-SDS.jpg?v=1772294594</image:loc>
      <image:title>Recombinant Human NKG2-E type II integral membrane protein (KLRC3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunoglobulin-heavy-constant-epsilon-ighe-partial-active-bhp10516883</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP1684HU3d7-SDS.jpg?v=1772294609</image:loc>
      <image:title>Recombinant Human Immunoglobulin heavy constant epsilon (IGHE), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-wnt-4-wnt4-bhp10516878</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP026137MOr10-SDS.jpg?v=1772294603</image:loc>
      <image:title>Recombinant Mouse Protein Wnt-4 (Wnt4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-thymic-stromal-lymphopoietin-tslp-active-bhp10516868</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP025141HUh7-SDS.jpg?v=1772294608</image:loc>
      <image:title>Recombinant Human Thymic stromal lymphopoietin (TSLP) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-autographa-californica-nuclear-polyhedrosis-virus-major-envelope-glycoprotein-gp64-partial-bhp10516896</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP324635ARA1d7-SDS.jpg?v=1772294600</image:loc>
      <image:title>Recombinant Autographa californica nuclear polyhedrosis virus Major envelope glycoprotein (GP64), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-6-il6-bhp10516887</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/Cusabio_Protein_Placeholder_30b62492-15e6-4a30-8ddb-ac7b50d1fd34.jpg?v=1784925934</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin-6 (IL6)</image:title>
      <image:caption>Recombinant Macaca fascicularis Interleukin-6 (IL6) – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunodeficiency-virus-type-1-group-m-subtype-b-gag-polyprotein-gag-partial-bhp10516892</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP319413HKY1c7-SDS.jpg?v=1772294678</image:loc>
      <image:title>Recombinant Human immunodeficiency virus type 1 group M subtype B Gag polyprotein (gag), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vitronectin-vtn-bhp10516874</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP025944HU-SDS.jpg?v=1772294592</image:loc>
      <image:title>Recombinant Human Vitronectin (VTN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-wnt-2-wnt2-bhp10516877</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP026133MO-SDS.jpg?v=1772294608</image:loc>
      <image:title>Recombinant Mouse Protein Wnt-2 (Wnt2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-wnt-10b-wnt10b-bhp10516876</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP026130MO-SDS.jpg?v=1772294595</image:loc>
      <image:title>Recombinant Mouse Protein Wnt-10b (Wnt10b)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-perilipin-2-plin2-bhp10516902</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP337564MOd9-SDS.jpg?v=1772294624</image:loc>
      <image:title>Recombinant Mouse Perilipin-2 (Plin2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-severe-acute-respiratory-syndrome-coronavirus-2-spike-glycoprotein-s-e484k-n501y-partial-bhp10516899</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP3324GMY1_M15_d7-SDS.jpg?v=1772294616</image:loc>
      <image:title>Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (E484K,N501Y), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-interleukin-6-il6-bhp10516893</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP322670RA-SDS.jpg?v=1772294676</image:loc>
      <image:title>Recombinant Rat Interleukin-6(Il6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-wnt-5a-wnt5a-bhp10516879</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP026138MO-SDS.jpg?v=1772294608</image:loc>
      <image:title>Recombinant Mouse Protein Wnt-5a (Wnt5a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-regakine-1-bhp10516889</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP307300BOd7-SDS.jpg?v=1772294632</image:loc>
      <image:title>Recombinant Bovine Regakine-1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-alpha-1-13-ifna1-bhp10516909</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP365592HUd9-SDS.jpg?v=1772294673</image:loc>
      <image:title>Recombinant Human Interferon alpha-1/13 (IFNA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-alpha-1-13-ifna1-active-bhp10516908</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP365592HU-SDS.jpg?v=1772294613</image:loc>
      <image:title>Recombinant Human Interferon alpha-1/13 (IFNA1) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-programmed-cell-death-protein-1-pdcd1-partial-bhp10516911</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP3745MO-SDS.jpg?v=1772294599</image:loc>
      <image:title>Recombinant Mouse Programmed cell death protein 1 (Pdcd1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-urokinase-type-plasminogen-activator-plau-partial-bhp10516905</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP360437HUd9-SDS.jpg?v=1772294621</image:loc>
      <image:title>Recombinant Human Urokinase-type plasminogen activator (PLAU), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-perilipin-2-plin2-bhp10516901</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP337564MO-SDS.jpg?v=1772294602</image:loc>
      <image:title>Recombinant Mouse Perilipin-2 (Plin2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-tumor-necrosis-factor-tnf-partial-active-bhp10516897</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP325438RA-SDS.jpg?v=1772294671</image:loc>
      <image:title>Recombinant Rat Tumor necrosis factor (Tnf), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vascular-endothelial-growth-factor-a-long-form-vegfa-active-bhp10516873</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP025833HU_F4_-SDS.jpg?v=1772294599</image:loc>
      <image:title>Recombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-angiopoietin-related-protein-4-angptl4-bhp10516914</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP4186MO-SDS.jpg?v=1772294611</image:loc>
