<?xml version="1.0" encoding="UTF-8"?>
<urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9" xmlns:image="http://www.google.com/schemas/sitemap-image/1.1">
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-very-long-chain-3r-3-hydroxyacyl-coa-dehydratase-3-hacd3-partial-bhp10513722</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP878945HU1-SDS.jpg?v=1772271468</image:loc>
      <image:title>Recombinant Human Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 (HACD3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-sheep-fibroblast-growth-factor-2-fgf2-bhp10513757</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008625SHc7-SDS.jpg?v=1772271474</image:loc>
      <image:title>Recombinant Sheep Fibroblast growth factor 2 (FGF2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-norvegicus-inhibin-beta-c-chain-inhbc-partial-bhp10513752</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011721RA-SDS.jpg?v=1772271474</image:loc>
      <image:title>Recombinant Rat norvegicus Inhibin beta C chain (Inhbc), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-stanniocalcin-2-stc2-bhp10513730</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP886420RA-SDS.jpg?v=1772271468</image:loc>
      <image:title>Recombinant Rat Stanniocalcin-2 (Stc2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-saccharomyces-cerevisiae-general-control-protein-gcn4-gcn4-bhp10513766</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP365837SVGa0-SDS.jpg?v=1772271489</image:loc>
      <image:title>Recombinant Saccharomyces cerevisiae General control protein GCN4 (GCN4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-anguilla-japonica-ventricular-natriuretic-peptide-vnp-bhp10513754</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP329334BZH-SDS.jpg?v=1772271488</image:loc>
      <image:title>Recombinant Anguilla japonica Ventricular natriuretic peptide (vnp)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lymphocyte-antigen-6-complex-locus-protein-g6f-ly6g6f-partial-bhp10513719</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP732899HU-SDS.jpg?v=1772271468</image:loc>
      <image:title>Recombinant Human Lymphocyte antigen 6 complex locus protein G6f (LY6G6F), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-newcastle-disease-virus-rna-directed-rna-polymerase-l-l-partial-bhp10513739</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887622NCT-SDS.jpg?v=1772271470</image:loc>
      <image:title>Recombinant Newcastle disease virus RNA-directed RNA polymerase L (L), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dehydrogenase-reductase-sdr-family-member-4-like-2-dhrs4l2-bhp10513742</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP747499HU-SDS.jpg?v=1772271471</image:loc>
      <image:title>Recombinant Human Dehydrogenase/reductase SDR family member 4-like 2 (DHRS4L2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-dna-gyrase-subunit-b-gyrb-partial-bhp10513773</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360158ENV-SDS.jpg?v=1772271478</image:loc>
      <image:title>Recombinant Escherichia coli DNA gyrase subunit B (gyrB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chicken-insulin-like-growth-factor-i-igf1-bhp10513764</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011086CH-SDS.jpg?v=1772271488</image:loc>
      <image:title>Recombinant Chicken Insulin-like growth factor I (IGF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tripartite-motif-containing-protein-51-trim51-bhp10513747</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP871567HU-SDS.jpg?v=1772271471</image:loc>
      <image:title>Recombinant Human Tripartite motif-containing protein 51 (TRIM51)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sap30-binding-protein-sap30bp-partial-bhp10513763</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP883403HU1a0-SDS.jpg?v=1772271547</image:loc>
      <image:title>Recombinant Human SAP30-binding protein (SAP30BP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-porcine-reproductive-and-respiratory-syndrome-virus-gp5-partial-bhp10513759</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5752GMWa2-SDS.jpg?v=1772271488</image:loc>
      <image:title>Recombinant Porcine reproductive and respiratory syndrome virus GP5, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-prolactin-prl-bhp10513760</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018724MO-SDS.jpg?v=1772271477</image:loc>
      <image:title>Recombinant Mouse Prolactin (Prl)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bifunctional-arginine-demethylase-and-lysyl-hydroxylase-jmjd6-jmjd6-bhp10513737</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP750768HU-SDS.jpg?v=1772271469</image:loc>
      <image:title>Recombinant Human Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 (JMJD6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-stathmin-2-stmn2-bhp10513769</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP853100HU-SDS.jpg?v=1772271473</image:loc>
      <image:title>Recombinant Human Stathmin-2 (STMN2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chicken-fibroblast-growth-factor-1-fgf1-bhp10513765</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008615CHe1-SDS.jpg?v=1772271491</image:loc>
      <image:title>Recombinant Chicken Fibroblast growth factor 1 (FGF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-bovis-esat-6-like-protein-esxb-esxb-bhp10513767</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP358628MVH-SDS.jpg?v=1772271489</image:loc>
      <image:title>Recombinant Mycobacterium bovis ESAT-6-like protein esxB (esxB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-bovis-diacylglycerol-acyltransferase-mycolyltransferase-ag85b-fbpb-bhp10513774</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP374472MOJb1-SDS.jpg?v=1772271480</image:loc>
      <image:title>Recombinant Mycobacterium bovis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-tenascin-tnc-partial-bhp10513775</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP642747PI-SDS.jpg?v=1772271480</image:loc>
      <image:title>Recombinant Pig Tenascin (TNC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-interleukin-8-cxcl8-bhp10513772</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011671BO-SDS.jpg?v=1772271478</image:loc>
      <image:title>Recombinant Bovine Interleukin-8 (CXCL8)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-variant-africanum-pe-family-protein-pe13-bhp10513753</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5916GXIa2-SDS.jpg?v=1772271473</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis variant africanum PE family protein PE13</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-heme-binding-protein-1-hebp1-bhp10513758</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP868305HUe0-SDS.jpg?v=1772271473</image:loc>
      <image:title>Recombinant Human Heme-binding protein 1 (HEBP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-iws1-homolog-iws1-partial-bhp10513734</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP822304HU-SDS.jpg?v=1772271471</image:loc>
      <image:title>Recombinant Human Protein IWS1 homolog (IWS1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-propionyl-coa-carboxylase-alpha-chain-mitochondrial-pcca-bhp10513768</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017522HU-SDS.jpg?v=1772271474</image:loc>
      <image:title>Recombinant Human Propionyl-CoA carboxylase alpha chain, mitochondrial (PCCA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-superoxide-dismutase-mn-soda-bhp10513762</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022398ENV-SDS.jpg?v=1772271472</image:loc>
      <image:title>Recombinant Escherichia coli Superoxide dismutase [Mn] (sodA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tobacco-mosaic-virus-capsid-protein-cp-bhp10513770</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP304020TFF-SDS.jpg?v=1772271476</image:loc>
      <image:title>Recombinant Tobacco mosaic virus Capsid protein (CP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cathepsin-g-ctsg-bhp10513777</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006190HU-SDS.jpg?v=1772271480</image:loc>
      <image:title>Recombinant Human Cathepsin G (CTSG)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neurogenic-differentiation-factor-1-neurod1-m114a-bhp10513776</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720182MO_M1_-SDS.jpg?v=1772271491</image:loc>
      <image:title>Recombinant Mouse Neurogenic differentiation factor 1 (Neurod1) (M114A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-propionyl-coa-carboxylase-beta-chain-mitochondrial-pccb-bhp10513771</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017523HU-SDS.jpg?v=1772271477</image:loc>
      <image:title>Recombinant Human Propionyl-CoA carboxylase beta chain, mitochondrial (PCCB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-newcastle-disease-virus-fusion-glycoprotein-f0-f-partial-bhp10513779</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP330269NCU-SDS.jpg?v=1772271554</image:loc>
      <image:title>Recombinant Newcastle disease virus Fusion glycoprotein F0 (F), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-fibroblast-growth-factor-2-fgf2-active-bhp10513782</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008625BOe1-SDS.jpg?v=1772271485</image:loc>
      <image:title>Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-renin-ren-bhp10513778</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP715703MOV-SDS.jpg?v=1772271476</image:loc>
      <image:title>Recombinant Macaca fascicularis Renin (REN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-verticillium-dahliae-pigment-biosynthesis-protein-ayg1-bhp10513748</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6008GYB-SDS.jpg?v=1772271474</image:loc>
      <image:title>Recombinant Verticillium dahliae Pigment biosynthesis protein Ayg1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-alpha-hemoglobin-stabilizing-protein-ahsp-bhp10513784</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP875156MO-SDS.jpg?v=1772271474</image:loc>
      <image:title>Recombinant Mouse Alpha-hemoglobin-stabilizing protein (Ahsp)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-3-ltbr-partial-bhp10513786</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013227HUa0-SDS.jpg?v=1772271479</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-b-cell-antigen-receptor-complex-associated-protein-alpha-chain-cd79a-partial-active-bhp10513788</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004957HU1-SDS.jpg?v=1772271478</image:loc>
      <image:title>Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-atrial-natriuretic-peptide-receptor-1-npr1-partial-bhp10513790</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP016023MO-SDS.jpg?v=1772271477</image:loc>
      <image:title>Recombinant Mouse Atrial natriuretic peptide receptor 1 (Npr1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-kidney-associated-antigen-1-bhp10513755</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5807MOV-SDS.jpg?v=1772271473</image:loc>
      <image:title>Recombinant Macaca fascicularis Kidney associated antigen 1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pro-epidermal-growth-factor-egf-partial-bhp10513785</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007473HUe1-SDS.jpg?v=1772271483</image:loc>
      <image:title>Recombinant Human Pro-epidermal growth factor (EGF), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cadherin-5-cdh5-partial-bhp10513795</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005054HU1-SDS.jpg?v=1772271481</image:loc>
      <image:title>Recombinant Human Cadherin-5 (CDH5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-liver-carboxylesterase-1-ces1-active-bhp10513800</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005258HU-SDS.jpg?v=1772271478</image:loc>
      <image:title>Recombinant Human Liver carboxylesterase 1 (CES1) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-g-antigen-7-gage7-bhp10513725</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009188HUe0-SDS.jpg?v=1772271468</image:loc>
      <image:title>Recombinant Human G antigen 7 (GAGE7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-atrial-natriuretic-peptide-receptor-1-npr1-partial-bhp10513791</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP016023MOV-SDS.jpg?v=1772271478</image:loc>
      <image:title>Recombinant Macaca fascicularis Atrial natriuretic peptide receptor 1 (NPR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-activin-receptor-type-2a-acvr2a-partial-active-bhp10513797</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001260MO1-SDS.jpg?v=1772271482</image:loc>
      <image:title>Recombinant Mouse Activin receptor type-2A (Acvr2a), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cadherin-20-cdh20-partial-bhp10513794</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP864022HU-SDS.jpg?v=1772271477</image:loc>
      <image:title>Recombinant Human Cadherin-20 (CDH20), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-probable-global-transcription-activator-snf2l2-smarca2-partial-bhp10513750</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021799HU1-SDS.jpg?v=1772271492</image:loc>
      <image:title>Recombinant Human Probable global transcription activator SNF2L2 (SMARCA2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cdna-flj11751-fis-clone-hemba1005576-moderately-similar-to-mus-musculus-plexin-2-h11y-s17f-bhp10513783</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5988HU_M_-SDS.jpg?v=1772271479</image:loc>
      <image:title>Recombinant Human cDNA FLJ11751 fis, clone HEMBA1005576, moderately similar to Mus musculus plexin 2 (H11Y,S17F)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-activin-receptor-type-2b-acvr2b-partial-active-bhp10513799</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001261MO1-SDS.jpg?v=1772271480</image:loc>
      <image:title>Recombinant Mouse Activin receptor type-2B (Acvr2b), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cynomolgus-monkey-activin-receptor-type-2a-acvr2a-partial-active-bhp10513796</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001260HU1-SDS.jpg?v=1772271477</image:loc>
      <image:title>Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atrial-natriuretic-peptide-receptor-3-npr3-partial-bhp10513793</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP016025HU1-SDS.jpg?v=1772271476</image:loc>
      <image:title>Recombinant Human Atrial natriuretic peptide receptor 3 (NPR3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-n-terminal-xaa-pro-lys-n-methyltransferase-2-ntmt2-bhp10513811</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP722791HU-SDS.jpg?v=1772271479</image:loc>
      <image:title>Recombinant Human N-terminal Xaa-Pro-Lys N-methyltransferase 2 (NTMT2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cysteine-rich-hydrophobic-domain-2-protein-chic2-bhp10513781</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP892453HUc7-SDS.jpg?v=1772271478</image:loc>
      <image:title>Recombinant Human Cysteine-rich hydrophobic domain 2 protein (CHIC2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-thyroglobulin-tg-partial-bhp10513804</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023442HU-SDS.jpg?v=1772271477</image:loc>
      <image:title>Recombinant Human Thyroglobulin (TG), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c-c-chemokine-receptor-type-5-ccr5-partial-bhp10513803</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004844MO-SDS.jpg?v=1772271488</image:loc>
      <image:title>Recombinant Mouse C-C chemokine receptor type 5 (Ccr5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-dependent-phosphate-transport-protein-2b-slc34a2-partial-bhp10513787</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021581HU1-SDS.jpg?v=1772271481</image:loc>
      <image:title>Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-pyruvate-dehydrogenase-e1-component-subunit-alpha-somatic-form-mitochondrial-pdha1-bhp10513802</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017715MO-SDS.jpg?v=1772271481</image:loc>
      <image:title>Recombinant Mouse Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (Pdha1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-t4-nad-protein-adp-ribosyltransferase-moda-moda-bhp10513806</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP331019EDZ-SDS.jpg?v=1772271479</image:loc>
      <image:title>Recombinant Enterobacteria phage T4 NAD--protein ADP-ribosyltransferase modA (modA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atrial-natriuretic-peptide-receptor-1-npr1-partial-bhp10513789</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP016023HU-SDS.jpg?v=1772271477</image:loc>
      <image:title>Recombinant Human Atrial natriuretic peptide receptor 1 (NPR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atrial-natriuretic-peptide-receptor-2-npr2-partial-bhp10513792</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP016024HU-SDS.jpg?v=1772271491</image:loc>
      <image:title>Recombinant Human Atrial natriuretic peptide receptor 2 (NPR2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-putative-uncharacterized-protein-c11orf40-c11orf40-bhp10513780</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP820187HU-SDS.jpg?v=1772271477</image:loc>
      <image:title>Recombinant Human Putative uncharacterized protein C11orf40 (C11orf40)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cyclin-y-like-protein-1-ccnyl1-bhp10513809</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP818724HU-SDS.jpg?v=1772271479</image:loc>
      <image:title>Recombinant Human Cyclin-Y-like protein 1 (CCNYL1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rabies-virus-glycoprotein-g-partial-biotinylated-bhp10513805</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP325676RAF-B-SDS.jpg?v=1772271480</image:loc>
      <image:title>Recombinant Rabies virus Glycoprotein (G), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-f-box-lrr-repeat-protein-2-fbxl2-bhp10513810</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP892134HUc7-SDS.jpg?v=1772271480</image:loc>
      <image:title>Recombinant Human F-box/LRR-repeat protein 2 (FBXL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atpase-family-aaa-domain-containing-protein-3c-atad3c-bhp10513808</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP716349HU-SDS.jpg?v=1772271480</image:loc>
      <image:title>Recombinant Human ATPase family AAA domain-containing protein 3C (ATAD3C)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alpha-tocopherol-transfer-protein-ttpa-bhp10513807</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025268HUc7-SDS.jpg?v=1772271480</image:loc>
      <image:title>Recombinant Human Alpha-tocopherol transfer protein (TTPA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-complement-component-receptor-1-like-protein-cr1l-partial-bhp10513828</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP726884RA-SDS.jpg?v=1772271481</image:loc>
      <image:title>Recombinant Rat Complement component receptor 1-like protein (Cr1l), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nacht-lrr-and-pyd-domains-containing-protein-3-nlrp3-partial-bhp10513815</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP822275HU7-SDS.jpg?v=1772271478</image:loc>
      <image:title>Recombinant Human NACHT, LRR and PYD domains-containing protein 3 (NLRP3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-spirometra-erinaceieuropaei-cysteine-proteinase-bhp10513816</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5965GXS-SDS.jpg?v=1772271488</image:loc>
      <image:title>Recombinant Spirometra erinaceieuropaei Cysteine proteinase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-putative-exonuclease-gor-rexo1l1p-bhp10513813</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP814220HU-SDS.jpg?v=1772271480</image:loc>
      <image:title>Recombinant Human Putative exonuclease GOR (REXO1L1P)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-forkhead-box-protein-d3-foxd3-bhp10513830</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP737178RA-SDS.jpg?v=1772271483</image:loc>
      <image:title>Recombinant Rat Forkhead box protein D3 (Foxd3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cocaine-esterase-ces2-active-bhp10513801</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005259HU-SDS.jpg?v=1772271482</image:loc>
      <image:title>Recombinant Human Cocaine esterase (CES2) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-n-acetylmuramoyl-l-alanine-amidase-amid-amid-bhp10513820</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP302787ENV-SDS.jpg?v=1772271481</image:loc>
      <image:title>Recombinant Escherichia coli N-acetylmuramoyl-L-alanine amidase AmiD (amiD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bombyx-mori-nuclear-polyhedrosis-virus-polyhedrin-ph-bhp10513812</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP355989BTU-SDS.jpg?v=1772271479</image:loc>
      <image:title>Recombinant Bombyx mori nuclear polyhedrosis virus Polyhedrin (PH)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tnf-receptor-associated-factor-3-traf3-bhp10513834</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP024148HUb0-SDS.jpg?v=1772271494</image:loc>
      <image:title>Recombinant Human TNF receptor-associated factor 3 (TRAF3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cynomolgus-monkey-activin-receptor-type-2b-acvr2b-partial-active-bhp10513798</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP623829HU-SDS.jpg?v=1772271482</image:loc>
      <image:title>Recombinant Human/Cynomolgus monkey Activin receptor type-2B (ACVR2B), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bromodomain-adjacent-to-zinc-finger-domain-protein-2b-baz2b-partial-bhp10513823</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP883427HU-SDS.jpg?v=1772271481</image:loc>
      <image:title>Recombinant Human Bromodomain adjacent to zinc finger domain protein 2B (BAZ2B), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chicken-amp-deaminase-1-ampd1-bhp10513814</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001680CH-SDS.jpg?v=1772271489</image:loc>
      <image:title>Recombinant Chicken AMP deaminase 1 (AMPD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-signal-recognition-particle-subunit-srp54-srp54-bhp10513843</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022675HUb1-SDS.jpg?v=1772271498</image:loc>
      <image:title>Recombinant Human Signal recognition particle subunit SRP54 (SRP54)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rice-tungro-bacilliform-virus-polyprotein-partial-bhp10513817</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5789GWU-SDS.jpg?v=1772271480</image:loc>
      <image:title>Recombinant Rice tungro bacilliform virus Polyprotein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-klebsiella-pneumoniae-subsp-pneumoniae-penicillin-binding-protein-1b-partial-bhp10513829</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6059GNA-SDS.jpg?v=1772271483</image:loc>
      <image:title>Recombinant Klebsiella pneumoniae subsp. pneumoniae Penicillin-binding protein 1B, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-measles-virus-nucleoprotein-n-partial-bhp10513839</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361386MCQ-SDS.jpg?v=1772271487</image:loc>
      <image:title>Recombinant Measles virus Nucleoprotein (N), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-tripartite-motif-containing-protein-72-trim72-bhp10513837</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5855PI-SDS.jpg?v=1772271485</image:loc>
      <image:title>Recombinant pig Tripartite motif-containing protein 72(TRIM72)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alpha-synuclein-snca-bhp10513821</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021912HU-SDS.jpg?v=1772271481</image:loc>
      <image:title>Recombinant Human Alpha-synuclein (SNCA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-phleum-pratense-profilin-1-pro1-bhp10513845</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017824EUQ-SDS.jpg?v=1772271485</image:loc>
      <image:title>Recombinant Phleum pratense Profilin-1 (PRO1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-intermembrane-phospholipid-transport-system-binding-protein-mlac-mlac-bhp10513819</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP365042ENV-SDS.jpg?v=1772271480</image:loc>
      <image:title>Recombinant Escherichia coli Intermembrane phospholipid transport system binding protein MlaC (mlaC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-measles-virus-nucleoprotein-n-partial-bhp10513844</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361386MCQa0-SDS.jpg?v=1772271484</image:loc>
      <image:title>Recombinant Measles virus Nucleoprotein (N), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-newcastle-disease-virus-fusion-glycoprotein-f0-f-partial-bhp10513838</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP333810NCW-SDS.jpg?v=1772271556</image:loc>
      <image:title>Recombinant Newcastle disease virus Fusion glycoprotein F0 (F), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-dna-gyrase-subunit-b-gyrb-partial-bhp10513833</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360158ENVb0-SDS.jpg?v=1772271482</image:loc>
      <image:title>Recombinant Escherichia coli DNA gyrase subunit B(gyrB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-triticum-aestivum-aluminum-activated-malate-transporter-1-almt1-partial-bhp10513818</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP751861TQN1-SDS.jpg?v=1772271481</image:loc>
      <image:title>Recombinant Triticum aestivum Aluminum-activated malate transporter 1 (ALMT1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-alpha-actinin-4-actn4-partial-bhp10513824</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001244BO-SDS.jpg?v=1772271482</image:loc>
      <image:title>Recombinant Bovine Alpha-actinin-4 (ACTN4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-focadhesin-focad-partial-bhp10513826</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP719626HU-SDS.jpg?v=1772271481</image:loc>
      <image:title>Recombinant Human Focadhesin (FOCAD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-fam171a2-fam171a2-partial-bhp10513835</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008131HU2a0-SDS.jpg?v=1772271484</image:loc>
      <image:title>Recombinant Human Protein FAM171A2(FAM171A2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pro-neuregulin-1-membrane-bound-isoform-nrg1-partial-bhp10513840</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP016077HU3_F6_-SDS.jpg?v=1772271481</image:loc>
      <image:title>Recombinant Human Pro-neuregulin-1, membrane-bound isoform (NRG1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-glutamate-cysteine-ligase-catalytic-subunit-gclc-bhp10513825</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009321MO-SDS.jpg?v=1772271480</image:loc>
      <image:title>Recombinant Mouse Glutamate--cysteine ligase catalytic subunit (Gclc)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-dna-gyrase-subunit-b-gyrb-partial-bhp10513832</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360158ENVc7-SDS.jpg?v=1772271482</image:loc>
      <image:title>Recombinant Escherichia coli DNA gyrase subunit B(gyrB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-adp-ribosylation-factor-like-protein-4d-arl4d-bhp10513847</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002087HU-SDS.jpg?v=1772271484</image:loc>