      <image:title>Recombinant Mouse Angiopoietin-related protein 4 (Angptl4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/virus-like-particles-vlps-isotype-control-bhp10516912</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/Cusabio_Protein_Placeholder_b38c98f0-9162-4f09-912e-25d0bae346fc.jpg?v=1784925934</image:loc>
      <image:title>Virus-Like Particles (VLPs) isotype control</image:title>
      <image:caption>Virus-Like Particles (VLPs) isotype control – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transferrin-receptor-protein-1-tfrc-partial-biotinylated-bhp10516907</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP3648HUj7-B-SDS.jpg?v=1772294609</image:loc>
      <image:title>Recombinant Human Transferrin receptor protein 1 (TFRC), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interferon-alpha-2-ifna2-biotinylated-bhp10516910</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP365593MOj7-B-SDS.jpg?v=1772294605</image:loc>
      <image:title>Recombinant Mouse Interferon alpha-2 (Ifna2), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-natural-cytotoxicity-triggering-receptor-3-ligand-1-ncr3lg1-partial-active-bhp10516917</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP4942MOV-SDS.jpg?v=1772294612</image:loc>
      <image:title>Recombinant Macaca fascicularis natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-protein-rv1269c-bhp10516904</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP358663MVZ-SDS.jpg?v=1772294606</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis Protein Rv1269c</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-macaca-fascicularis-brain-cdna-clone-qora-11660-similar-to-human-lymphocyte-antigen-6-complex-locus-e-ly6e-mrna-refseq-nm-002346-1-bhp10516925</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5575MOV-SDS.jpg?v=1772294620</image:loc>
      <image:title>Recombinant Macaca fascicularis Macaca fascicularis brain cDNA clone: QorA-11660, similar to human lymphocyte antigen 6 complex, locus E (LY6E), mRNA, RefSeq: NM_002346.1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-severe-acute-respiratory-syndrome-coronavirus-2-spike-glycoprotein-s-e484k-n501y-partial-bhp10516898</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP3324GMY1_M15_-SDS.jpg?v=1772294610</image:loc>
      <image:title>Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (E484K,N501Y), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arachis-hypogaea-allergen-ara-h-1-clone-p41b-partial-bhp10516900</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP337356ANE1-SDS.jpg?v=1782434301</image:loc>
      <image:title>Recombinant Arachis hypogaea Allergen Ara h 1, clone P41B, partial</image:title>
      <image:caption>Recombinant Arachis hypogaea Allergen Ara h 1, clone P41B, partial – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-sendai-virus-fusion-glycoprotein-f0-f-partial-bhp10516906</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP361388SFB-SDS.jpg?v=1772294602</image:loc>
      <image:title>Recombinant Sendai virus Fusion glycoprotein F0 (F), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-autographa-californica-nuclear-polyhedrosis-virus-major-envelope-glycoprotein-gp64-partial-bhp10516895</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP324635ARA1-SDS.jpg?v=1772294609</image:loc>
      <image:title>Recombinant Autographa californica nuclear polyhedrosis virus Major envelope glycoprotein (GP64), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-2-receptor-subunit-alpha-il2ra-partial-bhp10516920</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5104MOV-SDS.jpg?v=1772294605</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin-2 receptor subunit alpha (IL2RA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tsh-alpha-beta-heterodimer-protein-bhp10516922</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5167HU-SDS.jpg?v=1772294624</image:loc>
      <image:title>Recombinant Human TSH alpha/beta Heterodimer Protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/virus-like-particles-vlps-isotype-control-mcherry-fluorescent-bhp10516913</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/Cusabio_Protein_Placeholder_a2d2efaa-0177-4006-b40b-84f1df2316b0.jpg?v=1784925935</image:loc>
      <image:title>Virus-Like Particles (VLPs) isotype control-mCherry Fluorescent</image:title>
      <image:caption>Virus-Like Particles (VLPs) isotype control-mCherry Fluorescent – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prostate-specific-antigen-klk3-bhp10516915</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP4675HU-SDS.jpg?v=1772294680</image:loc>
      <image:title>Recombinant Human Prostate-specific antigen (KLK3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-carcinoembryonic-antigen-related-cell-adhesion-molecule-1-isoform-x1-ceacam1-partial-bhp10516936</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6160MOV-SDS.jpg?v=1772294607</image:loc>
      <image:title>Recombinant Macaca fascicularis carcinoembryonic antigen-related cell adhesion molecule 1 isoform X1 (CEACAM1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-importin-subunit-beta-1-kpnb1-bhp10516946</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP622929HU_A4_-SDS.jpg?v=1772294626</image:loc>
      <image:title>Recombinant Human Importin subunit beta-1 (KPNB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-orthohantavirus-hantanense-envelopment-polyprotein-partial-bhp10516916</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP4799GTQ-SDS.jpg?v=1772294681</image:loc>
      <image:title>Recombinant Orthohantavirus hantanense Envelopment polyprotein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cadherin-18-cdh18-partial-bhp10516935</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP615709HU-SDS.jpg?v=1772294608</image:loc>
      <image:title>Recombinant Human Cadherin-18 (CDH18), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-leukemia-virus-3-envelope-glycoprotein-gp63-env-partial-bhp10516930</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP611313HAALq10-SDS.jpg?v=1772294614</image:loc>
      <image:title>Recombinant Human T-cell leukemia virus 3 Envelope glycoprotein gp63 (env), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-butyrophilin-subfamily-1-member-a1-btn1a1-partial-bhp10516934</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP615684HU-SDS.jpg?v=1772294613</image:loc>
      <image:title>Recombinant Human Butyrophilin subfamily 1 member A1 (BTN1A1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-nkg2a-protein-nkg2a-partial-bhp10516919</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5045MOW-SDS.jpg?v=1772294618</image:loc>
      <image:title>Recombinant Macaca fascicularis NKG2A protein (nkg2A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transthyretin-ttr-bhp10516871</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP025270HUb1-SDS.jpg?v=1772294600</image:loc>
      <image:title>Recombinant Human Transthyretin (TTR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cd226-antigen-cd226-partial-bhp10516938</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP618996HUd9-SDS.jpg?v=1772294630</image:loc>
      <image:title>Recombinant Human CD226 antigen (CD226), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-disintegrin-and-metalloproteinase-domain-containing-protein-9-adam9-partial-biotinylated-bhp10516937</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP618774HUk7-B-SDS.jpg?v=1772294607</image:loc>
      <image:title>Recombinant Human Disintegrin and metalloproteinase domain-containing protein 9 (ADAM9), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-cytokine-receptor-like-factor-2-crlf2-partial-active-bhp10516924</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5357MOVd7-SDS.jpg?v=1772294611</image:loc>
      <image:title>Recombinant Macaca fascicularis cytokine receptor-like factor 2 (CRLF2), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-2-receptor-subunit-alpha-il2ra-partial-bhp10516921</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5104MOVd9-SDS.jpg?v=1772294625</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin-2 receptor subunit alpha (IL2RA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cd58-protein-cd58-partial-biotinylated-active-bhp10516932</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6138HUj8-B-SDS.jpg?v=1772294611</image:loc>
      <image:title>Recombinant Human CD58 protein (CD58), partial, Biotinylated (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-erythropoietin-receptor-epor-partial-bhp10516928</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5769MOWh8-SDS.jpg?v=1772294677</image:loc>
      <image:title>Recombinant Macaca mulatta Erythropoietin receptor (EPOR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-p-selectin-glycoprotein-ligand-1-selplg-partial-active-bhp10516943</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP621767HU1-SDS.jpg?v=1772294628</image:loc>
      <image:title>Recombinant Human P-selectin glycoprotein ligand 1 (SELPLG), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-interleukin-6-receptor-subunit-alpha-il6r-partial-active-bhp10516923</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5215MOW-SDS.jpg?v=1772294690</image:loc>
      <image:title>Recombinant Macaca mulatta Interleukin-6 receptor subunit alpha (IL6R), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-carbonic-anhydrase-9-ca9-partial-bhp10516933</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP614990HU1-SDS.jpg?v=1772294614</image:loc>
      <image:title>Recombinant Human Carbonic anhydrase 9 (CA9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-2-il2-bhp10516951</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP640916MOVb0-SDS.jpg?v=1772294610</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin-2 (IL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-parabacteroides-distasonis-outer-membrane-protein-beta-barrel-domain-containing-protein-bhp10516950</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6395GZQ-SDS.jpg?v=1772294616</image:loc>
      <image:title>Recombinant Parabacteroides distasonis Outer membrane protein beta-barrel domain-containing protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-falciparum-apical-membrane-antigen-1-partial-biotinylated-bhp10516926</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5760EWP_M_-B-SDS.jpg?v=1772294618</image:loc>
      <image:title>Recombinant Plasmodium falciparum Apical membrane antigen 1, partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nectin-1-nectin1-partial-biotinylated-bhp10516944</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP621867HU-B-SDS.jpg?v=1772294633</image:loc>
      <image:title>Recombinant Human Nectin-1(NECTIN1), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-receptor-superfamily-member-16-ngfr-partial-biotinylated-bhp10516949</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6393MOk7-B-SDS.jpg?v=1772294687</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor receptor superfamily member 16 (Ngfr), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-calcium-binding-protein-39-cab39-bhp10516953</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP640939HU-SDS.jpg?v=1772294611</image:loc>
      <image:title>Recombinant Human Tumor Calcium-binding protein 39 CAB39)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lymphocyte-antigen-6k-ly6k-active-bhp10516941</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP621061HUd9-SDS.jpg?v=1772294608</image:loc>
      <image:title>Recombinant Human Lymphocyte antigen 6K (LY6K) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-natural-cytotoxicity-triggering-receptor-3-ligand-1-ncr3lg1-partial-active-bhp10516918</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP4942MOVd9-SDS.jpg?v=1772294611</image:loc>
      <image:title>Recombinant Macaca fascicularis natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-insulin-like-growth-factor-1-igf1-bhp10516903</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP356436HUc9-SDS.jpg?v=1772294598</image:loc>