      <image:title>Recombinant Human ADP-ribosylation factor-like protein 4D (ARL4D)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neurogenic-differentiation-factor-1-neurod1-bhp10513849</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720182MO-SDS.jpg?v=1772271500</image:loc>
      <image:title>Recombinant Mouse Neurogenic differentiation factor 1 (Neurod1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-abrus-precatorius-abrin-c-partial-bhp10513862</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP340994AACe1-SDS.jpg?v=1772271501</image:loc>
      <image:title>Recombinant Abrus precatorius Abrin-c, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-signal-recognition-particle-subunit-srp54-srp54-bhp10513842</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022675HUc7-SDS.jpg?v=1772271489</image:loc>
      <image:title>Recombinant Human Signal recognition particle subunit SRP54 (SRP54)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-spirometra-erinaceieuropaei-cysteine-proteinase-bhp10513857</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5965GXSa0-SDS.jpg?v=1772271501</image:loc>
      <image:title>Recombinant Spirometra erinaceieuropaei Cysteine proteinase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-phosphoprotein-associated-with-glycosphingolipid-enriched-microdomains-1-pag1-partial-bhp10513822</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP885746HU-SDS.jpg?v=1772271479</image:loc>
      <image:title>Recombinant Human Phosphoprotein associated with glycosphingolipid-enriched microdomains 1(PAG1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-abrus-precatorius-abrin-d-partial-bhp10513863</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP313258AACe1-SDS.jpg?v=1772271496</image:loc>
      <image:title>Recombinant Abrus precatorius Abrin-d, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-threonine-protein-phosphatase-2a-catalytic-subunit-alpha-isoform-ppp2ca-bhp10513831</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018559HUa0-SDS.jpg?v=1772271482</image:loc>
      <image:title>Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform (PPP2CA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-eucalyptus-gunnii-caffeic-acid-3-o-methyltransferase-omt-bhp10513827</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP343979EOZ-SDS.jpg?v=1772271485</image:loc>
      <image:title>Recombinant Eucalyptus gunnii Caffeic acid 3-O-methyltransferase (OMT)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-z-dna-binding-protein-1-zbp1-bhp10513859</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861990HUf0-SDS.jpg?v=1772271483</image:loc>
      <image:title>Recombinant Human Z-DNA-binding protein 1 (ZBP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sentrin-specific-protease-1-senp1-bhp10513841</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP885787HU-SDS.jpg?v=1772271487</image:loc>
      <image:title>Recombinant Human Sentrin-specific protease 1 (SENP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-f-box-only-protein-22-fbxo22-bhp10513853</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP854115HUb0-SDS.jpg?v=1772271492</image:loc>
      <image:title>Recombinant Human F-box only protein 22 (FBXO22)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transcriptional-enhancer-factor-tef-3-tead4-partial-bhp10513866</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP737076MO2c7-SDS.jpg?v=1772271485</image:loc>
      <image:title>Recombinant Mouse Transcriptional enhancer factor TEF-3 (Tead4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-uncharacterized-protein-c1orf54-c1orf54-bhp10513855</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP840992HUc7-SDS.jpg?v=1772271484</image:loc>
      <image:title>Recombinant Human Uncharacterized protein C1orf54 (C1orf54)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-tripartite-motif-containing-protein-72-trim72-bhp10513856</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5856DO-SDS.jpg?v=1772271486</image:loc>
      <image:title>Recombinant Dog Tripartite motif-containing protein 72 (TRIM72)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-measles-virus-nucleoprotein-n-partial-bhp10513836</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361386MCQd7-SDS.jpg?v=1772271500</image:loc>
      <image:title>Recombinant Measles virus Nucleoprotein(N), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-transforming-growth-factor-beta-1-proprotein-tgfb1-partial-bhp10513871</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023446BOd7-SDS.jpg?v=1772271491</image:loc>
      <image:title>Recombinant Bovine Transforming growth factor beta-1 proprotein (TGFB1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-tyrosine-protein-kinase-hopscotch-hop-partial-bhp10513864</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP631547DLU-SDS.jpg?v=1772271495</image:loc>
      <image:title>Recombinant Drosophila melanogaster Tyrosine-protein kinase hopscotch (hop), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-n-acetylmuramoyl-l-alanine-amidase-amid-amid-bhp10513850</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP302787ENVb1-SDS.jpg?v=1772271489</image:loc>
      <image:title>Recombinant Escherichia coli N-acetylmuramoyl-L-alanine amidase AmiD (amiD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-2-3-bisphosphoglycerate-dependent-phosphoglycerate-mutase-gpma-bhp10513852</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP351195ENV-SDS.jpg?v=1772271498</image:loc>
      <image:title>Recombinant Escherichia coli 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-trim11-trim11-bhp10513858</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856931HU_A4_-SDS.jpg?v=1772271488</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase TRIM11 (TRIM11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-ustilaginoidea-virens-phosphoacetylglucosamine-mutase-bhp10513854</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6009GVZ-SDS.jpg?v=1772271492</image:loc>
      <image:title>Recombinant Ustilaginoidea virens Phosphoacetylglucosamine mutase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-zymogen-granule-membrane-protein-16-zg16-bhp10513846</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP807545RA-SDS.jpg?v=1772271489</image:loc>
      <image:title>Recombinant Rat Zymogen granule membrane protein 16 (Zg16)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-suppressor-of-cytokine-signaling-6-socs6-bhp10513860</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022395HU-SDS.jpg?v=1772271493</image:loc>
      <image:title>Recombinant Human Suppressor of cytokine signaling 6 (SOCS6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-abrus-precatorius-abrin-a-partial-bhp10513874</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP319970AACe1-SDS.jpg?v=1772271486</image:loc>
      <image:title>Recombinant Abrus precatorius Abrin-a, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-klebsiella-pneumoniae-microcin-e492-mcea-bhp10513875</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP912107KBG-SDS.jpg?v=1772271495</image:loc>
      <image:title>Recombinant Klebsiella pneumoniae Microcin E492 (mceA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-measles-virus-fusion-glycoprotein-f0-f-partial-bhp10513851</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP303138MCS-SDS.jpg?v=1772271485</image:loc>
      <image:title>Recombinant Measles virus Fusion glycoprotein F0 (F), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-tripartite-motif-containing-protein-72-trim72-bhp10513867</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP024511RA-SDS.jpg?v=1772271489</image:loc>
      <image:title>Recombinant Rat Tripartite motif-containing protein 72 (Trim72)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-granzyme-k-gzmk-bhp10513870</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010084HU1-SDS.jpg?v=1772271487</image:loc>
      <image:title>Recombinant Human Granzyme K (GZMK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-ricinus-communis-ricin-partial-bhp10513868</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP365798RMMe1-SDS.jpg?v=1772271501</image:loc>
      <image:title>Recombinant Ricinus communis Ricin, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-dependent-phosphate-transport-protein-2b-slc34a2-partial-bhp10513869</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021581HU2-SDS.jpg?v=1772271502</image:loc>
      <image:title>Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-co-chaperonin-groes-groes-bhp10513876</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP832069FSG-SDS.jpg?v=1772271485</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-motif-chemokine-5-ccl5-bhp10513861</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004800HUc7-SDS.jpg?v=1772271491</image:loc>
      <image:title>Recombinant Human C-C motif chemokine 5 (CCL5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-intermembrane-phospholipid-transport-system-binding-protein-mlac-mlac-bhp10513848</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP365042ENVb0-SDS.jpg?v=1772271482</image:loc>
      <image:title>Recombinant Escherichia coli Intermembrane phospholipid transport system binding protein MlaC (mlaC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-nucleolar-rna-helicase-2-ddx21-bhp10513865</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP881308MO_A4_-SDS.jpg?v=1772271486</image:loc>
      <image:title>Recombinant Mouse Nucleolar RNA helicase 2 (Ddx21)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-e6-e6-bhp10513877</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP4950GUH-SDS.jpg?v=1772271488</image:loc>
      <image:title>Recombinant Mouse Protein E6 (E6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-nucleolar-rna-helicase-2-ddx21-bhp10513880</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP881308MO_A4_c7-SDS.jpg?v=1772271493</image:loc>
      <image:title>Recombinant Mouse Nucleolar RNA helicase 2 (Ddx21)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-complex-protein-1-subunit-beta-cct2-bhp10513873</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004856HUa0-SDS.jpg?v=1772271490</image:loc>
      <image:title>Recombinant Human T-complex protein 1 subunit beta (CCT2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-danio-rerio-protein-dvr-1-dvr1-bhp10513878</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP330463DIL-SDS.jpg?v=1772271496</image:loc>
      <image:title>Recombinant Danio rerio Protein DVR-1 (dvr1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-enhancer-factor-tef-3-tead4-partial-bhp10513872</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP618010HU1-SDS.jpg?v=1772271496</image:loc>
      <image:title>Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-aspartate-carbamoyltransferase-catalytic-subunit-pyrb-bhp10513879</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP485810ENM-SDS.jpg?v=1772271493</image:loc>
      <image:title>Recombinant Escherichia coli Aspartate carbamoyltransferase catalytic subunit (pyrB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bifunctional-udp-n-acetylglucosamine-2-epimerase-n-acetylmannosamine-kinase-gne-bhp10514044</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP897458HU-SDS.jpg?v=1772280019</image:loc>
      <image:title>Recombinant Human Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase (GNE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-alpha-alpha-phosphotrehalase-bhp10514056</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6100ENR-SDS.jpg?v=1772280007</image:loc>
      <image:title>Recombinant Escherichia coli Alpha,alpha-phosphotrehalase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-grpe-protein-homolog-1-mitochondrial-grpel1-bhp10514052</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP875707HU_A4_-SDS.jpg?v=1772280072</image:loc>
      <image:title>Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-acyloxyacyl-hydrolase-aoah-bhp10514062</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001853HUa2-SDS.jpg?v=1772280022</image:loc>
      <image:title>Recombinant Human Acyloxyacyl hydrolase (AOAH)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-z-dna-binding-protein-1-zbp1-biotinylated-bhp10514033</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861990HU-B-SDS.jpg?v=1772280005</image:loc>
      <image:title>Recombinant Human Z-DNA-binding protein 1 (ZBP1), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-shigella-sonnei-flagellar-l-ring-protein-flgh-bhp10514032</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP669071SGI-SDS.jpg?v=1772279999</image:loc>
      <image:title>Recombinant Shigella sonnei Flagellar L-ring protein (flgH)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-latent-transforming-growth-factor-beta-binding-protein-4-ltbp4-partial-bhp10514051</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6158RA-SDS.jpg?v=1772280019</image:loc>
      <image:title>Recombinant Rat Latent transforming growth factor beta binding protein 4 (Ltbp4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacillus-subtilis-rna-binding-protein-ybxf-ruls-bhp10514053</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP343190BRJ-SDS.jpg?v=1772280005</image:loc>
      <image:title>Recombinant Bacillus subtilis RNA-binding protein YbxF (rulS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-voltage-dependent-calcium-channel-gamma-1-subunit-cacng1-partial-bhp10514058</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004415HU1-SDS.jpg?v=1772280007</image:loc>
      <image:title>Recombinant Human Voltage-dependent calcium channel gamma-1 subunit (CACNG1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rabbit-prolactin-inducible-protein-homolog-pip-bhp10514045</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018020RB-SDS.jpg?v=1772280018</image:loc>
      <image:title>Recombinant Rabbit Prolactin-inducible protein homolog (PIP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-synaptotagmin-like-protein-1-sytl1-partial-bhp10514043</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP858776MO1-SDS.jpg?v=1772280008</image:loc>
      <image:title>Recombinant Mouse Synaptotagmin-like protein 1 (Sytl1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-periplasmic-trehalase-trea-bhp10514054</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP319553ENV-SDS.jpg?v=1772280003</image:loc>
      <image:title>Recombinant Escherichia coli Periplasmic trehalase (treA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-receptor-type-tyrosine-protein-phosphatase-like-n-ptprn-partial-bhp10514034</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP730645MO-SDS.jpg?v=1772280004</image:loc>
      <image:title>Recombinant Mouse Receptor-type tyrosine-protein phosphatase-like N (Ptprn), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-aconitate-hydratase-bhp10514055</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6086ENR_A4_-SDS.jpg?v=1772279997</image:loc>
      <image:title>Recombinant Escherichia coli Aconitate hydratase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-muellerian-inhibiting-factor-amh-partial-bhp10513901</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF001666MO-SDS.jpg?v=1772280005</image:loc>
      <image:title>Recombinant Mouse Muellerian-inhibiting factor (Amh), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-vaccinia-virus-protein-opg154-opg154-biotinylated-bhp10514046</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP318120VAI-B-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Vaccinia virus Protein OPG154 (OPG154), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-salmo-salar-prolactin-prl-bhp10514031</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018724SWI-SDS.jpg?v=1772280010</image:loc>
      <image:title>Recombinant Salmo salar Prolactin (prl)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-beta-2-microglobulin-b2m-bhp10514059</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002486CA-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Cat Beta-2-microglobulin (B2M)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bromodomain-containing-protein-2-brd2-partial-bhp10514060</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002800HU1-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Human Bromodomain-containing protein 2 (BRD2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-respiratory-syncytial-virus-protein-m2-1-m2-1-bhp10514057</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6173HPN-SDS.jpg?v=1772280005</image:loc>
      <image:title>Recombinant Human respiratory syncytial virus Protein M2-1 (M2-1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-small-ribosomal-subunit-protein-us12-rps23-bhp10514035</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020400HU-SDS.jpg?v=1772280000</image:loc>
      <image:title>Recombinant Human Small ribosomal subunit protein uS12 (RPS23)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-hemoglobin-subunit-alpha-hba-bhp10514050</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010147MOa2-SDS.jpg?v=1772280014</image:loc>
      <image:title>Recombinant Mouse Hemoglobin subunit alpha (Hba)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cd44-antigen-cd44-partial-bhp10513891</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004938HU3_F1_d9-SDS.jpg?v=1772280005</image:loc>
      <image:title>Recombinant Human CD44 antigen (CD44), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myotubularin-mtm1-bhp10513912</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP614418HU-SDS.jpg?v=1772279998</image:loc>
      <image:title>Recombinant Human Myotubularin (MTM1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-apoptosis-associated-speck-like-protein-containing-a-card-pycard-partial-bhp10513936</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP890936HU1b1-SDS.jpg?v=1772279999</image:loc>
      <image:title>Recombinant Human Apoptosis-associated speck-like protein containing a CARD (PYCARD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hyaluronidase-1-hyal1-partial-bhp10513934</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP623651HU1e3-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Human Hyaluronidase-1 (HYAL1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-superoxide-dismutase-cu-zn-sod1-bhp10513933</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022397PIa2-SDS.jpg?v=1772280007</image:loc>
      <image:title>Recombinant Pig Superoxide dismutase [Cu-Zn](SOD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-ubiquitin-carboxyl-terminal-hydrolase-isozyme-l1-uchl1-partial-bhp10513909</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP713942MOV-SDS.jpg?v=1772280079</image:loc>
      <image:title>Recombinant Macaca fascicularis Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCHL1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-butyrophilin-like-protein-2-btnl2-partial-bhp10513913</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP883443HU-SDS.jpg?v=1772280016</image:loc>
      <image:title>Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mammaglobin-b-scgb2a1-bhp10513932</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020816HUa2-SDS.jpg?v=1772280086</image:loc>
      <image:title>Recombinant Human Mammaglobin-B (SCGB2A1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-mono-adp-ribosyltransferase-parp8-parp8-partial-bhp10513926</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP847623HU-SDS.jpg?v=1772280021</image:loc>
      <image:title>Recombinant Human Protein mono-ADP-ribosyltransferase PARP8 (PARP8), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-complement-component-c8-gamma-chain-c8g-bhp10514048</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP823734MO-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Mouse Complement component C8 gamma chain (C8g)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-fmrfamide-receptor-fmrfar-partial-bhp10513950</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP893353DLU1-SDS.jpg?v=1772280012</image:loc>
      <image:title>Recombinant Drosophila melanogaster FMRFamide receptor (FMRFaR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-formin-2-fmn2-partial-bhp10514049</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP873702HU-SDS.jpg?v=1772279998</image:loc>
      <image:title>Recombinant Human Formin-2 (FMN2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myosin-regulatory-light-polypeptide-9-myl9-bhp10513927</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015318HU-SDS.jpg?v=1772280077</image:loc>
      <image:title>Recombinant Human Myosin regulatory light polypeptide 9 (MYL9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-tyrosine-protein-kinase-mer-mertk-partial-active-bhp10513922</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6050MOV-SDS.jpg?v=1772279999</image:loc>
      <image:title>Recombinant Macaca fascicularis tyrosine-protein kinase Mer (MERTK), Partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-severe-acute-respiratory-syndrome-coronavirus-2-nucleoprotein-n-partial-bhp10513940</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP3325GMY2d7-SDS.jpg?v=1772279997</image:loc>
      <image:title>Recombinant Severe acute respiratory syndrome coronavirus 2 Nucleoprotein (N), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bromodomain-containing-protein-4-brd4-partial-bhp10514061</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002802HU3-SDS.jpg?v=1772280000</image:loc>
      <image:title>Recombinant Human Bromodomain-containing protein 4 (BRD4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-influenza-a-virus-matrix-protein-2-m2-partial-bhp10513889</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5562-SDS.jpg?v=1772280022</image:loc>
      <image:title>Recombinant Influenza A virus Matrix protein 2 (M2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dermatophagoides-farinae-paramyosin-partial-bhp10513931</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP853366DCOc7-SDS.jpg?v=1772280010</image:loc>
      <image:title>Recombinant Dermatophagoides farinae Paramyosin, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-rna-cytosine-c-5-methyltransferase-nsun2-nsun2-bhp10514047</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP626626HU-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Human RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-mono-adp-ribosyltransferase-parp16-parp16-partial-bhp10513925</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP836673HU-SDS.jpg?v=1772280004</image:loc>
      <image:title>Recombinant Human Protein mono-ADP-ribosyltransferase PARP16 (PARP16), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-platelet-derived-growth-factor-subunit-b-pdgfb-partial-bhp10513941</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017709BO1n6-SDS.jpg?v=1772280082</image:loc>
      <image:title>Recombinant Bovine Platelet-derived growth factor subunit B (PDGFB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-procollagen-lysine-2-oxoglutarate-5-dioxygenase-2-plod2-bhp10513890</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP018200HU-SDS.jpg?v=1772280000</image:loc>
      <image:title>Recombinant Human Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 (PLOD2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-cation-independent-mannose-6-phosphate-receptor-igf2r-partial-bhp10513946</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011093BOe1-SDS.jpg?v=1772280079</image:loc>
      <image:title>Recombinant Bovine Cation-independent mannose-6-phosphate receptor(IGF2R), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cricetulus-griseus-uncharacterized-protein-bhp10513962</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5481DXU-SDS.jpg?v=1772280014</image:loc>
      <image:title>Recombinant Cricetulus griseus Uncharacterized protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-type-18-minor-capsid-protein-l2-l2-bhp10513967</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356939HMNc7-SDS.jpg?v=1772280074</image:loc>
      <image:title>Recombinant Human papillomavirus type 18 Minor capsid protein L2 (L2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-importin-subunit-beta-1-kpnb1-bhp10513928</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP622929HU_A4_a0-SDS.jpg?v=1772280002</image:loc>
      <image:title>Recombinant Human Importin subunit beta-1 (KPNB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-thyrotropin-subunit-beta-tshb-partial-bhp10513938</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025130MO-SDS.jpg?v=1772280080</image:loc>
      <image:title>Recombinant Mouse Thyrotropin subunit beta (Tshb), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-charged-multivesicular-body-protein-2b-chmp2b-bhp10513975</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP891990HUc7-SDS.jpg?v=1772279998</image:loc>
      <image:title>Recombinant Human Charged multivesicular body protein 2b (CHMP2B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-finegoldia-magna-atcc-53516-lpxtg-motif-cell-wall-anchor-domain-protein-partial-biotinylated-bhp10513929</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5116GUR-B-SDS_0ef3832e-f779-4470-b3e9-33a218b8907c.jpg?v=1772279998</image:loc>
      <image:title>Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-angiopoietin-2-angpt2-bhp10513910</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP001707RA-SDS.jpg?v=1772279999</image:loc>
      <image:title>Recombinant Rat Angiopoietin-2 (Angpt2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-regulator-of-g-protein-signaling-16-rgs16-bhp10513970</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP019647HU-SDS.jpg?v=1772280008</image:loc>
      <image:title>Recombinant Human Regulator of G-protein signaling 16 (RGS16)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-clostridium-botulinum-hemagglutinin-component-of-the-neurotoxin-complex-ha17-bhp10513937</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP332826CLQf1-SDS.jpg?v=1772280088</image:loc>
      <image:title>Recombinant Clostridium botulinum Hemagglutinin component of the neurotoxin complex (ha17)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kelch-like-ech-associated-protein-1-keap1-biotinylated-bhp10513924</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012147HU-B-SDS.jpg?v=1772279997</image:loc>
      <image:title>Recombinant Human Kelch-like ECH-associated protein 1 (KEAP1), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sparc-related-modular-calcium-binding-protein-1-smoc1-partial-bhp10514013</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP875673HU1f0-SDS.jpg?v=1772279999</image:loc>
      <image:title>Recombinant Human SPARC-related modular calcium-binding protein 1(SMOC1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-contactin-associated-protein-like-2-cntnap2-partial-bhp10513951</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887030HU-SDS_7c34268d-6ba2-4db4-8f43-a8a4d4e8c284.jpg?v=1772280003</image:loc>
      <image:title>Recombinant Human Contactin-associated protein-like 2 (CNTNAP2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cd81-antigen-cd81-partial-bhp10513954</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004960MOc0-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Mouse CD81 antigen (Cd81), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-u1-small-nuclear-ribonucleoprotein-a-snrpa-partial-bhp10513976</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022327HU1c7-SDS.jpg?v=1772280088</image:loc>
      <image:title>Recombinant Human U1 small nuclear ribonucleoprotein A (SNRPA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-aspidelaps-scutatus-cytotoxin-homolog-s3c2-bhp10513945</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP325630APVa2-SDS.jpg?v=1772280003</image:loc>