      <image:title>Recombinant Human Insulin-like growth factor 1 (IGF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-2-receptor-subunit-beta-il2rb-partial-bhp10516958</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP657828MOV-SDS.jpg?v=1772294612</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin-2 receptor subunit beta (IL2RB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-receptor-superfamily-member-16-ngfr-partial-bhp10516947</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6393MO-SDS.jpg?v=1772294626</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor receptor superfamily member 16 (Ngfr), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lymphocyte-antigen-6k-ly6k-bhp10516942</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP621061HUh8-SDS.jpg?v=1772294627</image:loc>
      <image:title>Recombinant Human Lymphocyte antigen 6K (LY6K)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-itgav-and-itgb6-heterodimer-protein-biotinylated-bhp10516957</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6541MOV-B-SDS.jpg?v=1772294609</image:loc>
      <image:title>Recombinant Macaca fascicularis ITGAV&amp;ITGB6 Heterodimer Protein, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-mhc-class-i-polypeptide-related-sequence-b-micb-partial-active-bhp10516959</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6584MOV_A4_-SDS.jpg?v=1772294624</image:loc>
      <image:title>Recombinant Macaca fascicularis MHC class I polypeptide-related sequence B (MICB), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-urokinase-type-plasminogen-activator-plau-active-bhp10516966</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6725MOV-SDS.jpg?v=1772294688</image:loc>
      <image:title>Recombinant Macaca fascicularis Urokinase-type plasminogen activator (PLAU) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-itgav-and-itgb6-heterodimer-protein-active-bhp10516956</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6541-SDS.jpg?v=1772294618</image:loc>
      <image:title>Recombinant Macaca fascicularis ITGAV&amp;ITGB6 Heterodimer Protein (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-scavenger-receptor-cysteine-rich-type-1-protein-m130-cd163-partial-bhp10516954</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP649669PI-SDS.jpg?v=1772294610</image:loc>
      <image:title>Recombinant Pig Scavenger receptor cysteine-rich type 1 protein M130 (CD163), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-integrin-alpha-4-itga4-partial-bhp10516955</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6511MO4-SDS.jpg?v=1772294613</image:loc>
      <image:title>Recombinant Mouse Integrin alpha-4 (Itga4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-nemestrina-tnf-superfamily-member-13-tnfsf13-partial-bhp10516964</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6723MOX-SDS.jpg?v=1772294686</image:loc>
      <image:title>Recombinant Macaca nemestrina TNF superfamily member 13(TNFSF13), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-receptor-protein-tyrosine-kinase-partial-bhp10516967</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6737MOV-SDS.jpg?v=1772294627</image:loc>
      <image:title>Recombinant Macaca fascicularis receptor protein-tyrosine kinase, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-neural-cell-adhesion-molecule-l1-l1cam-partial-active-bhp10516977</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6775MOV-SDS.jpg?v=1772294679</image:loc>
      <image:title>Recombinant Macaca fascicularis Neural cell adhesion molecule L1 (L1CAM), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-low-affinity-immunoglobulin-gamma-fc-region-receptor-iii-a-fcer1a-partial-bhp10516963</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6693MOV-SDS.jpg?v=1772294694</image:loc>
      <image:title>Recombinant Macaca fascicularis Low affinity immunoglobulin gamma Fc region receptor III-A (FCER1A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-immunoreceptor-with-ig-and-itim-domains-tigit-partial-biotinylated-bhp10516973</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP675446HU-B-SDS.jpg?v=1772294696</image:loc>
      <image:title>Recombinant Human T-cell immunoreceptor with Ig and ITIM domains(TIGIT), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-2-il2-bhp10516952</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP640916MOVd9-SDS.jpg?v=1772294677</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin-2 (IL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cd58-protein-cd58-partial-biotinylated-bhp10516931</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6138HU-B-SDS.jpg?v=1782433704</image:loc>
      <image:title>Recombinant Human CD58 protein (CD58), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-cd226-antigen-cd226-partial-biotinylated-bhp10516979</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6842MOV-B-SDS.jpg?v=1772294617</image:loc>
      <image:title>Recombinant Macaca fascicularis CD226 antigen (CD226), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-t-cell-surface-glycoprotein-cd4-cd4-partial-active-bhp10516970</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6740MOW-SDS.jpg?v=1772294692</image:loc>
      <image:title>Recombinant Macaca mulatta T-cell surface glycoprotein CD4 (CD4), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-interleukin-23-receptor-il23r-partial-bhp10516975</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6762MOV-SDS.jpg?v=1772294630</image:loc>
      <image:title>Recombinant Macaca mulatta Interleukin 23 receptor (IL23R), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-interleukin-1-receptor-type-1-il1r1-partial-bhp10516969</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6739MOW-SDS.jpg?v=1772294683</image:loc>
      <image:title>Recombinant Macaca mulatta Interleukin 1 receptor type 1 (IL1R1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516981</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP684467HU10s1-SDS.jpg?v=1772294614</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-leukemia-virus-3-envelope-glycoprotein-gp63-env-partial-bhp10516929</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP611313HAAL-SDS.jpg?v=1772294610</image:loc>
      <image:title>Recombinant Human T-cell leukemia virus 3 Envelope glycoprotein gp63 (env), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-keratin-type-i-cytoskeletal-18-krt18-partial-bhp10516990</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP685592RA-SDS.jpg?v=1772294691</image:loc>
      <image:title>Recombinant Rat Keratin, type I cytoskeletal 18 (Krt18), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-tnf-superfamily-member-13b-tnfsf13b-partial-active-bhp10516965</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6724MOV-SDS.jpg?v=1772294610</image:loc>
      <image:title>Recombinant Macaca fascicularis TNF superfamily member 13b (TNFSF13B), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunodeficiency-virus-1-envelope-glycoprotein-gp160-env-partial-active-bhp10516974</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6761GJP-SDS.jpg?v=1772294628</image:loc>
      <image:title>Recombinant Human immunodeficiency virus 1 Envelope glycoprotein gp160 (env), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-macrophage-colony-stimulating-factor-1-isoform-x1-csf1-partial-bhp10516968</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6738MOV-SDS.jpg?v=1772294624</image:loc>
      <image:title>Recombinant Macaca fascicularis macrophage colony-stimulating factor 1 isoform X1 (CSF1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-receptor-superfamily-member-16-ngfr-partial-bhp10516948</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6393MO1-SDS.jpg?v=1772294609</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor receptor superfamily member 16 (Ngfr), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516980</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP684467HU10-SDS.jpg?v=1772294620</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-erythropoietin-receptor-epor-partial-bhp10516927</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5769MOWd9-SDS.jpg?v=1772294605</image:loc>
      <image:title>Recombinant Macaca mulatta Erythropoietin receptor (EPOR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cricetulus-griseus-endoplasmic-reticulum-chaperone-bip-hspa5-active-bhp10516992</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6869DXU-SDS.jpg?v=1772294625</image:loc>
      <image:title>Recombinant Cricetulus griseus Endoplasmic reticulum chaperone BiP (HSPA5) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516984</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP684467HU4-SDS.jpg?v=1772294631</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-ig-like-domain-containing-protein-partial-bhp10516962</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6692MOV-SDS.jpg?v=1772294623</image:loc>
      <image:title>Recombinant Macaca fascicularis Ig-like domain-containing protein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516985</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP684467HU5-SDS.jpg?v=1772294625</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-surface-glycoprotein-cd8-alpha-and-beta-heterodimer-protein-cd8a-and-cd8b-bhp10516993</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6900HU-SDS.jpg?v=1772294701</image:loc>
      <image:title>Recombinant Human T-cell surface glycoprotein CD8 alpha&amp;beta Heterodimer Protein (CD8A&amp;CD8B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516987</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP684467HU7-SDS.jpg?v=1772294616</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hla-a-02-01-and-b2m-and-ny-eso-1-sllmwitqv-protein-biotinylated-bhp10516991</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6862HU_M1_-B-SDS.jpg?v=1772294695</image:loc>
      <image:title>Recombinant Human HLA-A*02:01&amp;B2M&amp;NY-ESO-1 (SLLMWITQV) protein, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-ig-like-domain-containing-protein-egm-15593-partial-bhp10516971</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6751MOV-SDS.jpg?v=1772294612</image:loc>
      <image:title>Recombinant Macaca fascicularis Ig-like domain-containing protein (EGM_15593), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-transforming-growth-factor-beta-tgfb1-c33s-active-bhp10516972</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6752MOW_A4_M_-SDS.jpg?v=1772294696</image:loc>
      <image:title>Recombinant Macaca mulatta Transforming growth factor beta (TGFB1) (C33S) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516989</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP684467HU9-SDS.jpg?v=1772294618</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516986</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP684467HU6-SDS.jpg?v=1772294624</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516983</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP684467HU3p2-SDS.jpg?v=1772294636</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516988</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP684467HU8-SDS.jpg?v=1772294616</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-tumor-necrosis-factor-receptor-superfamily-member-1a-tnfrsf1a-partial-active-bhp10516996</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7005MOV-SDS.jpg?v=1772294617</image:loc>
      <image:title>Recombinant Macaca fascicularis Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-interferon-gamma-receptor-1-ifngr1-partial-active-bhp10516995</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6981MOW-SDS.jpg?v=1772294635</image:loc>
      <image:title>Recombinant Macaca mulatta Interferon gamma receptor 1 (IFNGR1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-fibroblast-activation-protein-alpha-fap-partial-active-bhp10516976</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6769MOV-SDS.jpg?v=1772294613</image:loc>
      <image:title>Recombinant Macaca fascicularis Fibroblast activation protein alpha (FAP), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-il23a-and-il12b-heterodimer-protein-active-bhp10516994</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6901HU-SDS.jpg?v=1772294637</image:loc>