      <image:title>Recombinant Aspidelaps scutatus Cytotoxin homolog S3C2</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-probable-rna-binding-protein-46-rbm46-bhp10514017</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP851536HU-SDS.jpg?v=1772280004</image:loc>
      <image:title>Recombinant Human Probable RNA-binding protein 46 (RBM46)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-allergin-1-milr1-partial-bhp10513939</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP801819HUe3-SDS.jpg?v=1772280019</image:loc>
      <image:title>Recombinant Human Allergin-1(MILR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-neisseria-gonorrhoeae-dihydrofolate-reductase-fola-bhp10514004</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006847NFZb1-SDS.jpg?v=1772280083</image:loc>
      <image:title>Recombinant Neisseria gonorrhoeae Dihydrofolate reductase (folA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-augurin-ecrg4-partial-bhp10513942</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887957HUa2-SDS.jpg?v=1772280000</image:loc>
      <image:title>Recombinant Human Augurin(ECRG4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-1-receptor-like-2-il1rl2-partial-bhp10513964</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP875357MOc7-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-fosb-fosb-bhp10514010</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008791HU-SDS.jpg?v=1772280017</image:loc>
      <image:title>Recombinant Human Protein fosB (FOSB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-x-c-chemokine-receptor-type-5-cxcr5-partial-bhp10513944</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006255HU1-SDS.jpg?v=1772280005</image:loc>
      <image:title>Recombinant Human C-X-C chemokine receptor type 5(CXCR5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-profilin-chic-bhp10513956</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP333112DLU-SDS.jpg?v=1772280000</image:loc>
      <image:title>Recombinant Drosophila melanogaster Profilin (chic)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-endophilin-b1-sh3glb1-bhp10513961</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP878084HUc7-SDS.jpg?v=1772280093</image:loc>
      <image:title>Recombinant Human Endophilin-B1 (SH3GLB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-phosphatase-ptc7-homolog-pptc7-bhp10514040</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP836783HU-SDS.jpg?v=1772280000</image:loc>
      <image:title>Recombinant Human Protein phosphatase PTC7 homolog (PPTC7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-shigella-sonnei-lps-assembly-protein-lptd-lptd-partial-bhp10514000</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP671312SGI-SDS.jpg?v=1772280004</image:loc>
      <image:title>Recombinant Shigella sonnei LPS-assembly protein lptD (lptD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibulin-1-fbln1-bhp10514001</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008452HU-SDS.jpg?v=1772280007</image:loc>
      <image:title>Recombinant Human Fibulin-1 (FBLN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-yth-domain-containing-family-protein-2-ythdf2-partial-bhp10513959</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP896902HU1-SDS.jpg?v=1772280009</image:loc>
      <image:title>Recombinant Human YTH domain-containing family protein 2 (YTHDF2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-26s-proteasome-non-atpase-regulatory-subunit-11-psmd11-bhp10513930</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018901HU-SDS.jpg?v=1772280088</image:loc>
      <image:title>Recombinant Human 26S proteasome non-ATPase regulatory subunit 11 (PSMD11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gamma-aminobutyric-acid-receptor-associated-protein-like-2-gabarapl2-bhp10513911</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP009132HU-SDS.jpg?v=1772280078</image:loc>
      <image:title>Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 2 (GABARAPL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-abc-transporter-arginine-binding-protein-1-artj-bhp10514028</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP333564ENV-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Escherichia coli ABC transporter arginine-binding protein 1 (artJ)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-gibberellin-regulated-protein-14-gasa14-bhp10513994</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP862779DOAc7-SDS.jpg?v=1772280002</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Gibberellin-regulated protein 14 (GASA14)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-gossypium-hirsutum-non-specific-lipid-transfer-protein-partial-bhp10514006</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP670383GHB-SDS.jpg?v=1772280074</image:loc>
      <image:title>Recombinant Gossypium hirsutum Non-specific lipid-transfer protein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-brugia-malayi-ddrgk-domain-containing-protein-1-bhp10513988</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006597BWV-SDS.jpg?v=1772279998</image:loc>
      <image:title>Recombinant Brugia malayi DDRGK domain-containing protein 1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-leptospira-interrogans-serogroup-icterohaemorrhagiae-serovar-lai-flagellar-filament-35-kda-core-protein-flab-bhp10513974</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP527481LOSc7-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Flagellar filament 35 kDa core protein (flaB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-fibroblast-growth-factor-1-fgf1-bhp10513935</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008615BO-SDS.jpg?v=1772280012</image:loc>
      <image:title>Recombinant Bovine Fibroblast growth factor 1 (FGF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-prolactin-prl-bhp10513947</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018724MOa0-SDS.jpg?v=1772280018</image:loc>
      <image:title>Recombinant Mouse Prolactin (Prl)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-haptoglobin-hp-partial-bhp10513995</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP016091HU-SDS.jpg?v=1772280088</image:loc>
      <image:title>Recombinant Human Haptoglobin (HP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-paired-box-protein-pax-7-pax7-bhp10513978</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017493HUc7-SDS.jpg?v=1772280007</image:loc>
      <image:title>Recombinant Human Paired box protein Pax-7 (PAX7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-phosphorylated-adapter-rna-export-protein-phax-bhp10514021</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP884932MO-SDS.jpg?v=1772280000</image:loc>
      <image:title>Recombinant Mouse Phosphorylated adapter RNA export protein (Phax)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-regenerating-islet-derived-protein-3-gamma-reg3g-partial-bhp10513984</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP019549MOc7-SDS.jpg?v=1772280009</image:loc>
      <image:title>Recombinant Mouse Regenerating islet-derived protein 3-gamma (Reg3g), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ras-related-protein-rap-2c-rap2c-bhp10513963</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP896507HU-SDS.jpg?v=1772280008</image:loc>
      <image:title>Recombinant Human Ras-related protein Rap-2c (RAP2C)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sun-domain-containing-protein-1-sun1-partial-bhp10513973</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP529741HU2-SDS.jpg?v=1772280001</image:loc>
      <image:title>Recombinant Human SUN domain-containing protein 1 (SUN1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-african-swine-fever-virus-b646l-p72-partial-bhp10513969</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP3311GMW1-SDS.jpg?v=1772280022</image:loc>
      <image:title>Recombinant African swine fever virus B646L (p72), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-shigella-flexneri-nucleoside-specific-channel-forming-protein-tsx-tsx-bhp10514041</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP359235SZB-SDS.jpg?v=1772280002</image:loc>
      <image:title>Recombinant Shigella flexneri Nucleoside-specific channel-forming protein tsx (tsx)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-d-3-phosphoglycerate-dehydrogenase-phgdh-partial-bhp10513960</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017920HU1c0-SDS.jpg?v=1772280000</image:loc>
      <image:title>Recombinant Human D-3-phosphoglycerate dehydrogenase (PHGDH), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-slit-homolog-2-protein-slit2-partial-bhp10513985</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP879505MO-SDS.jpg?v=1772280003</image:loc>
      <image:title>Recombinant Mouse Slit homolog 2 protein (Slit2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-shigella-flexneri-outer-membrane-protein-assembly-factor-bama-bama-partial-bhp10514029</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP359242SZB-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Shigella flexneri Outer membrane protein assembly factor BamA (bamA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-heterogeneous-nuclear-ribonucleoprotein-l-like-hnrpll-bhp10513980</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010630MO-SDS.jpg?v=1772280007</image:loc>
      <image:title>Recombinant Mouse Heterogeneous nuclear ribonucleoprotein L-like (Hnrpll)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-measles-virus-fusion-glycoprotein-f0-f-partial-bhp10513968</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP303138MCSb1-SDS.jpg?v=1772280005</image:loc>
      <image:title>Recombinant Measles virus Fusion glycoprotein F0 (F), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neuroendocrine-secretory-protein-55-gnas-bhp10514008</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009596HU-SDS.jpg?v=1772280015</image:loc>
      <image:title>Recombinant Human Neuroendocrine secretory protein 55 (GNAS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-shigella-flexneri-peptidoglycan-associated-lipoprotein-pal-bhp10514012</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP364258SZB-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Shigella flexneri Peptidoglycan-associated lipoprotein (pal)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-steap1-protein-steap1-partial-bhp10513982</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP890691HU-SDS.jpg?v=1772280019</image:loc>
      <image:title>Recombinant Human STEAP1 protein (STEAP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-glycine-max-seed-biotin-containing-protein-sbp65-sbp65-bhp10514016</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP661207GGVc7-SDS.jpg?v=1772280005</image:loc>
      <image:title>Recombinant Glycine max Seed biotin-containing protein SBP65 (SBP65)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-carnation-italian-ringspot-virus-rna-silencing-suppressor-p19-orf4-bhp10513977</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP737613CHAA-SDS.jpg?v=1772279998</image:loc>
      <image:title>Recombinant Carnation Italian ringspot virus RNA silencing suppressor p19 (ORF4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-putida-arginine-ornithine-antiporter-arcd-partial-bhp10514005</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP336829FFZ-SDS.jpg?v=1772279999</image:loc>
      <image:title>Recombinant Pseudomonas putida Arginine/ornithine antiporter (arcD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-androgen-receptor-ar-partial-bhp10514007</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001975HU4-SDS.jpg?v=1772280022</image:loc>
      <image:title>Recombinant Human Androgen receptor (AR) , partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-alpha-defensin-3-defa3-bhp10513992</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006655MO-SDS.jpg?v=1772280002</image:loc>
      <image:title>Recombinant Mouse Alpha-defensin 3 (Defa3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neurotrimin-ntm-bhp10514025</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP016126MO-SDS.jpg?v=1772280009</image:loc>
      <image:title>Recombinant Mouse Neurotrimin (Ntm)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-preli-domain-containing-protein-1-mitochondrial-prelid1-bhp10514003</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP896867HUb1-SDS.jpg?v=1772280084</image:loc>
      <image:title>Recombinant Human PRELI domain-containing protein 1, mitochondrial (PRELID1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-nepenthes-gracilis-aspartic-proteinase-nepenthesin-2-nep2-bhp10514018</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP765721NBAV-SDS.jpg?v=1772280000</image:loc>
      <image:title>Recombinant Nepenthes gracilis Aspartic proteinase nepenthesin-2 (nep2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-protease-23-prss23-bhp10513986</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018817HUa0-SDS.jpg?v=1772280003</image:loc>
      <image:title>Recombinant Human Serine protease 23 (PRSS23)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacillus-phage-phi29-single-stranded-dna-binding-protein-5-bhp10514039</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP654323BBC-SDS.jpg?v=1772280005</image:loc>
      <image:title>Recombinant Bacillus phage phi29 Single-stranded DNA-binding protein (5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-gapt-gapt-partial-bhp10513997</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP839783HU1a2-SDS.jpg?v=1772280078</image:loc>
      <image:title>Recombinant Human Protein GAPT (GAPT), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-chromobox-protein-homolog-1-cbx1-bhp10513955</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004597HU-SDS.jpg?v=1772280004</image:loc>
      <image:title>Recombinant Human Chromobox protein homolog 1 (CBX1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-shigella-flexneri-arginine-abc-transporter-permease-protein-artm-artm-partial-bhp10513979</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP365079SZB1-SDS.jpg?v=1772280000</image:loc>
      <image:title>Recombinant Shigella flexneri Arginine ABC transporter permease protein ArtM (artM), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cysteine-dioxygenase-type-1-cdo1-bhp10513958</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP621975HUf0-SDS.jpg?v=1772280008</image:loc>
      <image:title>Recombinant Human Cysteine dioxygenase type 1 (CDO1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pinctada-fucata-mantle-gene-8-bhp10513966</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5199GQA-SDS.jpg?v=1772280007</image:loc>
      <image:title>Recombinant Pinctada fucata Mantle gene 8</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-actin-related-protein-2-3-complex-subunit-2-arpc2-partial-bhp10513991</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002127HU1f0-SDS.jpg?v=1772280102</image:loc>
      <image:title>Recombinant Human Actin-related protein 2/3 complex subunit 2 (ARPC2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-murid-herpesvirus-1-envelope-glycoprotein-l-gl-biotinylated-bhp10514020</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP346765MJT-B-SDS.jpg?v=1772280035</image:loc>
      <image:title>Recombinant Murid herpesvirus 1 Envelope glycoprotein L (gL), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nucleolar-protein-3-nol3-bhp10514002</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015921HUc7-SDS.jpg?v=1772280073</image:loc>
      <image:title>Recombinant Human Nucleolar protein 3 (NOL3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-shigella-flexneri-long-chain-fatty-acid-transport-protein-fadl-bhp10514027</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP352957SZB-SDS.jpg?v=1772280007</image:loc>
      <image:title>Recombinant Shigella flexneri Long-chain fatty acid transport protein (fadL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bpi-fold-containing-family-a-member-3-bpifa3-bhp10513949</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP866261HU-SDS.jpg?v=1772280005</image:loc>
      <image:title>Recombinant Human BPI fold-containing family A member 3 (BPIFA3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-histone-h3-3-h3f3a-partial-bhp10513957</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010109HUf0-SDS.jpg?v=1772280009</image:loc>
      <image:title>Recombinant Human Histone H3.3 (H3F3A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-trichoderma-harzianum-endo-1-4-beta-xylanase-bhp10514036</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP344161TKN-SDS.jpg?v=1772280000</image:loc>
      <image:title>Recombinant Trichoderma harzianum Endo-1,4-beta-xylanase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-keratin-type-ii-cytoskeletal-6a-krt6a-bhp10513972</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012561HUf0-SDS.jpg?v=1772280014</image:loc>
      <image:title>Recombinant Human Keratin,type II cytoskeletal 6A (KRT6A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bos-indicus-x-bos-taurus-kappa-casein-partial-bhp10513993</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5324BUM3-SDS.jpg?v=1772279997</image:loc>
      <image:title>Recombinant Bos indicus x Bos taurus Kappa-casein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lysozyme-c-lyz-bhp10513983</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013283HUc7-SDS.jpg?v=1772280017</image:loc>
      <image:title>Recombinant Human Lysozyme C (LYZ)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-l-myc-mycl-partial-bhp10514014</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015274HU1-SDS.jpg?v=1772279997</image:loc>
      <image:title>Recombinant Human Protein L-Myc (MYCL), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-enhancer-of-rudimentary-homolog-erh-bhp10513981</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007785HUf0-SDS.jpg?v=1772280010</image:loc>
      <image:title>Recombinant Human Enhancer of rudimentary homolog (ERH)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-envelope-glycoprotein-l-gl-bhp10514011</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP355982EFAc0-SDS.jpg?v=1772280071</image:loc>
      <image:title>Recombinant Epstein-Barr virus Envelope glycoprotein L (gL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-polymerase-theta-polq-partial-bhp10513989</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018321HU9a0-SDS.jpg?v=1772280067</image:loc>
      <image:title>Recombinant Human DNA polymerase theta (POLQ), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-phage-t7-t7-rna-polymerase-1-partial-bhp10513948</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018353EEBa2-SDS.jpg?v=1772280082</image:loc>
      <image:title>Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-shigella-flexneri-virulence-sensor-protein-phoq-phoq-partial-bhp10514024</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP802867SZB1-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Shigella flexneri Virulence sensor protein PhoQ (phoQ), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-chromodomain-helicase-dna-binding-protein-4-chd4-partial-bhp10513965</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP614811HU-SDS.jpg?v=1772280071</image:loc>
      <image:title>Recombinant Human Chromodomain-helicase-DNA-binding protein 4 (CHD4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-aldo-keto-reductase-family-1-member-a1-akr1a1-bhp10513999</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001538PIa0-SDS.jpg?v=1772279998</image:loc>
      <image:title>Recombinant Pig Aldo-keto reductase family 1 member A1 (AKR1A1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-enhancer-factor-tef-1-tead1-partial-bhp10513953</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023363HU1e1-SDS.jpg?v=1772280007</image:loc>
      <image:title>Recombinant Human Transcriptional enhancer factor TEF-1 (TEAD1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ribonuclease-h1-rnaseh1-bhp10514026</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP019801HUc7-SDS.jpg?v=1772279998</image:loc>
      <image:title>Recombinant Human Ribonuclease H1 (RNASEH1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-regulator-erg-erg-239-245-bhp10514037</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007781HU_M_-SDS.jpg?v=1772279998</image:loc>
      <image:title>Recombinant Human Transcriptional regulator ERG (ERG) (Δ239-245)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-phenylalanine-4-hydroxylase-pah-bhp10513943</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017396MOe1-SDS.jpg?v=1772280005</image:loc>
      <image:title>Recombinant Mouse Phenylalanine-4-hydroxylase (Pah)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-shigella-flexneri-phosphatidylglycerophosphatase-b-pgpb-partial-bhp10514030</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP359233SZB1-SDS.jpg?v=1772279999</image:loc>
      <image:title>Recombinant Shigella flexneri Phosphatidylglycerophosphatase B (pgpB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-boule-like-boll-bhp10514009</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP854082HUc0-SDS.jpg?v=1772280000</image:loc>
      <image:title>Recombinant Human Protein boule-like (BOLL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bromodomain-containing-protein-4-brd4-partial-bhp10514063</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002802HU2-SDS.jpg?v=1772280078</image:loc>
      <image:title>Recombinant Human Bromodomain-containing protein 4 (BRD4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fyve-rhogef-and-ph-domain-containing-protein-3-fgd3-bhp10514022</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP689335HU-SDS.jpg?v=1772280011</image:loc>
      <image:title>Recombinant Human FYVE, RhoGEF and PH domain-containing protein 3 (FGD3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lysine-specific-demethylase-rsbn1l-rsbn1l-partial-bhp10514019</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP757620HU-SDS.jpg?v=1772280003</image:loc>
      <image:title>Recombinant Human Lysine-specific demethylase RSBN1L (RSBN1L), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-rhesus-theta-defensin-1-2-subunit-b-rtd1b-bhp10513987</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP307810MOW-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Macaca mulatta Rhesus theta defensin-1/2 subunit B (RTD1B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bromodomain-containing-protein-2-brd2-partial-bhp10514064</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002800HU-SDS.jpg?v=1772280013</image:loc>
      <image:title>Recombinant Human Bromodomain-containing protein 2 (BRD2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-poly-adp-ribose-polymerase-tankyrase-2-tnks2-partial-bhp10513998</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867136HU1-SDS.jpg?v=1772280005</image:loc>
      <image:title>Recombinant Human Poly [ADP-ribose] polymerase tankyrase-2 (TNKS2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-glutamate-aspartate-import-permease-protein-gltk-gltk-partial-bhp10514023</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360152ENV1-SDS.jpg?v=1772280006</image:loc>
      <image:title>Recombinant Escherichia coli Glutamate/aspartate import permease protein GltK (gltK), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-plexin-domain-containing-protein-1-plxdc1-partial-bhp10513971</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP816875HUb0-SDS.jpg?v=1772280022</image:loc>
      <image:title>Recombinant Human Plexin domain-containing protein 1 (PLXDC1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-proto-oncogene-wnt-1-wnt1-bhp10514065</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026128HU-SDS.jpg?v=1772280085</image:loc>
      <image:title>Recombinant Human Proto-oncogene Wnt-1 (WNT1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-coiled-coil-domain-containing-112-ccdc112-bhp10514069</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5684RA-SDS.jpg?v=1772280079</image:loc>
      <image:title>Recombinant Rat Coiled-coil domain containing 112 (Ccdc112)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-small-ribosomal-subunit-protein-es25-rps25-bhp10514015</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020406HUc7-SDS.jpg?v=1772280004</image:loc>
      <image:title>Recombinant Human Small ribosomal subunit protein eS25 (RPS25)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pinctada-fucata-extrapallial-fluid-protein-ep18-n82h-bhp10513996</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5055GQA_M_-SDS.jpg?v=1772280076</image:loc>
      <image:title>Recombinant Pinctada fucata Extrapallial fluid protein EP18 (N82H)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-shigella-flexneri-putative-multidrug-resistance-outer-membrane-protein-mdtq-mdtq-bhp10513990</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP802810SZB-SDS.jpg?v=1772280009</image:loc>
      <image:title>Recombinant Shigella flexneri Putative multidrug resistance outer membrane protein MdtQ (mdtQ)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-glutamicibacter-nicotianae-adenylate-cyclase-cya-bhp10514042</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP326731BLY-SDS.jpg?v=1772280000</image:loc>
      <image:title>Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-growth-differentiation-factor-2-gdf2-bhp10514066</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP892325HU1-SDS.jpg?v=1772280032</image:loc>
      <image:title>Recombinant Human Growth/differentiation factor 2 (GDF2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-inhibin-beta-e-chain-inhbe-bhp10514076</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011722RA-SDS.jpg?v=1772280081</image:loc>
      <image:title>Recombinant Rat Inhibin beta E chain (Inhbe)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bos-indicus-x-bos-taurus-kappa-casein-partial-bhp10513952</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5324BUM2-SDS.jpg?v=1772280009</image:loc>
      <image:title>Recombinant Bos indicus x Bos taurus Kappa-casein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-inhibin-subunit-beta-e-inhbe-partial-bhp10514067</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5872MOVc7-SDS.jpg?v=1772280097</image:loc>
      <image:title>Recombinant Macaca fascicularis Inhibin subunit beta E (INHBE), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-erythropoietin-epo-bhp10514071</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007743HU-SDS.jpg?v=1772280028</image:loc>
      <image:title>Recombinant Human Erythropoietin (EPO)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-inhibin-beta-e-chain-inhbe-bhp10514072</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011722MO-SDS.jpg?v=1772280032</image:loc>
      <image:title>Recombinant Mouse Inhibin beta E chain (Inhbe)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rotavirus-a-non-structural-glycoprotein-4-partial-bhp10514078</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP465285ROJc7-SDS.jpg?v=1772280106</image:loc>
      <image:title>Recombinant Rotavirus A Non-structural glycoprotein 4, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-uncharacterized-protein-c8orf76-c8orf76-bhp10514073</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856963HU-SDS.jpg?v=1772280036</image:loc>
      <image:title>Recombinant Human Uncharacterized protein C8orf76 (C8orf76)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-aconitate-hydratase-mitochondrial-aco2-k68r-bhp10514081</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859943HU_M_-SDS.jpg?v=1772280013</image:loc>
      <image:title>Recombinant Human Aconitate hydratase, mitochondrial (ACO2) (K68R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-containing-protein-28-lrrc28-bhp10514077</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP774826HU-SDS.jpg?v=1772280076</image:loc>
      <image:title>Recombinant Human Leucine-rich repeat-containing protein 28 (LRRC28)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-polyunsaturated-fatty-acid-5-lipoxygenase-alox5-bhp10514074</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001624HU-SDS.jpg?v=1772280090</image:loc>
      <image:title>Recombinant Human Polyunsaturated fatty acid 5-lipoxygenase (ALOX5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-t4-sliding-clamp-45-bhp10514038</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361288EDZ-SDS.jpg?v=1772280004</image:loc>
      <image:title>Recombinant Enterobacteria phage T4 Sliding clamp (45)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-casein-kinase-ii-subunit-alpha-csnk2a1-bhp10514080</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006072HUc7-SDS.jpg?v=1772280085</image:loc>
      <image:title>Recombinant Human Casein kinase II subunit alpha (CSNK2A1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-polyunsaturated-fatty-acid-5-lipoxygenase-alox5-bhp10514075</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001624HUd7-SDS.jpg?v=1772280079</image:loc>
      <image:title>Recombinant Human Polyunsaturated fatty acid 5-lipoxygenase (ALOX5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-transposon-tn3-resolvase-tnpr-bhp10514082</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP364980ENL-SDS.jpg?v=1772280025</image:loc>
      <image:title>Recombinant Escherichia coli Transposon Tn3 resolvase (tnpR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-ambrosia-artemisiifolia-pectate-lyase-5-bhp10514070</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP329754BYCc7-SDS.jpg?v=1772280077</image:loc>
      <image:title>Recombinant Ambrosia artemisiifolia Pectate lyase 5</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prothrombin-f2-partial-bhp10514068</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007923HU1-SDS.jpg?v=1772280085</image:loc>
      <image:title>Recombinant Human Prothrombin (F2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bone-morphogenetic-protein-4-bmp4-bhp10514094</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002740HUc7-SDS.jpg?v=1772280088</image:loc>
      <image:title>Recombinant Human Bone morphogenetic protein 4(BMP4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-spinacia-oleracea-phosphoribulokinase-chloroplastic-bhp10514086</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP362728FKI-SDS.jpg?v=1772280095</image:loc>
      <image:title>Recombinant Spinacia oleracea Phosphoribulokinase, chloroplastic</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-inactive-hydroxysteroid-dehydrogenase-like-protein-1-hsdl1-bhp10514096</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP664853HUe0-SDS.jpg?v=1772280030</image:loc>
      <image:title>Recombinant Human Inactive hydroxysteroid dehydrogenase-like protein 1 (HSDL1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cadherin-12-cdh12-partial-bhp10514091</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005037HUc7-SDS.jpg?v=1772280075</image:loc>
      <image:title>Recombinant Human Cadherin-12 (CDH12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sushi-repeat-containing-protein-srpx2-srpx2-bhp10514098</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022690HU-SDS.jpg?v=1772280056</image:loc>
      <image:title>Recombinant Human Sushi repeat-containing protein SRPX2 (SRPX2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-l-amino-acid-oxidase-il4i1-partial-bhp10514088</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP850426HU1-SDS.jpg?v=1772280016</image:loc>
      <image:title>Recombinant Human L-amino-acid oxidase (IL4I1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-macrophage-colony-stimulating-factor-1-csf1-partial-bhp10514095</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006043HU-SDS.jpg?v=1772280097</image:loc>
      <image:title>Recombinant Human Macrophage colony-stimulating factor 1 (CSF1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-midnolin-midn-bhp10514101</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013822HU-SDS.jpg?v=1772280087</image:loc>
      <image:title>Recombinant Human Midnolin (MIDN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neurogenic-differentiation-factor-1-neurod1-h241a-bhp10514083</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720182MO_M3_-SDS.jpg?v=1772280093</image:loc>
      <image:title>Recombinant Mouse Neurogenic differentiation factor 1 (Neurod1)(H241A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-syncytin-2-ervfrd-1-partial-bhp10514092</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP352689HU-SDS.jpg?v=1772280080</image:loc>
      <image:title>Recombinant Human Syncytin-2 (ERVFRD-1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-13-il13-bhp10514107</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011590MO-SDS.jpg?v=1772280096</image:loc>
      <image:title>Recombinant Mouse Interleukin-13 (Il13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-histone-deacetylase-2-hdac2-bhp10514097</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010238MO-SDS.jpg?v=1772280082</image:loc>
      <image:title>Recombinant Mouse Histone deacetylase 2 (Hdac2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-aldo-keto-reductase-family-1-member-a1-akr1a1-bhp10514102</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP878064MO-SDS.jpg?v=1772280088</image:loc>
      <image:title>Recombinant Mouse Aldo-keto reductase family 1 member A1 (Akr1a1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-receptor-superfamily-member-3-ltbr-partial-bhp10514109</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013227MO-SDS.jpg?v=1772280088</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor receptor superfamily member 3 (Ltbr), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-corynephage-beta-diphtheria-toxin-partial-bhp10514079</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360556CQR1c7-SDS.jpg?v=1772280105</image:loc>
      <image:title>Recombinant Corynephage beta Diphtheria toxin, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-formin-2-fmn2-partial-bhp10514103</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP873702HUc7-SDS.jpg?v=1772280087</image:loc>
      <image:title>Recombinant Human Formin-2 (FMN2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neurogenic-differentiation-factor-1-neurod1-h115a-bhp10514084</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720182MO_M2_-SDS.jpg?v=1772280088</image:loc>
      <image:title>Recombinant Mouse Neurogenic differentiation factor 1 (Neurod1)(H115A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-protein-bmrf2-bmrf2-partial-bhp10514087</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP365872EFAc7-SDS.jpg?v=1772280090</image:loc>
      <image:title>Recombinant Epstein-Barr virus Protein BMRF2 (BMRF2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-vespula-vulgaris-phospholipase-a1-bhp10514089</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP343003VETc7-SDS.jpg?v=1772280029</image:loc>
      <image:title>Recombinant Vespula vulgaris Phospholipase A1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-aconitate-hydratase-bhp10514105</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6086ENR_A4_b1-SDS.jpg?v=1772280100</image:loc>
      <image:title>Recombinant Escherichia coli Aconitate hydratase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-large-ribosomal-subunit-protein-bl25-rply-bhp10514110</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP542971ENT-SDS.jpg?v=1772280099</image:loc>
      <image:title>Recombinant Escherichia coli Large ribosomal subunit protein bL25 (rplY)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-adenosine-deaminase-ada-bhp10514085</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001268MO-SDS.jpg?v=1772280085</image:loc>
      <image:title>Recombinant Mouse Adenosine deaminase (Ada)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-newcastle-disease-virus-fusion-glycoprotein-f0-f-partial-bhp10514106</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP330269NCUb1-SDS.jpg?v=1772280088</image:loc>
      <image:title>Recombinant Newcastle disease virus Fusion glycoprotein F0 (F), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-lymphotoxin-beta-receptor-ltbr-partial-bhp10514108</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6176MOV-SDS.jpg?v=1772280094</image:loc>
      <image:title>Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-ndnf-ndnf-bhp10514099</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP807450MOa0-SDS.jpg?v=1772280080</image:loc>
      <image:title>Recombinant Mouse Protein NDNF (Ndnf)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-glutamicibacter-nicotianae-adenylate-cyclase-cya-d403a-bhp10514090</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP326731BLY_M_-SDS.jpg?v=1772280095</image:loc>
      <image:title>Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya) (D403A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-multiple-inositol-polyphosphate-phosphatase-1-minpp1-bhp10514104</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP891977HUf0-SDS.jpg?v=1772280013</image:loc>
      <image:title>Recombinant Human Multiple inositol polyphosphate phosphatase 1 (MINPP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytochrome-c-oxidase-subunit-1-mt-co1-partial-bhp10514123</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP015072HU-SDS.jpg?v=1772280089</image:loc>
      <image:title>Recombinant Human Cytochrome c oxidase subunit 1 (MT-CO1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-gamma-hemolysin-component-c-hlgc-bhp10514114</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP751944SKYc7-SDS.jpg?v=1772280106</image:loc>
      <image:title>Recombinant Staphylococcus aureus Gamma-hemolysin component C (hlgC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-marmota-monax-tumor-necrosis-factor-tnf-partial-bhp10514115</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP523593MQG-SDS.jpg?v=1772280019</image:loc>
      <image:title>Recombinant Marmota monax Tumor necrosis factor (TNF), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-trmt1-like-protein-trmt1l-bhp10514100</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP772010HU-SDS.jpg?v=1772280091</image:loc>
      <image:title>Recombinant Human TRMT1-like protein (TRMT1L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interferon-gamma-ifng-bhp10514093</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP1558MOa0-SDS.jpg?v=1772280083</image:loc>
      <image:title>Recombinant mouse Interferon gamma (Ifng)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-ustilaginoidea-virens-phosphoacetylglucosamine-mutase-bhp10514135</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP6009GVZ-SDS.jpg?v=1772280019</image:loc>
      <image:title>Recombinant Ustilaginoidea virens Phosphoacetylglucosamine mutase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-anguilla-japonica-ventricular-natriuretic-peptide-vnp-bhp10514125</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP329334BZH-SDS.jpg?v=1772280099</image:loc>
      <image:title>Recombinant Anguilla japonica Ventricular natriuretic peptide (vnp)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-alpha-hemoglobin-stabilizing-protein-ahsp-bhp10514126</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP875156MO-SDS.jpg?v=1772280029</image:loc>
      <image:title>Recombinant Mouse Alpha-hemoglobin-stabilizing protein (Ahsp)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o6-h1-uncharacterized-protein-ycio-ycio-bhp10514113</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP365343FQR-SDS.jpg?v=1772280104</image:loc>
      <image:title>Recombinant Escherichia coli O6:H1 Uncharacterized protein yciO (yciO)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-phleum-pratense-profilin-1-pro1-bhp10514131</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP017824EUQ-SDS.jpg?v=1772280033</image:loc>
      <image:title>Recombinant Phleum pratense Profilin-1 (PRO1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gtpase-kras-kras-g13d-partial-bhp10514143</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP012493HU-SDS.jpg?v=1772280018</image:loc>
      <image:title>Recombinant Human GTPase KRas (KRAS) (G13D), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-klebsiella-pneumoniae-fimbrial-subunit-type-3-mrka-bhp10514130</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP318939KBG-SDS.jpg?v=1772280033</image:loc>
      <image:title>Recombinant Klebsiella pneumoniae Fimbrial subunit type 3 (mrkA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tobacco-mosaic-virus-capsid-protein-cp-bhp10514121</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP304020TFF-SDS.jpg?v=1772280017</image:loc>
      <image:title>Recombinant Tobacco mosaic virus Capsid protein (CP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myosin-regulatory-light-chain-12a-myl12a-bhp10514144</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP015307HU-SDS.jpg?v=1772280104</image:loc>
      <image:title>Recombinant Human Myosin regulatory light chain 12A(MYL12A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-saponaria-officinalis-ribosome-inactivating-protein-saporin-9-sap9-d7n-l8a-bhp10514134</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP748739SCG_M1_-SDS.jpg?v=1772280031</image:loc>
      <image:title>Recombinant Saponaria officinalis Ribosome-inactivating protein saporin-9 (SAP9) (D7N,L8A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-bovis-esat-6-like-protein-esxb-esxb-bhp10514120</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP358628MVH-SDS.jpg?v=1772280026</image:loc>
      <image:title>Recombinant Mycobacterium bovis ESAT-6-like protein esxB (esxB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mumps-virus-fusion-glycoprotein-f0-f-partial-bhp10514142</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP341423MJL-SDS.jpg?v=1772280028</image:loc>
      <image:title>Recombinant Mumps virus Fusion glycoprotein F0 (F), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-klebsiella-pneumoniae-fimbrial-subunit-type-3-mrka-bhp10514129</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP318939KBGc7-SDS.jpg?v=1772280091</image:loc>
      <image:title>Recombinant Klebsiella pneumoniae Fimbrial subunit type 3 (mrkA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-2-3-bisphosphoglycerate-dependent-phosphoglycerate-mutase-gpma-bhp10514136</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP351195ENV-SDS.jpg?v=1772280018</image:loc>
      <image:title>Recombinant Escherichia coli 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-tenascin-tnc-partial-bhp10514127</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP642747PI-SDS.jpg?v=1772280034</image:loc>
      <image:title>Recombinant Pig Tenascin (TNC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-epstein-barr-nuclear-antigen-2-ebna2-partial-bhp10514116</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP319476EFA-SDS.jpg?v=1772280039</image:loc>
      <image:title>Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-deoxyribonuclease-1-dnase1-bhp10514122</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP007049HU-SDS.jpg?v=1772280091</image:loc>
      <image:title>Recombinant Human Deoxyribonuclease-1 (DNASE1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-20-receptor-subunit-beta-il20rb-partial-bhp10514152</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP740921HU-SDS.jpg?v=1772280039</image:loc>
      <image:title>Recombinant Human Interleukin-20 receptor subunit beta (IL20RB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-jacalin-type-lectin-domain-containing-protein-partial-bhp10514146</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP4727MOV-SDS.jpg?v=1772280047</image:loc>
      <image:title>Recombinant Macaca fascicularis Jacalin-type lectin domain-containing protein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lipocalin-1-lcn1-bhp10514118</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP012810HU-SDS.jpg?v=1772280049</image:loc>
      <image:title>Recombinant Human Lipocalin-1 (LCN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-phleum-pratense-pollen-allergen-phl-p-1-phlpi-bhp10514137</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP331772EUQ-SDS.jpg?v=1772280029</image:loc>
      <image:title>Recombinant Phleum pratense Pollen allergen Phl p 1 (PHLPI)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-mono-adp-ribosyltransferase-parp16-parp16-partial-bhp10514148</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP836673HU-SDS.jpg?v=1772280056</image:loc>
      <image:title>Recombinant Human Protein mono-ADP-ribosyltransferase PARP16 (PARP16), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-corylus-avellana-major-pollen-allergen-cor-a-1-isoforms-5-6-11-and-16-bhp10514138</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP600490CBAD-SDS.jpg?v=1772280032</image:loc>
      <image:title>Recombinant Corylus avellana Major pollen allergen Cor a 1 isoforms 5, 6, 11 and 16</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-saponaria-officinalis-ribosome-inactivating-protein-saporin-9-sap9-bhp10514117</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP748739SCG-SDS.jpg?v=1772280017</image:loc>
      <image:title>Recombinant Saponaria officinalis Ribosome-inactivating protein saporin-9 (SAP9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-36-gamma-il36g-bhp10514162</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP840290MO-SDS.jpg?v=1772280093</image:loc>
      <image:title>Recombinant Mouse Interleukin-36 gamma (Il36g)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ras-related-protein-rab-6a-rab6a-bhp10514159</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP019216HU-SDS.jpg?v=1772280101</image:loc>
      <image:title>Recombinant Human Ras-related protein Rab-6A (RAB6A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-enhancer-factor-tef-1-tead1-partial-bhp10514153</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP023363HU1-SDS.jpg?v=1772280055</image:loc>
      <image:title>Recombinant Human Transcriptional enhancer factor TEF-1 (TEAD1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-s-adenosylmethionine-synthase-isoform-type-1-mat1a-bhp10514119</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP013516HU-SDS.jpg?v=1772280032</image:loc>
      <image:title>Recombinant Human S-adenosylmethionine synthase isoform type-1 (MAT1A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-phleum-pratense-profilin-1-pro1-bhp10514132</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP017824EUQa0-SDS.jpg?v=1772280101</image:loc>
      <image:title>Recombinant Phleum pratense Profilin-1 (PRO1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leukemia-inhibitory-factor-lif-bhp10514150</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP012928HU-SDS.jpg?v=1772280106</image:loc>
      <image:title>Recombinant Human Leukemia inhibitory factor (LIF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-leukemia-inhibitory-factor-lif-bhp10514149</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP012928MO-SDS.jpg?v=1772280049</image:loc>
      <image:title>Recombinant Mouse Leukemia inhibitory factor (Lif)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o6-h1-dna-binding-dual-transcriptional-regulator-ompr-ompr-bhp10514111</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP359384FQR-SDS.jpg?v=1772280090</image:loc>
      <image:title>Recombinant Escherichia coli O6:H1 DNA-binding dual transcriptional regulator OmpR (ompR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ras-related-protein-rab-5c-rab5c-bhp10514158</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP019215HU-SDS.jpg?v=1772280099</image:loc>
      <image:title>Recombinant Human Ras-related protein Rab-5C (RAB5C)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-eukaryotic-translation-initiation-factor-4e-eif4e-bhp10514147</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP007556HU-SDS.jpg?v=1772280047</image:loc>
      <image:title>Recombinant Human Eukaryotic translation initiation factor 4E (EIF4E)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-folate-hydrolase-1-folh1-partial-bhp10514167</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP5772DO-SDS.jpg?v=1772280092</image:loc>
      <image:title>Recombinant Dog Folate hydrolase 1 (folh1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mannose-binding-protein-c-mbl2-bhp10514133</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP013540HUa4-SDS.jpg?v=1772280045</image:loc>
      <image:title>Recombinant Human Mannose-binding protein C (MBL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chicken-platelet-derived-growth-factor-subunit-b-pdgf-b-partial-bhp10514154</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP017709CH-SDS.jpg?v=1772280093</image:loc>
      <image:title>Recombinant Chicken Platelet derived growth factor subunit B (PDGF-B), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myosin-regulatory-light-chain-12b-myl12b-bhp10514145</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP015308HU-SDS.jpg?v=1772280042</image:loc>
      <image:title>Recombinant Human Myosin regulatory light chain 12B(MYL12B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-sheep-fibroblast-growth-factor-2-fgf2-active-bhp10514165</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP008625SH-SDS.jpg?v=1772280101</image:loc>
      <image:title>Recombinant Sheep Fibroblast growth factor 2 (FGF2) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-agalactiae-serotype-iii-single-stranded-dna-binding-protein-1-ssb1-bhp10514124</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP354227SMH-SDS.jpg?v=1772280032</image:loc>
      <image:title>Recombinant Streptococcus agalactiae serotype III Single-stranded DNA-binding protein 1 (ssb1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cell-adhesion-molecule-ceacam1-ceacam1-partial-active-bhp10514160</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP005157HU-SDS.jpg?v=1772280027</image:loc>
      <image:title>Recombinant Human Cell adhesion molecule CEACAM1 (CEACAM1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-dtx3l-dtx3l-bhp10514151</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP855054HU-SDS.jpg?v=1772280030</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase DTX3L (DTX3L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ras-related-protein-rab-6b-rab6b-bhp10514157</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP873642HU-SDS.jpg?v=1772280096</image:loc>
      <image:title>Recombinant Human Ras-related protein Rab-6B (RAB6B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ras-related-protein-rab-27a-rab27a-bhp10514156</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP019177HU-SDS.jpg?v=1772280036</image:loc>
      <image:title>Recombinant Human Ras-related protein Rab-27A (RAB27A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-porcine-reproductive-and-respiratory-syndrome-virus-nucleoprotein-n-bhp10514170</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP5754GMW-SDS.jpg?v=1772280034</image:loc>
      <image:title>Recombinant Porcine reproductive and respiratory syndrome virus Nucleoprotein (N)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chicken-pro-epidermal-growth-factor-egf-partial-bhp10514164</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP007473CH-SDS.jpg?v=1772280055</image:loc>
      <image:title>Recombinant Chicken Pro-epidermal growth factor (EGF), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-prrsv-hb-2-sh-2002-orf2b-structual-protein-partial-bhp10514171</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP5749GWO-SDS.jpg?v=1772280108</image:loc>
      <image:title>Recombinant PRRSV HB-2(sh)/2002 ORF2b structual protein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rabbit-b-0-and-type-amino-acid-transporter-1-slc7a9-partial-bhp10514128</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP889020RB-SDS.jpg?v=1772280023</image:loc>
      <image:title>Recombinant Rabbit B (0,+)-type amino acid transporter 1 (SLC7A9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-15-receptor-subunit-alpha-il15ra-partial-bhp10514163</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP614402HU-SDS.jpg?v=1772280111</image:loc>
      <image:title>Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-envelope-glycoprotein-gp350-bllf1-partial-bhp10514173</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP360986EFA-SDS.jpg?v=1772280053</image:loc>
      <image:title>Recombinant Epstein-Barr virus envelope glycoprotein GP350 (BLLF1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-3-ltbr-partial-active-bhp10514177</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP013227HU1-SDS.jpg?v=1772280037</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-cathepsin-z-ctsz-bhp10514181</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP006206RA-SDS.jpg?v=1772280041</image:loc>
      <image:title>Recombinant Rat Cathepsin Z(Ctsz)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-importin-subunit-beta-1-kpnb1-bhp10514139</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP622929HU_A4_-SDS.jpg?v=1772280097</image:loc>
      <image:title>Recombinant Human Importin subunit beta-1 (KPNB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-erythropoietin-receptor-epor-partial-bhp10514161</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP5769MOW-SDS.jpg?v=1772280089</image:loc>
      <image:title>Recombinant Macaca mulatta Erythropoietin receptor (EPOR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-chaperedoxin-cnox-bhp10514112</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP301231ENV-SDS.jpg?v=1772280057</image:loc>
      <image:title>Recombinant Escherichia coli Chaperedoxin (cnoX)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-necator-americanus-ancylostoma-secreted-protein-2-asp2-bhp10514183</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP3506GNW-SDS.jpg?v=1772280111</image:loc>
      <image:title>Recombinant Necator americanus Ancylostoma secreted protein 2 (ASP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chicken-fibroblast-growth-factor-1-fgf1-bhp10514169</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP008615CH-SDS.jpg?v=1772280050</image:loc>
      <image:title>Recombinant Chicken Fibroblast growth factor 1 (FGF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-metapneumovirus-major-surface-glycoprotein-g-g-partial-bhp10514141</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP754440HDAM1-SDS.jpg?v=1772280096</image:loc>
      <image:title>Recombinant Human metapneumovirus Major surface glycoprotein G (G), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hypoxia-inducible-factor-1-alpha-inhibitor-hif1an-bhp10514193</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP865160HUf0-SDS.jpg?v=1772280057</image:loc>
      <image:title>Recombinant Human Hypoxia-inducible factor 1-alpha inhibitor (HIF1AN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-carboxypeptidase-n-catalytic-chain-cpn1-bhp10514184</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP005898HU-SDS.jpg?v=1772280049</image:loc>