      <image:title>Recombinant Human IL23A&amp;IL12B Heterodimer Protein (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516982</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP684467HU3-SDS.jpg?v=1772294625</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-leukocyte-surface-antigen-cd47-cd47-partial-active-bhp10516978</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6802MOW-SDS.jpg?v=1772294622</image:loc>
      <image:title>Recombinant Macaca mulatta Leukocyte surface antigen CD47 (CD47), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-adam-metallopeptidase-domain-9-adam9-partial-active-bhp10517000</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7133MOVd7-SDS.jpg?v=1772294633</image:loc>
      <image:title>Recombinant Macaca fascicularis ADAM metallopeptidase domain 9 (ADAM9), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-nkg2a-and-cd94-nkg2a-and-cd94-partial-bhp10517008</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7147MOV-SDS.jpg?v=1772294622</image:loc>
      <image:title>Recombinant Macaca fascicularis nkg2A&amp;cd94 (nkg2A&amp;cd94), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-5-nucleotidase-nt5e-bhp10517015</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP723415MO-SDS.jpg?v=1772294628</image:loc>
      <image:title>Recombinant Mouse 5&apos;-nucleotidase (Nt5e)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-semaphorin-4b-sema4b-partial-bhp10517003</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP714012MO-SDS.jpg?v=1772294625</image:loc>
      <image:title>Recombinant Mouse Semaphorin-4B (Sema4b), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-il21-bhp10517005</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7141MOV-SDS.jpg?v=1772294621</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin (IL21)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-itgav-and-itgb3-heterodimer-protein-bhp10517006</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7144HU-SDS.jpg?v=1772294623</image:loc>
      <image:title>Recombinant Human ITGAV&amp;ITGB3 Heterodimer Protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-4-receptor-subunit-alpha-partial-bhp10517009</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7215MOV-SDS.jpg?v=1772294625</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin-4 receptor subunit alpha, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c-type-natriuretic-peptide-nppc-bhp10517002</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP713991MO-SDS.jpg?v=1772294623</image:loc>
      <image:title>Recombinant Mouse C-type natriuretic peptide (Nppc)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-semaphorin-4b-sema4b-partial-bhp10517004</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP714012MOd9-SDS.jpg?v=1772294632</image:loc>
      <image:title>Recombinant Mouse Semaphorin-4B (Sema4b), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mucin-16-muc16-partial-biotinylated-bhp10516998</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP704410HU3j7-B-SDS.jpg?v=1772294699</image:loc>
      <image:title>Recombinant Human Mucin-16 (MUC16), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-il23a-and-il12b-heterodimer-protein-active-bhp10516999</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7054MOV-SDS.jpg?v=1772294642</image:loc>
      <image:title>Recombinant Macaca fascicularis IL23A&amp;IL12B Heterodimer Protein (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-hypoxia-inducible-factor-1-alpha-hif1a-partial-bhp10517021</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP730731MO-SDS.jpg?v=1772294696</image:loc>
      <image:title>Recombinant Mouse Hypoxia-inducible factor 1-alpha (Hif1a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-coagulation-factor-ix-f9-active-bhp10517010</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7216MOV-SDS.jpg?v=1772294622</image:loc>
      <image:title>Recombinant Macaca fascicularis Coagulation factor IX (F9) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-lilrb2-lilrb2-partial-bhp10517013</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7226MOV-SDS.jpg?v=1772294629</image:loc>
      <image:title>Recombinant Macaca fascicularis LILRB2 (LILRB2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-platelet-derived-growth-factor-receptor-alpha-pdgfra-partial-active-bhp10517011</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7222MOV-SDS.jpg?v=1772294624</image:loc>
      <image:title>Recombinant Macaca fascicularis Platelet-derived growth factor receptor alpha (PDGFRA), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-delta-like-protein-dll4-partial-bhp10517020</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7292MOV-C-SDS.jpg?v=1772294625</image:loc>
      <image:title>Recombinant Macaca fascicularis Delta-like protein (DLL4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-pro-neuregulin-1-membrane-bound-isoform-nrg1-partial-bhp10516997</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7012MO-SDS.jpg?v=1772294632</image:loc>
      <image:title>Recombinant Mouse Pro-neuregulin-1, membrane-bound isoform (Nrg1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mesocricetus-auratus-programmed-cell-death-1-ligand-1-cd274-partial-biotinylated-bhp10517016</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7255MRG-B-SDS.jpg?v=1772294625</image:loc>
      <image:title>Recombinant Mesocricetus auratus Programmed cell death 1 ligand 1 (Cd274), partial, Biotinylated</image:title>
      <image:caption>CSB-MP009316HU is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mesocricetus-auratus-programmed-cell-death-1-ligand-1-isoform-x1-cd274-partial-biotinylated-bhp10517017</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7255MRG-B-C-SDS.jpg?v=1772294700</image:loc>
      <image:title>Recombinant Mesocricetus auratus Programmed Cell death 1 ligand 1 isoform X1 (Cd274), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-adam-metallopeptidase-domain-9-adam9-partial-biotinylated-active-bhp10517001</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7133MOVk7-B-SDS.jpg?v=1772294637</image:loc>