      <image:title>Recombinant Human Carboxypeptidase N catalytic chain (CPN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-sortase-a-srta-p94r-d160n-d165a-k190e-k196t-d124g-y187l-e189r-partial-bhp10514172</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP3093FLF-SDS.jpg?v=1772280111</image:loc>
      <image:title>Recombinant Staphylococcus aureus Sortase A (srtA) (P94R,D160N,D165A,K190E,K196T,D124G,Y187L,E189R), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-fibroblast-growth-factor-1-fgf1-bhp10514166</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP008615BO-SDS.jpg?v=1772280050</image:loc>
      <image:title>Recombinant Bovine Fibroblast growth factor 1 (FGF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-feline-herpesvirus-1-envelope-glycoprotein-d-us6-partial-bhp10514174</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP5353FAJ-SDS.jpg?v=1772280100</image:loc>
      <image:title>Recombinant Feline herpesvirus 1 Envelope glycoprotein D (US6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-horse-vascular-endothelial-growth-factor-a-vegfa-bhp10514180</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP025833HO-SDS.jpg?v=1772280042</image:loc>
      <image:title>Recombinant Horse Vascular endothelial growth factor A (VEGFA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cynomolgus-monkey-activin-receptor-type-2a-acvr2a-partial-active-bhp10514175</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP001260HU1-SDS.jpg?v=1772280043</image:loc>
      <image:title>Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cricetulus-griseus-elongation-factor-1-alpha-1-eef1a1-bhp10514195</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP007409DXU-SDS.jpg?v=1772280050</image:loc>
      <image:title>Recombinant Cricetulus griseus Elongation factor 1-alpha 1 (EEF1A1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-progonadoliberin-1-gnrh1-bhp10514189</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP009635RA-SDS.jpg?v=1772280049</image:loc>
      <image:title>Recombinant Rat Progonadoliberin-1(Gnrh1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-coronavirus-spike-glycoprotein-s-partial-bhp10514196</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP819726BJF-SDS.jpg?v=1772280053</image:loc>
      <image:title>Recombinant Bovine coronavirus Spike glycoprotein (S), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-ribonuclease-e-rne-partial-bhp10514187</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP324207ENV-SDS.jpg?v=1772280105</image:loc>
      <image:title>Recombinant Escherichia coli Ribonuclease E (rne), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-activin-receptor-type-2b-acvr2b-partial-active-bhp10514176</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP001261MO1-SDS.jpg?v=1772280045</image:loc>
      <image:title>Recombinant Mouse Activin receptor type-2B (Acvr2b), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-ganoderma-lucidum-immunomodulatory-protein-ling-zhi-8-bhp10514197</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP320455GAW-SDS.jpg?v=1772280056</image:loc>
      <image:title>Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-apelin-apln-partial-bhp10514203</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP001909RA1-SDS.jpg?v=1772280041</image:loc>
      <image:title>Recombinant Rat Apelin (Apln), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dendroaspis-angusticeps-natriuretic-peptide-dnp-bhp10514140</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP329805DBG-SDS.jpg?v=1772280095</image:loc>
      <image:title>Recombinant Dendroaspis angusticeps Natriuretic peptide DNP</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-seizure-6-like-protein-2-sez6l2-partial-bhp10514200</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP643717BO-SDS.jpg?v=1772280059</image:loc>
      <image:title>Recombinant Bovine Seizure 6-like protein 2 (SEZ6L2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-aldehyde-dehydrogenase-mitochondrial-aldh2-bhp10514188</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP001571RA-SDS.jpg?v=1772280109</image:loc>
      <image:title>Recombinant Rat Aldehyde dehydrogenase, mitochondrial (Aldh2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-enhancer-factor-tef-1-tead1-bhp10514186</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP023363HUe1-SDS.jpg?v=1772280042</image:loc>
      <image:title>Recombinant Human Transcriptional enhancer factor TEF-1 (TEAD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pro-neuregulin-1-membrane-bound-isoform-nrg1-partial-bhp10514179</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP016077HU2_F6_-SDS.jpg?v=1772280095</image:loc>
      <image:title>Recombinant Human Pro-neuregulin-1, membrane-bound isoform (NRG1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cyclin-dependent-kinase-inhibitor-1-cdkn1a-bhp10514190</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP005086MO-SDS.jpg?v=1772280048</image:loc>
      <image:title>Recombinant Mouse Cyclin-dependent kinase inhibitor 1 (Cdkn1a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-natriuretic-peptides-a-nppa-bhp10514205</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP016020MO-SDS.jpg?v=1772280051</image:loc>
      <image:title>Recombinant Mouse Natriuretic peptides A (Nppa)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mitogen-activated-protein-kinase-3-mapk3-bhp10514191</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP013456HU_A5_-SDS.jpg?v=1772280048</image:loc>
      <image:title>Recombinant Human Mitogen-activated protein kinase 3 (MAPK3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-canine-coronavirus-nucleoprotein-n-bhp10514182</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP745849CHAH-SDS.jpg?v=1772280049</image:loc>
      <image:title>Recombinant Canine coronavirus Nucleoprotein(N)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-zymogen-granule-membrane-protein-16-zg16-bhp10514178</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP807545RA-SDS.jpg?v=1772280103</image:loc>
      <image:title>Recombinant Rat Zymogen granule membrane protein 16 (Zg16)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-citrus-unshiu-limonoid-udp-glucosyltransferase-bhp10514201</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP888951DTR-SDS.jpg?v=1772280108</image:loc>
      <image:title>Recombinant Citrus unshiu Limonoid UDP-glucosyltransferase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-puccinia-triticina-secreted-protein-bhp10514198</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP3751GPC-SDS.jpg?v=1772280048</image:loc>
      <image:title>Recombinant Puccinia triticina Secreted protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-necator-americanus-ancylostoma-secreted-protein-2-asp2-bhp10514194</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP3506GNWf3-SDS.jpg?v=1772280116</image:loc>
      <image:title>Recombinant Necator americanus Ancylostoma secreted protein 2 (ASP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-trichoderma-harzianum-endo-1-4-beta-xylanase-bhp10514211</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP344161TKN-SDS.jpg?v=1772280053</image:loc>
      <image:title>Recombinant Trichoderma harzianum Endo-1,4-beta-xylanase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-junctional-cadherin-5-associated-protein-jcad-partial-bhp10514202</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP873729HU-SDS.jpg?v=1772280113</image:loc>
      <image:title>Recombinant Human Junctional cadherin 5-associated protein (JCAD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rotavirus-a-non-structural-glycoprotein-4-partial-bhp10514207</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP465285ROJa4-SDS.jpg?v=1772280054</image:loc>
      <image:title>Recombinant Rotavirus A Non-structural glycoprotein 4, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-pml-pml-partial-bhp10514192</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP018236HU-SDS.jpg?v=1772280053</image:loc>
      <image:title>Recombinant Human Protein PML (PML), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-signal-recognition-particle-subunit-srp54-srp54-bhp10514208</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP022675HU-SDS.jpg?v=1772280048</image:loc>
      <image:title>Recombinant Human Signal recognition particle subunit SRP54 (SRP54)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bromodomain-containing-protein-2-brd2-partial-bhp10514214</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP002800HU-SDS.jpg?v=1772280051</image:loc>
      <image:title>Recombinant Human Bromodomain-containing protein 2 (BRD2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-protein-bmrf2-bmrf2-partial-bhp10514206</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP365872EFA-SDS.jpg?v=1772280050</image:loc>
      <image:title>Recombinant Epstein-Barr virus Protein BMRF2 (BMRF2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-thymic-stromal-lymphopoietin-tslp-bhp10514168</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP5042MOV-SDS.jpg?v=1772280111</image:loc>
      <image:title>Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-zinc-finger-ccch-domain-containing-protein-14-zc3h14-bhp10514216</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP740793HU-SDS.jpg?v=1772280063</image:loc>
      <image:title>Recombinant Human Zinc finger CCCH domain-containing protein 14 (ZC3H14)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-collagen-alpha-1-xviii-chain-col18a1-partial-bhp10514213</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP005725HU4-SDS.jpg?v=1772280056</image:loc>
      <image:title>Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-pulmonary-surfactant-associated-protein-b-sftpb-bhp10514204</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP021173BOe1-SDS.jpg?v=1772280048</image:loc>
      <image:title>Recombinant Bovine Pulmonary surfactant-associated protein B (SFTPB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-herpesvirus-6a-immediate-early-protein-1-u90-u89-partial-bhp10514231</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP721301HJZ-SDS.jpg?v=1772280057</image:loc>
      <image:title>Recombinant Human herpesvirus 6A Immediate-early protein 1 (U90/U89), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neutrophil-elastase-elane-bhp10514224</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP007587HU-SDS.jpg?v=1772280056</image:loc>
      <image:title>Recombinant Human Neutrophil elastase (ELANE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bromodomain-containing-protein-4-brd4-partial-bhp10514209</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP002802HU3-SDS.jpg?v=1772280060</image:loc>
      <image:title>Recombinant Human Bromodomain-containing protein 4 (BRD4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lactotransferrin-ltf-bhp10514230</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP013229HU-SDS.jpg?v=1772280058</image:loc>
      <image:title>Recombinant Human Lactotransferrin (LTF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tetronarce-californica-acetylcholine-receptor-subunit-alpha-chrna1-partial-bhp10514220</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005386TOTc7-SDS.jpg?v=1772280054</image:loc>
      <image:title>Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bromodomain-containing-protein-4-brd4-partial-bhp10514212</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP002802HU3b0-SDS.jpg?v=1772280055</image:loc>
      <image:title>Recombinant Human Bromodomain-containing protein 4 (BRD4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cancer-testis-antigen-1-ctag1a-bhp10514218</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006125HUc7-SDS.jpg?v=1772280051</image:loc>
      <image:title>Recombinant Human Cancer/testis antigen 1 (CTAG1A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-islet-cell-autoantigen-1-ica1-bhp10514225</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP010947HU_A4_d7-SDS.jpg?v=1772280058</image:loc>
      <image:title>Recombinant Human Islet cell autoantigen 1 (ICA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-collagen-alpha-1-xviii-chain-col18a1-partial-bhp10514210</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP005725HU4c7-SDS.jpg?v=1772280044</image:loc>
      <image:title>Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cold-inducible-rna-binding-protein-cirbp-bhp10514219</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005440MOc7-SDS.jpg?v=1772280056</image:loc>
      <image:title>Recombinant Mouse Cold-inducible RNA-binding protein (Cirbp)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-1-acylglycerol-3-phosphate-o-acyltransferase-pnpla3-pnpla3-i148m-bhp10514221</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP889106HU_A4_M_c7-SDS.jpg?v=1772280116</image:loc>
      <image:title>Recombinant Human 1-acylglycerol-3-phosphate O-acyltransferase PNPLA3 (PNPLA3) (I148M)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-replication-atp-dependent-helicase-nuclease-dna2-dna2-partial-bhp10514233</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP006982HU-SDS.jpg?v=1772280056</image:loc>
      <image:title>Recombinant Human DNA replication ATP-dependent helicase/nuclease DNA2 (DNA2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-apis-mellifera-hyaluronidase-bhp10514199</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP3666DNK-SDS.jpg?v=1772280045</image:loc>
      <image:title>Recombinant Apis mellifera Hyaluronidase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-islet-cell-autoantigen-1-ica1-bhp10514222</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP010947HU_A4_-SDS.jpg?v=1772280055</image:loc>
      <image:title>Recombinant Human Islet cell autoantigen 1 (ICA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chlamydia-pneumoniae-large-cysteine-rich-periplasmic-protein-omcb-omcb-partial-bhp10514238</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP326426DRZd7-SDS.jpg?v=1772280058</image:loc>
      <image:title>Recombinant Chlamydia pneumoniae Large cysteine-rich periplasmic protein OmcB (omcB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tick-borne-encephalitis-virus-european-subtype-genome-polyprotein-partial-bhp10514223</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-caspase-3-casp3-bhp10514235</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP004548HU_A4_-SDS.jpg?v=1772280056</image:loc>
      <image:title>Recombinant Human Caspase-3(CASP3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tick-borne-encephalitis-virus-far-eastern-subtype-genome-polyprotein-partial-bhp10514226</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP357187TEN-SDS.jpg?v=1772280057</image:loc>
      <image:title>Recombinant Tick-borne encephalitis virus Far Eastern subtype Genome polyprotein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-influenza-a-virus-polymerase-basic-protein-2-pb2-bhp10514239</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP361051IFZ_A4_-SDS.jpg?v=1772280058</image:loc>
      <image:title>Recombinant Influenza A virus Polymerase basic protein 2 (PB2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lactotransferrin-ltf-bhp10514228</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP013229HUc7-SDS.jpg?v=1772280057</image:loc>
      <image:title>Recombinant Human Lactotransferrin (LTF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-origin-recognition-complex-subunit-1-orc1-partial-bhp10514242</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP621667HU3-SDS.jpg?v=1772280063</image:loc>
      <image:title>Recombinant Human Origin recognition complex subunit 1 (ORC1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bromodomain-containing-protein-2-brd2-partial-bhp10514215</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP002800HU1-SDS.jpg?v=1772280050</image:loc>
      <image:title>Recombinant Human Bromodomain-containing protein 2 (BRD2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tick-borne-encephalitis-virus-far-eastern-subtype-genome-polyprotein-partial-bhp10514229</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP357187TENd7-SDS.jpg?v=1772280067</image:loc>
      <image:title>Recombinant Tick-borne encephalitis virus Far Eastern subtype Genome polyprotein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-herpesvirus-6a-immediate-early-protein-1-u90-u89-partial-bhp10514234</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP721301HJZc7-SDS.jpg?v=1772280058</image:loc>
      <image:title>Recombinant Human herpesvirus 6A Immediate-early protein 1 (U90/U89), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-apis-mellifera-allergen-api-m-6-03-api-m-6-04-bhp10514244</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP307940DNK-SDS.jpg?v=1772280058</image:loc>
      <image:title>Recombinant Apis mellifera Allergen Api m 6.03 / Api m 6.04</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-replication-protein-a-32-kda-subunit-rpa2-partial-bhp10514232</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP020089HU1-SDS.jpg?v=1772280054</image:loc>
      <image:title>Recombinant Human Replication protein A 32 kDa subunit (RPA2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-follicle-stimulating-hormone-receptor-fshr-partial-bhp10514217</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009021HUc7-SDS.jpg?v=1772280051</image:loc>
      <image:title>Recombinant Human Follicle-stimulating hormone receptor (FSHR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-wnt-5a-wnt5a-bhp10514248</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP026138HU-SDS.jpg?v=1772280058</image:loc>
      <image:title>Recombinant Human Protein Wnt-5a (WNT5A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-h19b-shiga-like-toxin-1-subunit-b-stxb-bhp10514251</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP300809EKZ-SDS.jpg?v=1772280058</image:loc>
      <image:title>Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-threonine-protein-phosphatase-pgam5-mitochondrial-pgam5-partial-bhp10514243</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP839338HU-SDS.jpg?v=1772280058</image:loc>
      <image:title>Recombinant Human Serine/threonine-protein phosphatase PGAM5, mitochondrial (PGAM5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-origin-recognition-complex-subunit-1-orc1-partial-bhp10514241</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP621667HU2-SDS.jpg?v=1772280066</image:loc>
      <image:title>Recombinant Human Origin recognition complex subunit 1 (ORC1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-apis-mellifera-venom-serine-protease-34-bhp10514245</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP847592DNK-SDS.jpg?v=1772280064</image:loc>
      <image:title>Recombinant Apis mellifera Venom serine protease 34</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-integrin-alpha-x-itgax-partial-bhp10514249</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP874106MO1p1-SDS.jpg?v=1772280066</image:loc>
      <image:title>Recombinant Mouse Integrin alpha-X (Itgax), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tick-borne-encephalitis-virus-european-subtype-genome-polyprotein-partial-bhp10514227</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP318509TEMd7-SDS.jpg?v=1772280056</image:loc>
      <image:title>Recombinant Tick-borne encephalitis virus European subtype Genome polyprotein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-apis-mellifera-venom-acid-phosphatase-acph-1-bhp10514247</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP710683DNK-SDS.jpg?v=1772280065</image:loc>
      <image:title>Recombinant Apis mellifera Venom acid phosphatase Acph-1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chlamydia-pneumoniae-large-cysteine-rich-periplasmic-protein-omcb-omcb-partial-bhp10514236</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP326426DRZ-SDS.jpg?v=1772280058</image:loc>
      <image:title>Recombinant Chlamydia pneumoniae Large cysteine-rich periplasmic protein OmcB(omcB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-herpesvirus-1-capsid-vertex-component-1-cvc1-partial-bhp10514237</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP320621HWY-SDS.jpg?v=1772280061</image:loc>
      <image:title>Recombinant Human herpesvirus 1 Capsid vertex component 1 (CVC1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lysosomal-acid-glucosylceramidase-gba1-bhp10514255</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP009289HUd7-SDS.jpg?v=1772280059</image:loc>
      <image:title>Recombinant Human Lysosomal acid glucosylceramidase (GBA1 )</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-thermotoga-maritima-pseudouridine-5-phosphate-glycosidase-psug-bhp10514246</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP895816TNJ-SDS.jpg?v=1772280059</image:loc>
      <image:title>Recombinant Thermotoga maritima Pseudouridine-5&apos;-phosphate glycosidase (psuG)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-phage-933w-shiga-like-toxin-2-subunit-b-stxb2-bhp10514253</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP357663ECCc7-SDS.jpg?v=1772280060</image:loc>
      <image:title>Recombinant Escherichia phage 933W Shiga-like toxin 2 subunit B (stxB2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-origin-recognition-complex-subunit-1-orc1-partial-bhp10514240</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP621667HU1-SDS.jpg?v=1772280058</image:loc>
      <image:title>Recombinant Human Origin recognition complex subunit 1 (ORC1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-1-acylglycerol-3-phosphate-o-acyltransferase-pnpla3-pnpla3-i148m-bhp10514250</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP889106HU_A4_M_d7-SDS.jpg?v=1772280060</image:loc>
      <image:title>Recombinant Human 1-acylglycerol-3-phosphate O-acyltransferase PNPLA3 (PNPLA3) (I148M)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-semaphorin-3c-sema3c-bhp10514265</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP720289MO-SDS.jpg?v=1772280066</image:loc>
      <image:title>Recombinant Mouse Semaphorin-3C (Sema3c)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-phage-933w-shiga-like-toxin-2-subunit-b-stxb2-bhp10514252</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP357663ECC-SDS.jpg?v=1772280060</image:loc>
      <image:title>Recombinant Escherichia phage 933W Shiga-like toxin 2 subunit B (stxB2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-bifunctional-3-5-exonuclease-atp-dependent-helicase-wrn-wrn-partial-bhp10514259</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP026149MO4-SDS.jpg?v=1772280063</image:loc>
      <image:title>Recombinant Mouse Bifunctional 3&apos;-5&apos; exonuclease/ATP-dependent helicase WRN (Wrn), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-serine-threonine-protein-kinase-wnk3-wnk3-partial-bhp10514258</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP800360MO-SDS.jpg?v=1772280065</image:loc>
      <image:title>Recombinant Mouse Serine/threonine-protein kinase WNK3 (Wnk3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-mono-adp-ribosyltransferase-parp16-parp16-partial-bhp10514264</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP836673HU-SDS.jpg?v=1772280064</image:loc>
      <image:title>Recombinant Human Protein mono-ADP-ribosyltransferase PARP16 (PARP16), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neurogenic-differentiation-factor-1-neurod1-h115a-bhp10514271</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP720182MO_M2_-SDS.jpg?v=1772280066</image:loc>
      <image:title>Recombinant Mouse Neurogenic differentiation factor 1 (Neurod1)(H115A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lysozyme-c-lyz-bhp10514254</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP013283HU-SDS.jpg?v=1772280059</image:loc>
      <image:title>Recombinant Human Lysozyme C (LYZ)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-trim11-trim11-bhp10514274</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP856931HU_A4_-SDS.jpg?v=1772280068</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase TRIM11 (TRIM11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-topoisomerase-1-top1-bhp10514267</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP024056HU-SDS.jpg?v=1772280067</image:loc>
      <image:title>Recombinant Human DNA topoisomerase 1 (TOP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-putative-phospholipase-b-like-2-plbd2-bhp10514256</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP663623MOc7-SDS.jpg?v=1772280063</image:loc>
      <image:title>Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-coiled-coil-domain-containing-protein-112-ccdc112-bhp10514262</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP818774HU-SDS.jpg?v=1772280062</image:loc>
      <image:title>Recombinant Human Coiled-coil domain-containing protein 112 (CCDC112 )</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ubiquitin-like-modifier-activating-enzyme-6-uba6-partial-bhp10514257</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP025420HUe0-SDS.jpg?v=1772280063</image:loc>
      <image:title>Recombinant Human Ubiquitin-like modifier-activating enzyme 6(UBA6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-desmoglein-1-dsg1-partial-bhp10514269</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP861938HU-SDS.jpg?v=1772280066</image:loc>
      <image:title>Recombinant Human Desmoglein-1 (DSG1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-collagen-and-calcium-binding-egf-domain-containing-protein-1-ccbe1-partial-bhp10514281</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP747637HU1-SDS.jpg?v=1772280068</image:loc>
      <image:title>Recombinant Human Collagen and calcium-binding EGF domain-containing protein 1 (CCBE1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-interleukin-11-il11-bhp10514270</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP859561RA-SDS.jpg?v=1772280065</image:loc>
      <image:title>Recombinant Rat Interleukin-11 (Il11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-protease-1-prss1-bhp10514272</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP018811HU-SDS.jpg?v=1772280067</image:loc>
      <image:title>Recombinant Human Serine protease 1 (PRSS1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-glycerol-3-phosphate-dehydrogenase-nad-and-cytoplasmic-gpd1-bhp10514278</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009709MO-SDS.jpg?v=1772280067</image:loc>
      <image:title>Recombinant Mouse Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic (Gpd1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pulmonary-surfactant-associated-protein-a2-sftpa2-partial-bhp10514289</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP815565HU2-SDS.jpg?v=1772280071</image:loc>
      <image:title>Recombinant Human Pulmonary surfactant-associated protein A2 (SFTPA2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-guanine-nucleotide-binding-protein-g-i-subunit-alpha-1-gnai1-bhp10514268</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP009588HU-SDS.jpg?v=1772280069</image:loc>
      <image:title>Recombinant Human Guanine nucleotide-binding protein G(i) subunit alpha-1 (GNAI1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-putative-phospholipase-b-like-2-plbd2-bhp10514263</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP663623MO-SDS.jpg?v=1772280064</image:loc>
      <image:title>Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nuclear-body-protein-sp140-like-protein-sp140l-bhp10514275</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP875697HU-SDS.jpg?v=1772280067</image:loc>
      <image:title>Recombinant Human Nuclear body protein SP140-like protein (SP140L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tnf-receptor-associated-factor-3-traf3-bhp10514261</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP024148HU-SDS.jpg?v=1772280060</image:loc>
      <image:title>Recombinant Human TNF receptor-associated factor 3 (TRAF3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macrovipera-lebetina-chymotrypsin-like-protease-vlctlp-bhp10514279</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP522192MPJh8-SDS.jpg?v=1772280069</image:loc>
      <image:title>Recombinant Macrovipera lebetina Chymotrypsin-like protease VLCTLP</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vascular-endothelial-growth-factor-receptor-2-kdr-partial-active-bhp10514280</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012145HU-SDS.jpg?v=1772280067</image:loc>
      <image:title>Recombinant Human Vascular endothelial growth factor receptor 2 (KDR), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-suppressor-of-cytokine-signaling-6-socs6-bhp10514273</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP022395HU-SDS.jpg?v=1772280065</image:loc>
      <image:title>Recombinant Human Suppressor of cytokine signaling 6 (SOCS6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-beta-nerve-growth-factor-ngf-bhp10514297</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015779RA_A4_-SDS.jpg?v=1772280073</image:loc>
      <image:title>Recombinant Rat Beta-nerve growth factor (Ngf)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-crimean-congo-hemorrhagic-fever-virus-envelopment-polyprotein-gp-partial-active-bhp10514313</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP810349CSC2-SDS.jpg?v=1772280072</image:loc>
      <image:title>Recombinant Crimean-Congo hemorrhagic fever virus Envelopment polyprotein (GP), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-anguilla-japonica-ventricular-natriuretic-peptide-vnp-bhp10514292</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP329334BZH-SDS.jpg?v=1772280071</image:loc>
      <image:title>Recombinant Anguilla japonica Ventricular natriuretic peptide (vnp)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ubiquitin-like-modifier-activating-enzyme-6-uba6-partial-bhp10514260</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP025420HU-SDS.jpg?v=1772280064</image:loc>
      <image:title>Recombinant Human Ubiquitin-like modifier-activating enzyme 6 (UBA6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-guanine-nucleotide-binding-protein-g-q-subunit-alpha-gnaq-bhp10514266</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP342271HU-SDS.jpg?v=1772280067</image:loc>
      <image:title>Recombinant Human Guanine nucleotide-binding protein G(q) subunit alpha (GNAQ)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-importin-subunit-alpha-1-kpna2-bhp10514288</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012484HU-SDS.jpg?v=1772280069</image:loc>
      <image:title>Recombinant Human Importin subunit alpha-1 (KPNA2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mammaglobin-b-scgb2a1-bhp10514282</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP020816HU-SDS.jpg?v=1772280070</image:loc>
      <image:title>Recombinant Human Mammaglobin-B (SCGB2A1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-myocilin-myoc-bhp10514293</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP774701MOV-SDS.jpg?v=1772280073</image:loc>
      <image:title>Recombinant Macaca fascicularis Myocilin (MYOC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-newcastle-disease-virus-hemagglutinin-neuraminidase-hn-partial-bhp10514294</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP334020NCU1-SDS.jpg?v=1772280072</image:loc>
      <image:title>Recombinant Newcastle disease virus Hemagglutinin-neuraminidase (HN), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-uncharacterized-protein-c1orf54-homolog-bhp10514291</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP848110MOd7-SDS.jpg?v=1772280072</image:loc>
      <image:title>Recombinant Mouse Uncharacterized protein C1orf54 homolog</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-activin-beta-c-chain-partial-bhp10514305</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5873MOV-SDS.jpg?v=1772280072</image:loc>
      <image:title>Recombinant Macaca fascicularis Activin beta-C chain, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-porcine-epidemic-diarrhea-virus-spike-glycoprotein-s-partial-bhp10514301</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5982GRQ3-SDS.jpg?v=1772280072</image:loc>
      <image:title>Recombinant Porcine epidemic diarrhea virus Spike glycoprotein (S), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-complement-factor-b-cfb-bhp10514303</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005268MO-SDS.jpg?v=1772280073</image:loc>
      <image:title>Recombinant Mouse Complement factor B (Cfb)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-fibroblast-growth-factor-23-fgf23-r174q-bhp10514285</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5514CA_A4_M_-SDS.jpg?v=1772280068</image:loc>
      <image:title>Recombinant Cat Fibroblast growth factor 23 (FGF23) (R174Q)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-inhibin-subunit-beta-e-inhbe-partial-bhp10514304</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5872MOV-SDS.jpg?v=1772280076</image:loc>
      <image:title>Recombinant Macaca fascicularis Inhibin subunit beta E (INHBE), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/virus-like-particles-vlps-isotype-control-bhp10514312</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-high-mobility-group-protein-b1-hmgb1-partial-bhp10514315</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP010553HU1-SDS.jpg?v=1772280076</image:loc>
      <image:title>Recombinant Human High mobility group protein B1 (HMGB1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-inhibin-beta-e-chain-inhbe-bhp10514306</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011722MO-SDS.jpg?v=1772280073</image:loc>
      <image:title>Recombinant Mouse Inhibin beta E chain (Inhbe)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-caprin-1-caprin1-bhp10514295</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP614529HU-SDS.jpg?v=1772280073</image:loc>
      <image:title>Recombinant Human Caprin-1 (CAPRIN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-fatty-acid-binding-protein-adipocyte-fabp4-bhp10514283</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007945MO-SDS.jpg?v=1772280067</image:loc>
      <image:title>Recombinant Mouse Fatty acid-binding protein, adipocyte (Fabp4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-coiled-coil-domain-containing-112-ccdc112-bhp10514286</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5684RA-SDS.jpg?v=1772280070</image:loc>
      <image:title>Recombinant Rat Coiled-coil domain containing 112 (Ccdc112)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-gamma-synuclein-sncg-bhp10514277</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5197MO-SDS.jpg?v=1772280067</image:loc>
      <image:title>Recombinant Mouse Gamma-synuclein (Sncg)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-carboxypeptidase-n-subunit-2-cpn2-bhp10514287</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005899HU-SDS.jpg?v=1772280068</image:loc>
      <image:title>Recombinant Human Carboxypeptidase N subunit 2 (CPN2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-klotho-kl-partial-bhp10514284</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012377RA-SDS.jpg?v=1772280070</image:loc>
      <image:title>Recombinant Rat Klotho (Kl), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interferon-alpha-4-ifna4-bhp10514327</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011040MO-SDS.jpg?v=1772280080</image:loc>
      <image:title>Recombinant Mouse Interferon alpha-4 (Ifna4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-parathyroid-hormone-parathyroid-hormone-related-peptide-receptor-pth1r-partial-active-bhp10514296</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP018988MOV4-SDS.jpg?v=1772280072</image:loc>
      <image:title>Recombinant Macaca fascicularis Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-ubiquitin-carboxyl-terminal-hydrolase-isozyme-l1-uchl1-partial-bhp10514331</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP713942MOV-SDS.jpg?v=1772280082</image:loc>
      <image:title>Recombinant Macaca fascicularis Ubiquitin carboxyl-terminal hydrolase isozyme L1(UCHL1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-coagulation-factor-xi-f11-active-bhp10514302</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007916HU_A4_-SDS.jpg?v=1772280072</image:loc>
      <image:title>Recombinant Human Coagulation factor XI (F11) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-aldo-keto-reductase-family-1-member-a1-akr1a1-bhp10514276</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP878064MO-SDS.jpg?v=1772280067</image:loc>
      <image:title>Recombinant Mouse Aldo-keto reductase family 1 member A1 (Akr1a1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-metapneumovirus-major-surface-glycoprotein-g-g-partial-bhp10514290</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP754440HDAM1-SDS.jpg?v=1772280072</image:loc>
      <image:title>Recombinant Human metapneumovirus Major surface glycoprotein G (G), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-programmed-cell-death-1-ligand-2-pdcd1lg2-partial-bhp10514319</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017667HU1-SDS.jpg?v=1772280079</image:loc>
      <image:title>Recombinant Human Programmed cell death 1 ligand 2 (PDCD1LG2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/virus-like-particles-vlps-isotype-control-egfp-fluorescent-bhp10514323</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-ligand-superfamily-member-9-tnfsf9-partial-bhp10514338</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023997HU1a0-SDS.jpg?v=1772280083</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytotoxic-and-regulatory-t-cell-molecule-crtam-partial-bhp10514333</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005998HU1-SDS.jpg?v=1772280082</image:loc>
      <image:title>Recombinant Human Cytotoxic and regulatory T-cell molecule (CRTAM), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-angiotensin-converting-enzyme-2-ace2-partial-bhp10514342</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP866317HUb0-SDS.jpg?v=1772280081</image:loc>
      <image:title>Recombinant Human Angiotensin-converting enzyme 2 (ACE2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-semenogelin-2-semg2-bhp10514328</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021002HU-SDS.jpg?v=1772280081</image:loc>
      <image:title>Recombinant Human Semenogelin-2 (SEMG2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-semenogelin-1-semg1-bhp10514329</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021001HU_F1_-SDS.jpg?v=1772280082</image:loc>
      <image:title>Recombinant Human Semenogelin-1 (SEMG1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-membrane-cofactor-protein-cd46-partial-biotinylated-bhp10514344</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004939HU-B-SDS.jpg?v=1772280085</image:loc>
      <image:title>Recombinant Human Membrane cofactor protein (CD46), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-pulmonary-surfactant-associated-protein-a-sftpa1-bhp10514320</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021168RA-SDS.jpg?v=1772280079</image:loc>
      <image:title>Recombinant Rat Pulmonary surfactant-associated protein A (Sftpa1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mucin-1-muc1-partial-bhp10514314</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015215HU2-SDS.jpg?v=1772280076</image:loc>
      <image:title>Recombinant Human Mucin-1 (MUC1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-mono-adp-ribosyltransferase-parp16-parp16-partial-bhp10514345</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP836673HU-SDS.jpg?v=1772280085</image:loc>
      <image:title>Recombinant Human Protein mono-ADP-ribosyltransferase PARP16 (PARP16), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cathepsin-l2-ctsv-bhp10514317</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006194HUc7-SDS.jpg?v=1772280075</image:loc>
      <image:title>Recombinant Human Cathepsin L2 (CTSV)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ectonucleotide-pyrophosphatase-phosphodiesterase-family-member-3-enpp3-partial-active-bhp10514324</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007681HUb0-SDS.jpg?v=1772280077</image:loc>
      <image:title>Recombinant Human Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 (ENPP3), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-coronavirus-nl63-spike-glycoprotein-s-partial-bhp10514318</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP747509HIX2-SDS.jpg?v=1772280075</image:loc>
      <image:title>Recombinant Human coronavirus NL63 Spike glycoprotein (S), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cd226-antigen-cd226-partial-biotinylated-bhp10514355</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP618996HU-B-SDS.jpg?v=1772280087</image:loc>
      <image:title>Recombinant Human CD226 antigen (CD226), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-caveolin-3-cav3-bhp10514347</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004573MO-SDS.jpg?v=1772280085</image:loc>
      <image:title>Recombinant Mouse Caveolin-3 (Cav3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-metamycoplasma-hominis-arginine-deiminase-arca-p210s-bhp10514337</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP334815MLO_M_-SDS.jpg?v=1772280081</image:loc>
      <image:title>Recombinant Metamycoplasma hominis Arginine deiminase (arcA) (P210S)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cell-adhesion-molecule-1-cadm1-partial-bhp10514343</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004425HUd9-SDS.jpg?v=1772280083</image:loc>
      <image:title>Recombinant Human Cell adhesion molecule 1 (CADM1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-gastric-inhibitory-polypeptide-receptor-gipr-partial-bhp10514335</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP4825MOV-SDS.jpg?v=1772280080</image:loc>
      <image:title>Recombinant Macaca fascicularis Gastric inhibitory polypeptide receptor (GIPR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytochrome-b5-type-b-cyb5b-partial-bhp10514358</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006310HU1-SDS.jpg?v=1772280086</image:loc>
      <image:title>Recombinant Human Cytochrome b5 type B (CYB5B), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-butyrophilin-like-protein-2-btnl2-partial-bhp10514330</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP883443HUj8-SDS.jpg?v=1772280082</image:loc>
      <image:title>Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macacaf-scicularis-erythropoietin-receptor-epor-partial-bhp10514366</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP3538MOV-SDS.jpg?v=1772280085</image:loc>
      <image:title>Recombinant Macacaf scicularis Erythropoietin receptor (EPOR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-ligand-superfamily-member-4-tnfsf4-partial-bhp10514369</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023994HU1-SDS.jpg?v=1772280089</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mesothelin-like-protein-mslnl-partial-bhp10514325</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP853447HU1-SDS.jpg?v=1772280077</image:loc>
      <image:title>Recombinant Human Mesothelin-like protein (MSLNL), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-caveolin-3-cav3-bhp10514348</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP671371PI-SDS.jpg?v=1772280082</image:loc>
      <image:title>Recombinant Pig Caveolin-3 (CAV3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-signal-regulatory-protein-gamma-sirpg-partial-bhp10514354</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021338HU-SDS.jpg?v=1772280083</image:loc>
      <image:title>Recombinant Human Signal-regulatory protein gamma (SIRPG), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-granulocyte-macrophage-colony-stimulating-factor-receptor-subunit-alpha-csf2ra-partial-bhp10514346</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006046HU-SDS.jpg?v=1772280084</image:loc>
      <image:title>Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-mannan-binding-lectin-serine-protease-2-masp2-bhp10514362</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP856307MO-SDS.jpg?v=1772280084</image:loc>
      <image:title>Recombinant Mouse Mannan-binding lectin serine protease 2 (Masp2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calcitonin-gene-related-peptide-1-calca-partial-bhp10514370</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP153444HU-SDS.jpg?v=1772280086</image:loc>
      <image:title>Recombinant Human Calcitonin gene-related peptide 1 (CALCA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-porcine-reproductive-and-respiratory-syndrome-viru-glycoprotein-2a-gp2a-partial-bhp10514349</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP367568PYZ1-SDS.jpg?v=1772280083</image:loc>
      <image:title>Recombinant Porcine reproductive and respiratory syndrome viru Glycoprotein 2a (GP2a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-heat-stable-enterotoxin-receptor-gucy2c-partial-bhp10514322</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP3779MOV-SDS.jpg?v=1772280077</image:loc>
      <image:title>Recombinant Macaca fascicularis Heat-stable enterotoxin receptor (GUCY2C), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hepatocyte-growth-factor-receptor-met-partial-active-bhp10514365</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013714HUc7-SDS.jpg?v=1772280084</image:loc>
      <image:title>Recombinant Human Hepatocyte growth factor receptor (MET), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-natural-killer-cells-antigen-cd94-klrd1-partial-bhp10514316</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP615672HU-SDS.jpg?v=1772280078</image:loc>
      <image:title>Recombinant Human Natural killer cells antigen CD94 (KLRD1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-secreted-and-transmembrane-protein-1-sectm1-partial-biotinylated-bhp10514368</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP819898HU-B-SDS.jpg?v=1772280086</image:loc>
      <image:title>Recombinant Human Secreted and transmembrane protein 1 (SECTM1), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hyaluronidase-ph-20-spam1-partial-bhp10514378</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022471HU1-SDS.jpg?v=1772280086</image:loc>
      <image:title>Recombinant Human Hyaluronidase PH-20 (SPAM1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-phospholipid-transfer-protein-pltp-bhp10514371</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP018212MO-SDS.jpg?v=1772280085</image:loc>
      <image:title>Recombinant Mouse Phospholipid transfer protein (Pltp)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-icos-ligand-icoslg-partial-biotinylated-bhp10514356</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP010958HU1-B-SDS.jpg?v=1772280083</image:loc>
      <image:title>Recombinant Human ICOS ligand (ICOSLG), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leukemia-inhibitory-factor-receptor-lifr-partial-bhp10514379</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012929HU-SDS.jpg?v=1772280092</image:loc>
      <image:title>Recombinant Human Leukemia inhibitory factor receptor (LIFR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-ubiquitin-carboxyl-terminal-hydrolase-isozyme-l1-uchl1-bhp10514367</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP747573PI-SDS.jpg?v=1772280085</image:loc>
      <image:title>Recombinant Pig Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCHL1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibulin-1-fbln1-bhp10514382</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008452HU-SDS.jpg?v=1772280090</image:loc>
      <image:title>Recombinant Human Fibulin-1 (FBLN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-angiopoietin-related-protein-6-angptl6-bhp10514383</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP822824HU-SDS.jpg?v=1772280092</image:loc>
      <image:title>Recombinant Human Angiopoietin-related protein 6 (ANGPTL6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-zinc-finger-protein-410-znf410-bhp10514360</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP026730HU-SDS.jpg?v=1772280083</image:loc>
      <image:title>Recombinant Human Zinc finger protein 410 (ZNF410)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-thyrotropin-subunit-beta-tshb-partial-bhp10514389</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP025130MO-SDS.jpg?v=1772280092</image:loc>
      <image:title>Recombinant Mouse Thyrotropin subunit beta（Tshb), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calcitonin-gene-related-peptide-1-calca-partial-bhp10514374</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP153444HUh8-SDS.jpg?v=1772280087</image:loc>
      <image:title>Recombinant Human Calcitonin gene-related peptide 1 (CALCA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-dihydrolipoyllysine-residue-acetyltransferase-component-of-pyruvate-dehydrogenase-complex-mitochondrial-dlat-bhp10514391</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP804374MOe1-SDS.jpg?v=1772280091</image:loc>
      <image:title>Recombinant Mouse Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (Dlat)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-gibbon-ape-leukemia-virus-envelope-glycoprotein-env-partial-bhp10514363</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP321953GCA-SDS.jpg?v=1772280083</image:loc>
      <image:title>Recombinant Gibbon ape leukemia virus Envelope glycoprotein (env) , partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-butyrophilin-like-protein-2-btnl2-partial-bhp10514384</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP883443HU_M_d9-SDS.jpg?v=1772280090</image:loc>
      <image:title>Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-ligand-superfamily-member-4-tnfsf4-partial-biotinylated-bhp10514376</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023994HU1-B-SDS.jpg?v=1772280088</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-erythropoietin-receptor-epor-partial-bhp10514377</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007744MO1-SDS.jpg?v=1772280087</image:loc>
      <image:title>Recombinant Mouse Erythropoietin receptor (Epor), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-inhibin-beta-c-chain-inhbc-bhp10514397</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP896246RA-SDS.jpg?v=1772280091</image:loc>
      <image:title>Recombinant Rat Inhibin beta C chain (Inhbc)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transforming-growth-factor-beta-1-proprotein-tgfb1-bhp10514380</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023446HU_A4_-SDS.jpg?v=1772280087</image:loc>
      <image:title>Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-8-tnfrsf8-partial-bhp10514375</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023983HU1h6-SDS.jpg?v=1772280090</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 8(TNFRSF8), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-peptidylglycine-alpha-amidating-monooxygenase-pam-partial-bhp10514393</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017417RA-SDS.jpg?v=1772280089</image:loc>
      <image:title>Recombinant Rat Peptidylglycine alpha-amidating monooxygenase (Pam), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mitofusin-2-mfn2-partial-bhp10514386</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013756HU1-SDS.jpg?v=1772280087</image:loc>
      <image:title>Recombinant Human Mitofusin-2 (MFN2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-interleukin-11-il11-bhp10514392</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP859561RAb0-SDS.jpg?v=1772280091</image:loc>
      <image:title>Recombinant Rat Interleukin-11 (Il11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-mono-adp-ribosyltransferase-parp14-parp14-partial-bhp10514395</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP677190HU2-SDS.jpg?v=1772280092</image:loc>
      <image:title>Recombinant Human Protein mono-ADP-ribosyltransferase PARP14 (PARP14), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-4-il4-active-bhp10514400</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011659HUd7-SDS.jpg?v=1772280091</image:loc>
      <image:title>Recombinant Human Interleukin-4 (IL4) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-urocortin-2-ucn2-partial-bhp10514385</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP822298HU-SDS.jpg?v=1772280089</image:loc>
      <image:title>Recombinant Human Urocortin-2 (UCN2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-somatotropin-gh1-bhp10514390</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009407HUh8-SDS.jpg?v=1772280091</image:loc>
      <image:title>Recombinant Human Somatotropin (GH1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-cadherin-1-cdh1-partial-active-bhp10514398</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5601MOV-SDS.jpg?v=1772280094</image:loc>
      <image:title>Recombinant Macaca fascicularis Cadherin-1 (CDH1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cartilage-acidic-protein-1-crtac1-partial-bhp10514381</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005997MO1-SDS.jpg?v=1772280088</image:loc>
      <image:title>Recombinant Mouse Cartilage acidic protein 1 (Crtac1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leukocyte-surface-antigen-cd47-cd47-partial-active-bhp10514396</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004940HUd7-SDS.jpg?v=1772280091</image:loc>
      <image:title>Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-calcitonin-gene-related-peptide-1-calca-partial-bhp10514373</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP859124MO-SDS.jpg?v=1772280086</image:loc>
      <image:title>Recombinant Mouse Calcitonin gene-related peptide 1 (Calca), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-transporter-ppe51-ppe51-bhp10514404</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP745262GKB-SDS.jpg?v=1772280094</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis Transporter PPE51 (PPE51)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-inositol-1-4-5-trisphosphate-receptor-interacting-protein-like-1-itpripl1-partial-active-bhp10514401</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP756966HU-SDS.jpg?v=1772280094</image:loc>
      <image:title>Recombinant Human Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cysteine-and-glycine-rich-protein-2-csrp2-bhp10514411</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006084HU-SDS.jpg?v=1772280097</image:loc>
      <image:title>Recombinant Human Cysteine and glycine-rich protein 2 (CSRP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-alteromonas-macleodii-iota-carrageenase-cgia-bhp10514410</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP884193ALAX-SDS.jpg?v=1772280096</image:loc>
      <image:title>Recombinant Alteromonas macleodii Iota-carrageenase (cgiA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-cytoplasmic-trehalase-tref-bhp10514417</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6077ENRc7-SDS.jpg?v=1772280096</image:loc>