      <image:title>Recombinant Macaca fascicularis ADAM metallopeptidase domain 9 (ADAM9), partial, Biotinylated (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nad-and-hydrolase-sarm1-sarm1-partial-bhp10517033</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP750971HU1-SDS.jpg?v=1772294625</image:loc>
      <image:title>Recombinant Human NAD(+) hydrolase SARM1 (SARM1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-frog-virus-3-major-capsid-protein-fv3-090r-bhp10517018</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP727768FDG-SDS.jpg?v=1772294624</image:loc>
      <image:title>Recombinant Frog virus 3 Major capsid protein (FV3-090R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chicken-hepatocyte-growth-factor-hgf-partial-bhp10517036</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP758831CH-SDS.jpg?v=1772294704</image:loc>
      <image:title>Recombinant Chicken Hepatocyte growth factor (HGF), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-lysosomal-phospholipase-a-and-acyltransferase-pla2g15-bhp10517019</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP727770RA-SDS.jpg?v=1772294623</image:loc>
      <image:title>Recombinant Rat Lysosomal phospholipase A and acyltransferase (Pla2g15)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-lama-glama-interleukin-2-il2-bhp10517039</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP769693LBS-SDS.jpg?v=1772294626</image:loc>
      <image:title>Recombinant Lama glama Interleukin-2 (IL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-hypoxia-inducible-factor-1-alpha-hif1a-partial-bhp10517022</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP730731MOd7-SDS.jpg?v=1772294639</image:loc>
      <image:title>Recombinant Mouse Hypoxia-inducible factor 1-alpha (Hif1a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-lin-28-homolog-b-lin28b-bhp10517029</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP741049HU-SDS.jpg?v=1772294626</image:loc>
      <image:title>Recombinant Human Protein lin-28 homolog B (LIN28B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cardiotrophin-1-ctf1-bhp10517026</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP733705MO-SDS.jpg?v=1772294622</image:loc>
      <image:title>Recombinant Mouse Cardiotrophin-1 (Ctf1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-tissue-kallikrein-klk5-partial-bhp10517030</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7444DO-SDS.jpg?v=1772294623</image:loc>
      <image:title>Recombinant Dog tissue kallikrein (KLK5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-itgav-and-itgb3-heterodimer-protein-biotinylated-bhp10517007</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7144HU-B-SDS.jpg?v=1772294696</image:loc>
      <image:title>Recombinant Human ITGAV&amp;ITGB3 Heterodimer Protein, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-near-infrared-fluorescent-protein-mirfp670nano3-bhp10517012</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7223-SDS.jpg?v=1772294628</image:loc>
      <image:title>Recombinant near-infrared fluorescent protein (miRFP670nano3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-glypican-3-gpc3-partial-biotinylated-bhp10517042</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/Cusabio_Protein_Placeholder_82b00df8-1edf-4477-aad8-b8854c55f93d.jpg?v=1784925934</image:loc>
      <image:title>Recombinant Mouse Glypican-3 (Gpc3), partial, Biotinylated</image:title>
      <image:caption>Recombinant Mouse Glypican-3 (Gpc3), partial, Biotinylated – Figure 1 of 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-alanine-trna-ligase-cytoplasmic-aars1-bhp10517044</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP804328MO_A4_c7-SDS.jpg?v=1772294643</image:loc>
      <image:title>Recombinant Mouse Alanine--tRNA ligase, cytoplasmic (Aars1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-alanine-trna-ligase-cytoplasmic-aars1-bhp10517043</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP804328MO_A4_-SDS.jpg?v=1772294628</image:loc>
      <image:title>Recombinant Mouse Alanine--tRNA ligase, cytoplasmic (Aars1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-non-selective-voltage-gated-ion-channel-vdac2-vdac2-partial-bhp10517014</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP723359MO-SDS.jpg?v=1772294622</image:loc>
      <image:title>Recombinant Mouse Non-selective voltage-gated ion channel VDAC2 (Vdac2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-mib1-mib1-partial-bhp10517041</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP771476HU1-SDS.jpg?v=1772294627</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase MIB1 (MIB1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-inositol-1-4-5-trisphosphate-receptor-interacting-protein-like-1-itpripl1-partial-bhp10517035</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP756966HUd9-SDS.jpg?v=1772294623</image:loc>
      <image:title>Recombinant Human Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-rd3-rd3-bhp10517045</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP805945MO-SDS.jpg?v=1772294711</image:loc>
      <image:title>Recombinant Mouse Protein RD3 (Rd3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-delta-and-notch-like-epidermal-growth-factor-related-receptor-dner-partial-bhp10517048</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP818784HU-SDS.jpg?v=1772294628</image:loc>
      <image:title>Recombinant Human Delta and Notch-like epidermal growth factor-related receptor (DNER), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-kallikrein-related-peptidase-5-klk5-partial-bhp10517032</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7445MOVd9-SDS.jpg?v=1772294626</image:loc>
      <image:title>Recombinant Macaca fascicularis Kallikrein related peptidase 5 (KLK5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-transferrin-receptor-protein-1-tfrc-partial-bhp10517047</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP816838PI1-SDS.jpg?v=1772294627</image:loc>
      <image:title>Recombinant Pig Transferrin receptor protein 1 (TFRC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-thyrotropin-receptor-tshr-partial-bhp10517028</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7389HU-SDS.jpg?v=1772294628</image:loc>