      <image:title>Recombinant Escherichia coli Cytoplasmic trehalase (treF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hyaluronidase-ph-20-spam1-bhp10514387</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022471HU-SDS.jpg?v=1772280090</image:loc>
      <image:title>Recombinant Human Hyaluronidase PH-20 (SPAM1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-peptidylglycine-alpha-amidating-monooxygenase-pam-partial-bhp10514394</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017417RAn1-SDS.jpg?v=1772280090</image:loc>
      <image:title>Recombinant Rat Peptidylglycine alpha-amidating monooxygenase (Pam), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-retinoblastoma-associated-protein-rb1-partial-bhp10514418</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP019386HU2-SDS.jpg?v=1772280096</image:loc>
      <image:title>Recombinant Human Retinoblastoma-associated protein (RB1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-glutamine-synthetase-chloroplastic-mitochondrial-gln2-bhp10514412</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP674854DOA-SDS.jpg?v=1772280094</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Glutamine synthetase, chloroplastic/mitochondrial (GLN2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o157-h7-uncharacterized-protein-yqgb-yqgb-bhp10514408</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP353135EOD-SDS.jpg?v=1772280096</image:loc>
      <image:title>Recombinant Escherichia coli O157:H7 Uncharacterized protein yqgB (yqgB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacillus-subtilis-penicillin-binding-protein-3-pbpc-partial-bhp10514407</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP331705BRJ1-SDS.jpg?v=1772280094</image:loc>
      <image:title>Recombinant Bacillus subtilis Penicillin-binding protein 3 (pbpC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-ligand-superfamily-member-4-tnfsf4-partial-bhp10514372</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023994HU1c9-SDS.jpg?v=1772280086</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-adenylate-cyclase-type-10-adcy10-partial-bhp10514403</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP804898MO-SDS.jpg?v=1772280091</image:loc>
      <image:title>Recombinant Mouse Adenylate cyclase type 10 (Adcy10), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-arginine-deiminase-type-1-padi1-bhp10514409</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP891543HUc7-SDS.jpg?v=1772280099</image:loc>
      <image:title>Recombinant Human Protein-arginine deiminase type-1 (PADI1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-filaggrin-flg-partial-bhp10514414</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008712HU2-SDS.jpg?v=1772280096</image:loc>
      <image:title>Recombinant Human Filaggrin (FLG), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-erythropoietin-epo-active-bhp10514399</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007743HU-SDS.jpg?v=1772280091</image:loc>
      <image:title>Recombinant Human Erythropoietin (EPO) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-astrotactin-1-astn1-partial-bhp10514420</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002251HU-SDS.jpg?v=1772280096</image:loc>
      <image:title>Recombinant Human Astrotactin-1 (ASTN1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-chondroitin-sulfate-proteoglycan-5-cspg5-partial-bhp10514405</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP866833RA-SDS.jpg?v=1772280095</image:loc>
      <image:title>Recombinant Rat Chondroitin sulfate proteoglycan 5 (Cspg5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sorbitol-dehydrogenase-sord-bhp10514421</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022410MO-SDS.jpg?v=1772280097</image:loc>
      <image:title>Recombinant Mouse Sorbitol dehydrogenase (Sord)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-proliferation-marker-protein-ki-67-mki67-partial-bhp10514415</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP014597HU1-SDS.jpg?v=1772280094</image:loc>
      <image:title>Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-mimecan-ogn-bhp10514431</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP733811MO-SDS.jpg?v=1772280115</image:loc>
      <image:title>Recombinant Mouse Mimecan (Ogn)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-uracil-phosphoribosyltransferase-upp-bhp10514413</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP404542MON-SDS.jpg?v=1772280096</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis Uracil phosphoribosyltransferase (upp)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-alpha-defensin-24-defa24-bhp10514426</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP685929MO-SDS.jpg?v=1772280096</image:loc>
      <image:title>Recombinant Mouse Alpha-defensin 24 (Defa24)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-oryza-sativa-subsp-japonica-jasmonoyl-l-amino-acid-synthetase-gh3-5-gh3-5-bhp10514406</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP743555OFG-SDS.jpg?v=1772280094</image:loc>
      <image:title>Recombinant Oryza sativa subsp. japonica Jasmonoyl--L-amino acid synthetase GH3.5 (GH3.5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-alpha-crystallin-a-chain-cryaa-bhp10514429</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006007RA-SDS.jpg?v=1772280097</image:loc>
      <image:title>Recombinant Rat Alpha-crystallin A chain (Cryaa)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-francisella-tularensis-subsp-holarctica-chaperonin-groel-groel-partial-bhp10514432</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP311342FCO-SDS.jpg?v=1772280097</image:loc>
      <image:title>Recombinant Francisella tularensis subsp. holarctica Chaperonin GroEL (groEL), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-metapneumovirus-major-surface-glycoprotein-g-g-partial-bhp10514388</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP754440HDAM1d7-SDS.jpg?v=1772280090</image:loc>
      <image:title>Recombinant Human metapneumovirus Major surface glycoprotein G (G), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-pyogenes-c5a-peptidase-scpa-partial-bhp10514434</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP325390SMR-SDS.jpg?v=1772280100</image:loc>
      <image:title>Recombinant Streptococcus pyogenes C5a peptidase (scpA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kit-ligand-kitlg-partial-active-bhp10514402</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002061HU1-SDS.jpg?v=1772280093</image:loc>
      <image:title>Recombinant Human Kit ligand (KITLG), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prolyl-3-hydroxylase-1-p3h1-bhp10514427</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP657676HU-SDS.jpg?v=1772280097</image:loc>
      <image:title>Recombinant Human Prolyl 3-hydroxylase 1 (P3H1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-apolipoprotein-e-apoe-bhp10514422</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001936MOW-SDS.jpg?v=1772280095</image:loc>
      <image:title>Recombinant Macaca mulatta Apolipoprotein E (APOE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bone-morphogenetic-protein-1-bmp1-bhp10514425</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002733HUc7-SDS.jpg?v=1772280098</image:loc>
      <image:title>Recombinant Human Bone morphogenetic protein 1 (BMP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-colicin-ia-cia-bhp10514428</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361926ENL-SDS.jpg?v=1772280096</image:loc>
      <image:title>Recombinant Escherichia coli Colicin-Ia (cia)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cartilage-associated-protein-crtap-bhp10514416</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005999HU-SDS.jpg?v=1772280095</image:loc>
      <image:title>Recombinant Human Cartilage-associated protein (CRTAP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-esterase-ybff-ybff-bhp10514430</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP305118ENV-SDS.jpg?v=1772280097</image:loc>
      <image:title>Recombinant Escherichia coli Esterase ybfF (ybfF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rice-tungro-bacilliform-virus-polyprotein-partial-i669v-bhp10514419</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5789GWU_M_-SDS.jpg?v=1772280098</image:loc>
      <image:title>Recombinant Rice tungro bacilliform virus Polyprotein, partial (I669V)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-copper-transport-protein-atox1-atox1-bhp10514424</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP866134DO-SDS.jpg?v=1772280097</image:loc>
      <image:title>Recombinant Dog Copper transport protein ATOX1 (ATOX1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-wnt-3a-wnt3a-partial-bhp10514444</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026136HU1g5-SDS.jpg?v=1772280098</image:loc>
      <image:title>Recombinant Human Protein Wnt-3a (WNT3A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-microtubule-associated-proteins-1a-1b-light-chain-3b-map1lc3b-bhp10514439</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861453MO-SDS.jpg?v=1772280101</image:loc>
      <image:title>Recombinant Mouse Microtubule-associated proteins 1A/1B light chain 3B (Map1lc3b)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-aeromonas-hydrophila-major-cold-shock-protein-cspa-bhp10514441</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP676004AXW-SDS.jpg?v=1772280101</image:loc>
      <image:title>Recombinant Aeromonas hydrophila Major cold-shock protein (cspA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sal-like-protein-4-sall4-partial-bhp10514440</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP892126HU2-SDS.jpg?v=1772280116</image:loc>
      <image:title>Recombinant Human Sal-like protein 4 (SALL4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-osteocalcin-bglap-bhp10514436</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002682BO-SDS.jpg?v=1772280100</image:loc>
      <image:title>Recombinant Bovine Osteocalcin (BGLAP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-medicago-sativa-leghemoglobin-1-bhp10514435</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP357595MQO-SDS.jpg?v=1772280104</image:loc>
      <image:title>Recombinant Medicago sativa Leghemoglobin-1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-23-fgf23-partial-bhp10514437</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008629HU-SDS.jpg?v=1772280100</image:loc>
      <image:title>Recombinant Human Fibroblast growth factor 23 (FGF23), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-polypeptide-n-acetylgalactosaminyltransferase-14-galnt14-bhp10514451</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP836212HUc7-SDS.jpg?v=1772280102</image:loc>
      <image:title>Recombinant Human Polypeptide N-acetylgalactosaminyltransferase 14 (GALNT14)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-peroxisomal-multifunctional-enzyme-type-2-hsd17b4-bhp10514464</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010774HU-SDS.jpg?v=1772280108</image:loc>
      <image:title>Recombinant Human Peroxisomal multifunctional enzyme type 2 (HSD17B4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cysteine-rich-protein-1-crip1-partial-bhp10514454</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005969HUf0-SDS.jpg?v=1772280109</image:loc>
      <image:title>Recombinant Human Cysteine-rich protein 1 (CRIP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o157-h7-uncharacterized-protein-yqgb-yqgb-bhp10514458</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP353135EODe3-SDS.jpg?v=1772280103</image:loc>
      <image:title>Recombinant Escherichia coli O157:H7 Uncharacterized protein yqgB (yqgB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-tyrosine-protein-kinase-hopscotch-hop-partial-bhp10514459</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP631547DLUd7-SDS.jpg?v=1772280102</image:loc>
      <image:title>Recombinant Drosophila melanogaster Tyrosine-protein kinase hopscotch (hop), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-focadhesin-focad-partial-bhp10514472</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP719626HUg5-SDS.jpg?v=1772280180</image:loc>
      <image:title>Recombinant Human Focadhesin (FOCAD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-type-1-associated-death-domain-protein-tradd-bhp10514457</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP621879HUc7-SDS.jpg?v=1772280102</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor type 1-associated DEATH domain protein (TRADD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-profilin-chic-bhp10514470</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP333112DLUd7-SDS.jpg?v=1772280196</image:loc>
      <image:title>Recombinant Drosophila melanogaster Profilin (chic)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-coiled-coil-domain-containing-112-ccdc112-bhp10514450</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5684RAc7-SDS.jpg?v=1772280101</image:loc>
      <image:title>Recombinant Rat Coiled-coil domain-containing 112 (CCDC112)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-arylamine-n-acetyltransferase-1-nat1-bhp10514443</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015464HU-SDS.jpg?v=1772280100</image:loc>
      <image:title>Recombinant Human Arylamine N-acetyltransferase 1 (NAT1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-superoxide-dismutase-cu-zn-sod1-x53s-bhp10514423</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP819871DO-SDS.jpg?v=1772280094</image:loc>
      <image:title>Recombinant Dog Superoxide dismutase [Cu-Zn] (SOD1) (X53S)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-insulin-like-growth-factor-ii-igf2-bhp10514447</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011088BOa0-SDS.jpg?v=1772280101</image:loc>
      <image:title>Recombinant Bovine Insulin-like growth factor II (IGF2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atp-synthase-f-1-complex-subunit-beta-mitochondrial-atp5f1b-bhp10514433</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002350HU-SDS.jpg?v=1772280098</image:loc>
      <image:title>Recombinant Human ATP synthase F(1) complex subunit beta, mitochondrial (ATP5F1B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-tata-box-binding-protein-1-tbp1-bhp10514469</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP329782DOAa0-SDS.jpg?v=1772280188</image:loc>
      <image:title>Recombinant Arabidopsis thaliana TATA-box-binding protein 1 (TBP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-enhancer-factor-tef-4-tead2-partial-bhp10514465</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP613597HU2g5-SDS.jpg?v=1772280182</image:loc>
      <image:title>Recombinant Human Transcriptional enhancer factor TEF-4 (TEAD2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-parathyroid-hormone-pth-bhp10514446</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018987MOVc7-SDS.jpg?v=1772280100</image:loc>
      <image:title>Recombinant Macaca fascicularis Parathyroid hormone (PTH)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-acetylcholinesterase-ache-bhp10514445</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001154HU-SDS.jpg?v=1772280102</image:loc>
      <image:title>Recombinant Human Acetylcholinesterase (ACHE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o6-h1-dna-binding-dual-transcriptional-regulator-ompr-ompr-bhp10514471</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP359384FQRg5-SDS.jpg?v=1772280181</image:loc>
      <image:title>Recombinant Escherichia coli O6:H1 DNA-binding dual transcriptional regulator OmpR (ompR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-profilin-chic-bhp10514466</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP333112DLUg5-SDS.jpg?v=1772280124</image:loc>
      <image:title>Recombinant Drosophila melanogaster Profilin (chic)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-heterogeneous-nuclear-ribonucleoprotein-k-hnrnpk-partial-bhp10514442</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010611HUc0-SDS.jpg?v=1772280100</image:loc>
      <image:title>Recombinant Human Heterogeneous nuclear ribonucleoprotein K (HNRNPK), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-lambda-carrageenase-cgla-partial-bhp10514453</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP312317PTS-SDS.jpg?v=1772280104</image:loc>
      <image:title>Recombinant Lambda-carrageenase (cglA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o6-h1-dna-binding-dual-transcriptional-regulator-ompr-ompr-bhp10514462</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP359384FQRd7-SDS.jpg?v=1772280106</image:loc>
      <image:title>Recombinant Escherichia coli O6:H1 DNA-binding dual transcriptional regulator OmpR (ompR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-leukemia-inhibitory-factor-lif-bhp10514455</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012928MO-SDS.jpg?v=1772280103</image:loc>
      <image:title>Recombinant Mouse Leukemia inhibitory factor (Lif)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-trim21-trim21-bhp10514484</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP024457HUc7-SDS.jpg?v=1772280110</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase TRIM21 (TRIM21)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-enhancer-factor-tef-5-tead3-partial-bhp10514477</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP860344HUd7-SDS.jpg?v=1772280106</image:loc>
      <image:title>Recombinant Human Transcriptional enhancer factor TEF-5 (TEAD3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-motif-chemokine-5-ccl5-bhp10514463</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004800HUd7-SDS.jpg?v=1772280117</image:loc>
      <image:title>Recombinant Human C-C motif chemokine 5 (CCL5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-nad-p-h-dehydrogenase-quinone-lpda-bhp10514452</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6072FSG-SDS.jpg?v=1772280102</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis NAD(P)H dehydrogenase (quinone) (lpdA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-motif-chemokine-5-ccl5-bhp10514461</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004800HUg5-SDS.jpg?v=1772280117</image:loc>
      <image:title>Recombinant Human C-C motif chemokine 5 (CCL5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-peptide-deformylase-mitochondrial-pdf-bhp10514438</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP872538HU-SDS.jpg?v=1772280099</image:loc>
      <image:title>Recombinant Human Peptide deformylase, mitochondrial (PDF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-enhancer-factor-tef-3-tead4-partial-bhp10514478</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP618010HU1g5-SDS.jpg?v=1772280182</image:loc>
      <image:title>Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4), Partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vimentin-vim-bhp10514479</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025857HUc7-SDS.jpg?v=1772280190</image:loc>
      <image:title>Recombinant Human Vimentin (VIM)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-actinia-equina-equinatoxin-3-partial-bhp10514467</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP313498ACN-SDS.jpg?v=1772280106</image:loc>
      <image:title>Recombinant Actinia equina Equinatoxin-3, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pendrin-slc26a4-partial-bhp10514497</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021527HUc7-SDS.jpg?v=1772280111</image:loc>
      <image:title>Recombinant Human Pendrin (SLC26A4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-apoptosis-associated-speck-like-protein-containing-a-card-pycard-bhp10514485</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861664MOc7-SDS.jpg?v=1772280172</image:loc>
      <image:title>Recombinant Mouse Apoptosis-associated speck-like protein containing a CARD (Pycard)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-carboxypeptidase-a4-cpa4-bhp10514449</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005878HU-SDS.jpg?v=1772280183</image:loc>
      <image:title>Recombinant Human Carboxypeptidase A4 (CPA4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-enhancer-factor-tef-3-tead4-partial-bhp10514495</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CBS-EP618010HU1d7-SDS.jpg?v=1772280133</image:loc>
      <image:title>Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4), Partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-wnt-3a-wnt3a-bhp10514483</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026136MOc7-SDS.jpg?v=1772280182</image:loc>
      <image:title>Recombinant Mouse Protein Wnt-3a (Wnt3a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-10-fgf10-partial-bhp10514491</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008616HU1c7-SDS.jpg?v=1772280113</image:loc>
      <image:title>Recombinant Human Fibroblast growth factor 10 (FGF10), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-klebsiella-pneumoniae-subsp-pneumoniae-penicillin-binding-protein-1b-partial-bhp10514460</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6059GNAg5-SDS.jpg?v=1772280106</image:loc>
      <image:title>Recombinant Klebsiella pneumoniae subsp. pneumoniae Penicillin-binding protein 1B, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-lysine-6-oxidase-lox-partial-bhp10514482</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013038HU1-SDS.jpg?v=1772280119</image:loc>
      <image:title>Recombinant Human Protein-lysine 6-oxidase (LOX), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lysosomal-acid-glucosylceramidase-gba1-bhp10514492</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009289HUa2-SDS.jpg?v=1772280193</image:loc>
      <image:title>Recombinant Human Lysosomal acid glucosylceramidase (GBA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-klebsiella-pneumoniae-subsp-pneumoniae-penicillin-binding-protein-1b-partial-bhp10514481</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6059GNAd7-SDS.jpg?v=1772280128</image:loc>
      <image:title>Recombinant Klebsiella pneumoniae subsp. pneumoniae Penicillin-binding protein 1B, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-receptor-interacting-serine-threonine-protein-kinase-1-ripk1-bhp10514496</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720181MOc7-SDS.jpg?v=1772280178</image:loc>
      <image:title>Recombinant Mouse Receptor-interacting serine/threonine-protein kinase 1 (Ripk1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-gamma-ifng-bhp10514456</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011050HU_A4_a0-SDS.jpg?v=1772280185</image:loc>
      <image:title>Recombinant Human Interferon gamma (IFNG)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-tyrosine-protein-kinase-hopscotch-hop-partial-bhp10514494</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP631547DLUg5-SDS.jpg?v=1772280186</image:loc>
      <image:title>Recombinant Drosophila melanogaster Tyrosine-protein kinase hopscotch (hop), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-nephrin-nphs1-partial-bhp10514475</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP870792MO-SDS.jpg?v=1772280113</image:loc>
      <image:title>Recombinant Mouse Nephrin (Nphs1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-casein-kinase-i-isoform-delta-csnk1d-bhp10514501</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006067HU-SDS.jpg?v=1772280206</image:loc>
      <image:title>Recombinant Human Casein kinase I isoform delta (CSNK1D)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-influenza-b-virus-nucleoprotein-np-partial-bhp10514489</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP319610IIRc7-SDS.jpg?v=1772280123</image:loc>
      <image:title>Recombinant Influenza B virus Nucleoprotein (NP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-enhancer-factor-tef-4-tead2-partial-bhp10514493</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP613597HU2d7-SDS.jpg?v=1772280180</image:loc>
      <image:title>Recombinant Human Transcriptional enhancer factor TEF-4 (TEAD2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-surfactant-associated-protein-2-sfta2-bhp10514480</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP754403HUc7-SDS.jpg?v=1772280126</image:loc>
      <image:title>Recombinant Human Surfactant-associated protein 2 (SFTA2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kinesin-like-protein-kif20b-kif20b-partial-bhp10514500</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP839399HU-SDS.jpg?v=1772280183</image:loc>
      <image:title>Recombinant Human Kinesin-like protein KIF20B (KIF20B), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-cytoplasmic-trehalase-tref-bhp10514474</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6077ENR-SDS.jpg?v=1772280106</image:loc>
      <image:title>Recombinant Escherichia coli Cytoplasmic trehalase (treF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-roundabout-homolog-3-robo3-partial-bhp10514476</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP846671HU1-SDS.jpg?v=1772280106</image:loc>
      <image:title>Recombinant Human Roundabout homolog 3 (ROBO3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-gamma-hemolysin-component-a-hlga-bhp10514503</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP362888SKY-SDS.jpg?v=1772280197</image:loc>
      <image:title>Recombinant Staphylococcus aureus Gamma-hemolysin component A (hlgA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bunodosoma-granuliferum-delta-actitoxin-bgr2a-bhp10514468</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP314923BNL-SDS.jpg?v=1772280110</image:loc>
      <image:title>Recombinant Bunodosoma granuliferum Delta-actitoxin-Bgr2a</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-newcastle-disease-virus-fusion-glycoprotein-f0-f-partial-bhp10514511</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP333810NCWc7-SDS.jpg?v=1772280187</image:loc>
      <image:title>Recombinant Newcastle disease virus Fusion glycoprotein F0 (F), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-syncytin-1-ervw-1-partial-bhp10514509</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP891578HUc7-SDS.jpg?v=1772280112</image:loc>
      <image:title>Recombinant Human Syncytin-1 (ERVW-1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-sp-group-g-immunoglobulin-g-binding-protein-g-spg-partial-bhp10514488</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP322577SNDb0_F10_-SDS.jpg?v=1772280129</image:loc>
      <image:title>Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-platelet-derived-growth-factor-d-pdgfd-partial-bhp10514507</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887935HU-SDS.jpg?v=1772280111</image:loc>
      <image:title>Recombinant Human Platelet-derived growth factor D (PDGFD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-newcastle-disease-virus-rna-directed-rna-polymerase-l-l-partial-bhp10514498</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887622NCTb1-SDS.jpg?v=1772280190</image:loc>
      <image:title>Recombinant Newcastle disease virus RNA-directed RNA polymerase L (L), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-l-lactate-dehydrogenase-b-chain-ldhb-bhp10514505</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012841HUc7-SDS.jpg?v=1772280110</image:loc>
      <image:title>Recombinant Human L-lactate dehydrogenase B chain (LDHB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-wnt-3a-wnt3a-partial-bhp10514486</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026136HU1c7-SDS.jpg?v=1772280116</image:loc>