      <image:title>Recombinant Human Thyrotropin receptor (TSHR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-roundabout-homolog-3-robo3-partial-bhp10517064</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP846671HU-SDS.jpg?v=1782433723</image:loc>
      <image:title>Recombinant Human Roundabout homolog 3 (ROBO3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-lama-glama-interleukin-2-il2-bhp10517040</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP769693LBSd9-SDS.jpg?v=1772294628</image:loc>
      <image:title>Recombinant Lama glama Interleukin-2 (IL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neutral-amino-acid-transporter-9-slc38a9-partial-bhp10517058</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP836713HU-SDS.jpg?v=1772294633</image:loc>
      <image:title>Recombinant Human Neutral amino acid transporter 9 (SLC38A9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-nepenthes-gracilis-aspartic-proteinase-nepenthesin-2-nep2-bhp10517038</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP765721NBAV_A4_-SDS.jpg?v=1772294630</image:loc>
      <image:title>Recombinant Nepenthes gracilis Aspartic proteinase nepenthesin-2 (nep2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cmrf35-like-molecule-1-cd300lf-e111a-d116a-w52a-w59a-partial-bhp10517051</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP819470HU1_M1_-SDS.jpg?v=1772294630</image:loc>
      <image:title>Recombinant Human CMRF35-like molecule 1 (CD300LF) (E111A,D116A,W52A,W59A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-solute-carrier-family-45-member-3-slc45a3-partial-bhp10517057</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP836239HU-SDS.jpg?v=1772294649</image:loc>
      <image:title>Recombinant Human Solute carrier family 45 member 3 (SLC45A3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-wnt-9a-wnt9a-bhp10517061</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP840305MO-SDS.jpg?v=1772294633</image:loc>
      <image:title>Recombinant Mouse Protein Wnt-9a (Wnt9a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-anti-muellerian-hormone-type-2-receptor-amhr2-partial-bhp10517046</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP814331MO-SDS.jpg?v=1772294628</image:loc>
      <image:title>Recombinant Mouse Anti-Muellerian hormone type-2 receptor (Amhr2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-17f-il17f-bhp10517062</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP842733HU-SDS.jpg?v=1772294653</image:loc>
      <image:title>Recombinant Human Interleukin-17F (IL17F)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-proepiregulin-ereg-partial-bhp10517024</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP730741MOr10-SDS.jpg?v=1772294625</image:loc>
      <image:title>Recombinant Mouse Proepiregulin (Ereg), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-ndnf-ndnf-bhp10517054</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP823447HU-SDS.jpg?v=1772294636</image:loc>
      <image:title>Recombinant Human Protein NDNF (NDNF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-roundabout-homolog-3-robo3-partial-bhp10517065</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP846671HUd9-SDS.jpg?v=1782433711</image:loc>
      <image:title>Recombinant Human Roundabout homolog 3 (ROBO3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-placenta-expressed-transcript-1-protein-plet1-bhp10517070</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP851843MO-SDS.jpg?v=1772294638</image:loc>
      <image:title>Recombinant Mouse Placenta-expressed transcript 1 protein (Plet1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-reston-ebolavirus-pre-small-secreted-glycoprotein-gp-partial-bhp10517071</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP852740RCI-SDS.jpg?v=1782433759</image:loc>
      <image:title>Recombinant Reston ebolavirus Pre-small/secreted glycoprotein (GP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-22-receptor-subunit-alpha-2-il22ra2-bhp10517068</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP850247HU1-SDS.jpg?v=1772294654</image:loc>
      <image:title>Recombinant Human Interleukin-22 receptor subunit alpha-2 (IL22RA2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nectin-2-nectin2-partial-bhp10517055</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP835690HUd7-SDS.jpg?v=1772294636</image:loc>
      <image:title>Recombinant Human Nectin-2 (NECTIN2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-t-cell-surface-glycoprotein-cd3-epsilon-chain-cd3e-partial-bhp10517053</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP822100MOV-SDS.jpg?v=1772294631</image:loc>
      <image:title>Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 epsilon chain (CD3E) , partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-repulsive-guidance-molecule-a-rgma-partial-active-bhp10517056</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP836186HU1-SDS.jpg?v=1772294633</image:loc>
      <image:title>Recombinant Human Repulsive guidance molecule A (RGMA), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-secretogranin-3-scg3-bhp10517063</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP845166HU-SDS.jpg?v=1772294633</image:loc>
      <image:title>Recombinant Human Secretogranin-3 (SCG3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c-type-lectin-domain-family-4-member-k-cd207-partial-bhp10517059</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP837695MOd9-SDS.jpg?v=1772294638</image:loc>
      <image:title>Recombinant Mouse C-type lectin domain family 4 member K (Cd207), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-proheparin-binding-egf-like-growth-factor-hbegf-partial-bhp10517075</loc>
    <lastmod>2026-08-19T19:32:43-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP857429MO-SDS.jpg?v=1772294635</image:loc>
      <image:title>Recombinant Mouse Proheparin-binding EGF-like growth factor (Hbegf), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
</urlset>