      <image:title>Recombinant Human Protein Wnt-3a (WNT3A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-enamelin-enam-partial-bhp10514448</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007662HUc7-SDS.jpg?v=1772280101</image:loc>
      <image:title>Recombinant Human Enamelin (ENAM), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-focadhesin-focad-partial-bhp10514473</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP719626HUd7-SDS.jpg?v=1772280119</image:loc>
      <image:title>Recombinant Human Focadhesin (FOCAD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-granzyme-k-gzmk-bhp10514516</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010084HU1d7-SDS.jpg?v=1772280184</image:loc>
      <image:title>Recombinant Human Granzyme K (GZMK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-enhancer-factor-tef-3-tead4-partial-bhp10514490</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP618010HU1a0-SDS.jpg?v=1772280188</image:loc>
      <image:title>Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-granzyme-k-gzmk-bhp10514515</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010084HU1g5-SDS.jpg?v=1772280130</image:loc>
      <image:title>Recombinant Human Granzyme K (GZMK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-thrombopoietin-thpo-partial-bhp10514514</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023509HUc7-SDS.jpg?v=1772280188</image:loc>
      <image:title>Recombinant Human Thrombopoietin (THPO), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-danio-rerio-aerolysin-like-protein-aep1-bhp10514487</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP710693DIL-SDS.jpg?v=1772280108</image:loc>
      <image:title>Recombinant Danio rerio Aerolysin-like protein (aep1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-brain-derived-neurotrophic-factor-bdnf-r225e-r245e-bhp10514504</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002655HU_M_-SDS.jpg?v=1772280178</image:loc>
      <image:title>Recombinant Human Brain-derived neurotrophic factor (BDNF) (R225E,R245E)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-phospholipid-scramblase-1-plscr1-bhp10514513</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018207HUc7-SDS.jpg?v=1772280112</image:loc>
      <image:title>Recombinant Human Phospholipid scramblase 1 (PLSCR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-secreted-frizzled-related-protein-5-sfrp5-bhp10514499</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021141MOc7-SDS.jpg?v=1772280124</image:loc>
      <image:title>Recombinant Mouse Secreted frizzled-related protein 5 (Sfrp5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/n-terminal-6xhis-sumo-tagged-bhp10514502</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP213344Ba-SDS.jpg?v=1772280109</image:loc>
      <image:title>N-terminal 6xHis-SUMO-tagged</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-complement-factor-b-cfb-bhp10514510</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005268MOc7-SDS.jpg?v=1772280110</image:loc>
      <image:title>Recombinant Mouse Complement factor B (Cfb)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-fibroblast-growth-factor-15-fgf15-bhp10514508</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP522052MOc7-SDS.jpg?v=1772280197</image:loc>
      <image:title>Recombinant Mouse Fibroblast growth factor 15 (Fgf15)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cyclic-gmp-amp-synthase-cgas-bhp10514522</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5333MO-SDS.jpg?v=1772280125</image:loc>
      <image:title>Recombinant Mouse Cyclic GMP-AMP synthase (Cgas)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-interleukin-18-il18-bhp10514512</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP895937DOc7-SDS.jpg?v=1772280172</image:loc>
      <image:title>Recombinant Dog Interleukin-18 (IL18)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-retinoblastoma-associated-protein-rb1-partial-bhp10514525</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP019386HU-SDS.jpg?v=1772280119</image:loc>
      <image:title>Recombinant Human Retinoblastoma-associated protein (RB1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-kplce-kplce-bhp10514521</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP713129HU-SDS.jpg?v=1772280115</image:loc>
      <image:title>Recombinant Human Protein KPLCE (KPLCE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rabbit-beta-crystallin-b2-crybb2-bhp10514527</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006013RB-SDS.jpg?v=1772280113</image:loc>
      <image:title>Recombinant Rabbit Beta-crystallin B2 (CRYBB2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sestrin-2-sesn2-bhp10514529</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021096HU-SDS.jpg?v=1772280130</image:loc>
      <image:title>Recombinant Human Sestrin-2 (SESN2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-shigella-flexneri-cold-shock-like-protein-cspe-cspe-bhp10514523</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP359257SZB-SDS.jpg?v=1772280118</image:loc>
      <image:title>Recombinant Shigella flexneri Cold shock-like protein CspE (cspE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-desmoglein-3-dsg3-partial-biotinylated-bhp10514532</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007205MO-B-SDS.jpg?v=1772280128</image:loc>
      <image:title>Recombinant Mouse Desmoglein-3 (Dsg3), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-xenopus-laevis-cyclin-a2-ccna2-bhp10514519</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004805XBE-SDS.jpg?v=1772280110</image:loc>
      <image:title>Recombinant Xenopus laevis Cyclin-A2 (ccna2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunoglobulin-lambda-like-polypeptide-5-igll5-bhp10514539</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP494948HUa0-SDS.jpg?v=1772280115</image:loc>
      <image:title>Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-large-ribosomal-subunit-protein-bl28m-mrpl28-bhp10514531</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP621647HUf0-SDS.jpg?v=1772280115</image:loc>
      <image:title>Recombinant Human Large ribosomal subunit protein bL28m (MRPL28)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10514530</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU2-SDS.jpg?v=1772280113</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-casein-kinase-i-isoform-delta-csnk1d-bhp10514517</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006067HUb0-SDS.jpg?v=1772280112</image:loc>
      <image:title>Recombinant Human Casein kinase I isoform delta (CSNK1D)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-threonine-protein-phosphatase-2a-regulatory-subunit-b-subunit-beta-ppp2r3b-bhp10514524</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP896533HU_F_-SDS.jpg?v=1772280113</image:loc>
      <image:title>Recombinant Human Serine/threonine-protein phosphatase 2A regulatory subunit B&apos;&apos; subunit beta (PPP2R3B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-diamine-acetyltransferase-1-sat1-partial-bhp10514535</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020717HU1c7-SDS.jpg?v=1772280118</image:loc>
      <image:title>Recombinant Human Diamine acetyltransferase 1(SAT1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-cop1-cop1-bhp10514520</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP822821HU-SDS.jpg?v=1772280123</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase COP1 (COP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-dihydroorotate-dehydrogenase-quinone-mitochondrial-dhodh-partial-bhp10514541</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP714357RA1c2-SDS.jpg?v=1772280129</image:loc>
      <image:title>Recombinant Rat Dihydroorotate dehydrogenase (quinone), mitochondrial (Dhodh), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-ppr-motif-containing-protein-mitochondrial-lrpprc-partial-bhp10514528</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013105HU1-SDS.jpg?v=1772280113</image:loc>
      <image:title>Recombinant Human Leucine-rich PPR motif-containing protein, mitochondrial (LRPPRC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-deoxyribonuclease-gamma-dnase1l3-bhp10514506</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP621686HUd7-SDS.jpg?v=1772280187</image:loc>
      <image:title>Recombinant Human Deoxyribonuclease gamma (DNASE1L3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-saccharomyces-cerevisiae-arginine-permease-can1-can1-partial-bhp10514526</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361378SVG-SDS.jpg?v=1772280115</image:loc>
      <image:title>Recombinant Saccharomyces cerevisiae Arginine permease CAN1 (CAN1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-vaccinia-virus-envelope-protein-h3-opg108-x27s-x28s-x29s-partial-biotinylated-bhp10514538</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP329027VAD-B-SDS.jpg?v=1772280113</image:loc>
      <image:title>Recombinant Vaccinia virus Envelope protein H3 (OPG108) (X27S,X28S,X29S), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-wnt-9a-wnt9a-bhp10514543</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP840305MO-SDS.jpg?v=1772280114</image:loc>
      <image:title>Recombinant Mouse Protein Wnt-9a (Wnt9a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-inhibin-beta-a-chain-inhba-active-bhp10514549</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-glycoside-hydrolase-family-1-bhp10514540</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6076ENR-SDS.jpg?v=1772280115</image:loc>
      <image:title>Recombinant Escherichia coli Glycoside hydrolase family 1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-s-adenosylmethionine-synthase-isoform-type-2-mat2a-bhp10514548</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP013517HUa0-SDS.jpg?v=1772280117</image:loc>
      <image:title>Recombinant Human S-adenosylmethionine synthase isoform type-2 (MAT2A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-bile-acid-receptor-nr1h4-bhp10514542</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP723332MO-SDS.jpg?v=1772280119</image:loc>
      <image:title>Recombinant Mouse Bile acid receptor (Nr1h4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-coxiella-burnetii-chaperonin-groel-groel-partial-bhp10514537</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP323108DXPc7-SDS.jpg?v=1772280112</image:loc>
      <image:title>Recombinant Coxiella burnetii Chaperonin GroEL (groEL), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-apoptosis-associated-speck-like-protein-containing-a-card-pycard-bhp10514547</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861664MOd7-SDS.jpg?v=1772280125</image:loc>
      <image:title>Recombinant Mouse Apoptosis-associated speck-like protein containing a CARD (Pycard)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-p2x-purinoceptor-7-p2rx7-partial-bhp10514518</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859103HU-SDS.jpg?v=1772280188</image:loc>
      <image:title>Recombinant Human P2X purinoceptor 7 (P2RX7), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-platelet-derived-growth-factor-subunit-b-pdgfb-active-bhp10514551</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-intermembrane-phospholipid-transport-system-lipoprotein-mlaa-mlaa-bhp10514536</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP300563ENVc7-SDS.jpg?v=1772280113</image:loc>
      <image:title>Recombinant Escherichia coli Intermembrane phospholipid transport system lipoprotein MlaA (mlaA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vacuolar-protein-sorting-associated-protein-29-vps29-partial-bhp10514545</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP890661HU1_F2_-SDS.jpg?v=1772280193</image:loc>
      <image:title>Recombinant Human Vacuolar protein sorting-associated protein 29 (VPS29), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transforming-growth-factor-beta-1-proprotein-tgfb1-partial-active-bhp10514553</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-newcastle-disease-virus-rna-directed-rna-polymerase-l-l-partial-bhp10514544</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887622NCTa0-SDS.jpg?v=1772280115</image:loc>
      <image:title>Recombinant Newcastle disease virus RNA-directed RNA polymerase L (L), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ryanodine-receptor-3-ryr3-partial-bhp10514534</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020621HU1-SDS.jpg?v=1772280185</image:loc>
      <image:title>Recombinant Human Ryanodine receptor 3 (RYR3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-cold-shock-protein-cspa-cspa-bhp10514546</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP748537SULe1-SDS.jpg?v=1772280130</image:loc>
      <image:title>Recombinant Staphylococcus aureus Cold shock protein CspA (cspA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pro-epidermal-growth-factor-egf-partial-active-bhp10514552</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-10-fgf10-active-bhp10514550</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transforming-growth-factor-beta-1-proprotein-tgfb1-partial-active-bhp10514554</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serotransferrin-tf-active-bhp10514566</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alpha-2-hs-glycoprotein-ahsg-partial-active-bhp10514564</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-erythropoietin-epo-active-bhp10514560</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibronectin-fn1-partial-active-bhp10514561</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-insulin-ins-partial-bhp10514556</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-3-il3-active-bhp10514575</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-integrin-alpha-iib-itga2b-partial-bhp10514533</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011865HUc7-SDS.jpg?v=1772280128</image:loc>
      <image:title>Recombinant Human Integrin alpha-IIb (ITGA2B), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serotransferrin-tf-active-bhp10514565</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibronectin-fn1-partial-active-bhp10514562</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vitronectin-vtn-active-bhp10514568</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-tnf-partial-active-bhp10514557</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-somatotropin-gh1-active-bhp10514555</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-4-il4-active-bhp10514572</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-alpha-2-hs-glycoprotein-ahsg-active-bhp10514580</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-6-il6-active-bhp10514573</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibronectin-fn1-partial-active-bhp10514563</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-fibroblast-growth-factor-2-fgf2-active-bhp10514567</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-alpha-2-ifna2-active-bhp10514558</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-leukemia-inhibitory-factor-lif-active-bhp10514577</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vascular-endothelial-growth-factor-a-long-form-vegfa-active-bhp10514587</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-granulocyte-colony-stimulating-factor-csf3-partial-active-bhp10514578</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-7-il7-active-bhp10514581</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-2-fgf2-active-bhp10514576</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bone-morphogenetic-protein-7-bmp7-partial-active-bhp10514588</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-4-fgf4-active-bhp10514574</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-wnt-3a-wnt3a-active-bhp10514597</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hepatocyte-growth-factor-hgf-partial-active-bhp10514584</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tissue-factor-f3-partial-bhp10514583</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-gamma-ifng-active-bhp10514559</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-granulocyte-macrophage-colony-stimulating-factor-csf2-active-bhp10514570</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-il12p40-and-il12p35-heterodimer-protein-active-bhp10514592</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-21-il21-active-bhp10514606</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vascular-endothelial-growth-factor-a-long-form-vegfa-active-bhp10514586</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-9-fgf9-partial-active-bhp10514593</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kit-ligand-kitlg-partial-active-bhp10514589</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transforming-growth-factor-beta-2-proprotein-tgfb2-partial-active-bhp10514599</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-insulin-like-growth-factor-i-igf1-e51r-active-bhp10514571</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pulmonary-surfactant-associated-protein-a1-sftpa1-bhp10514611</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP810281HU-SDS.jpg?v=1772280117</image:loc>
      <image:title>Recombinant Human Pulmonary surfactant-associated protein A1 (SFTPA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-noggin-nog-active-bhp10514601</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vitronectin-vtn-active-bhp10514569</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vascular-endothelial-growth-factor-receptor-2-kdr-partial-bhp10514608</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012145HUd7-SDS.jpg?v=1772280118</image:loc>
      <image:title>Recombinant Human Vascular endothelial growth factor receptor 2 (KDR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macrovipera-lebetina-chymotrypsin-like-protease-vlctlp-bhp10514609</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP522192MPJd7-SDS.jpg?v=1772280117</image:loc>
      <image:title>Recombinant Macrovipera lebetina Chymotrypsin-like protease VLCTLP</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-uncharacterized-protein-c1orf54-homolog-bhp10514610</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP848110MO-SDS.jpg?v=1772280203</image:loc>
      <image:title>Recombinant Mouse Uncharacterized protein C1orf54 homolog</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-oncostatin-m-osm-active-bhp10514582</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-il12p40-and-p19-heterodimer-protein-active-bhp10514591</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-glucagon-like-peptide-1-receptor-glp1r-partial-active-bhp10514617</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009514RA2-SDS.jpg?v=1772280189</image:loc>
      <image:title>Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transforming-growth-factor-beta-3-proprotein-tgfb3-partial-active-bhp10514579</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-18-il18-active-bhp10514602</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-15-il15-active-bhp10514595</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-2-il2-active-bhp10514598</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-r-spondin-1-rspo1-active-bhp10514604</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pro-neuregulin-1-membrane-bound-isoform-nrg1-partial-active-bhp10514600</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leukemia-inhibitory-factor-lif-active-bhp10514585</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-sparus-aurata-fibroblast-growth-factor-fgf2-active-bhp10514607</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-l-amino-acid-oxidase-il4i1-bhp10514613</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011660MO-SDS.jpg?v=1772280133</image:loc>
      <image:title>Recombinant Mouse L-amino-acid oxidase (Il4i1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-deoxyribonuclease-1-dnase1-bhp10514614</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007049HU-SDS.jpg?v=1772280130</image:loc>
      <image:title>Recombinant Human Deoxyribonuclease-1 (DNASE1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-21-il21-active-bhp10514605</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dendroaspis-angusticeps-natriuretic-peptide-dnp-bhp10514615</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP329805DBG-SDS.jpg?v=1772280142</image:loc>
      <image:title>Recombinant Dendroaspis angusticeps Natriuretic peptide DNP</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-13-il13-partial-active-bhp10514594</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fms-related-tyrosine-kinase-3-ligand-flt3lg-partial-active-bhp10514596</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-7-fgf7-active-bhp10514590</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-serotransferrin-tf-active-bhp10514603</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-porcine-epidemic-diarrhea-virus-spike-glycoprotein-s-partial-bhp10514625</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP5982GRQ-SDS.jpg?v=1772280207</image:loc>
      <image:title>Recombinant Porcine epidemic diarrhea virus Spike glycoprotein(S), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-glucagon-like-peptide-1-receptor-glp1r-partial-active-bhp10514618</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009514MO1-SDS.jpg?v=1772280193</image:loc>
      <image:title>Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-monoglyceride-lipase-mgll-bhp10514636</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013787MO-SDS.jpg?v=1772280136</image:loc>
      <image:title>Recombinant Mouse Monoglyceride lipase (Mgll)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-r-spondin-2-rspo2-partial-bhp10514616</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP751021HU1_M_-SDS.jpg?v=1772280209</image:loc>
      <image:title>Recombinant Human R-spondin-2 (RSPO2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-unc-13-homolog-a-unc13a-partial-bhp10514612</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP680183MO-SDS.jpg?v=1772280133</image:loc>
      <image:title>Recombinant Mouse Protein unc-13 homolog A (Unc13a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myc-associated-zinc-finger-protein-maz-bhp10514620</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013528HU-SDS.jpg?v=1772280188</image:loc>
      <image:title>Recombinant Human Myc-associated zinc finger protein (MAZ)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-macaca-fascicularis-brain-cdna-clone-qora-11660-similar-to-human-lymphocyte-antigen-6-complex-locus-e-ly6e-mrna-refseq-nm-002346-1-bhp10514632</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5575MOV-SDS.jpg?v=1772280190</image:loc>
      <image:title>Recombinant Macaca fascicularis Macaca fascicularis brain cDNA clone: QorA-11660, similar to human lymphocyte antigen 6 complex, locus E (LY6E), mRNA, RefSeq: NM_002346.1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-ly6-plaur-domain-containing-protein-3-lypd3-active-bhp10514637</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013263RA-SDS.jpg?v=1772280131</image:loc>
      <image:title>Recombinant Rat Ly6/PLAUR domain-containing protein 3 (Lypd3) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-ly6-plaur-domain-containing-protein-3-lypd3-bhp10514638</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP013263RA-SDS.jpg?v=1772280145</image:loc>
      <image:title>Recombinant Rat Ly6/PLAUR domain-containing protein 3 (Lypd3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-queuine-trna-ribosyltransferase-tgt-bhp10514630</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP019146ENT-SDS.jpg?v=1772280125</image:loc>
      <image:title>Recombinant Escherichia coli Queuine tRNA-ribosyltransferase (tgt)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-large-ribosomal-subunit-protein-bl12-rpll-bhp10514627</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP402772SUJ-SDS.jpg?v=1772280117</image:loc>
      <image:title>Recombinant Staphylococcus aureus Large ribosomal subunit protein bL12 (rplL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-ananas-comosus-fruit-bromelain-bhp10514635</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP522821BYU-SDS.jpg?v=1772280126</image:loc>
      <image:title>Recombinant Ananas comosus Fruit bromelain</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glucagon-like-peptide-2-receptor-glp2r-partial-biotinylated-bhp10514621</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009515HU1-B-SDS.jpg?v=1772280195</image:loc>
      <image:title>Recombinant Human Glucagon-like peptide 2 receptor (GLP2R), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-macrophage-colony-stimulating-factor-1-csf1-partial-bhp10514652</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP006043MO-SDS.jpg?v=1772280139</image:loc>
      <image:title>Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ly6-plaur-domain-containing-protein-3-lypd3-active-bhp10514640</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013263HU-SDS.jpg?v=1772280119</image:loc>
      <image:title>Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-growth-differentiation-factor-8-mstn-active-bhp10514634</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015057HU_A4_-SDS.jpg?v=1772280196</image:loc>
      <image:title>Recombinant Human Growth/differentiation factor 8 (MSTN) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-insulin-like-growth-factor-i-igf1-bhp10514655</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011086BOc7-SDS.jpg?v=1772280141</image:loc>
      <image:title>Recombinant Bovine Insulin-like growth factor I (IGF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-prunus-persica-non-specific-serine-threonine-protein-kinase-bhp10514633</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5511EZK-SDS.jpg?v=1772280124</image:loc>
      <image:title>Recombinant Prunus persica non-specific serine/threonine protein kinase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-coagulation-factor-ix-f9-active-bhp10514643</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007936BO_A4_-SDS.jpg?v=1772280187</image:loc>
      <image:title>Recombinant Bovine Coagulation factor IX (F9) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gelsolin-gsn-bhp10514651</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009965HU-SDS.jpg?v=1772280136</image:loc>
      <image:title>Recombinant Human Gelsolin (GSN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-african-swine-fever-virus-inner-membrane-protein-p54-p54-partial-bhp10514631</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5531GOG-SDS.jpg?v=1772280135</image:loc>
      <image:title>Recombinant African swine fever virus Inner membrane protein p54 (p54), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-growth-hormone-receptor-ghr-partial-bhp10514622</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009411PI-SDS.jpg?v=1772280151</image:loc>
      <image:title>Recombinant Pig Growth hormone receptor (GHR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
According to the left SDS-PAGE image, the purity of Proteinase K is 95%+ and the molecular weight is 28.9 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-type-16-truncated-l2-protein-l2-partial-bhp10514623</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6382HML-SDS.jpg?v=1772280119</image:loc>
      <image:title>Recombinant Human papillomavirus type 16 Truncated L2 protein (L2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-13-il13-bhp10514629</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP6408HU-SDS.jpg?v=1772280186</image:loc>
      <image:title>Recombinant Human Interleukin-13 (IL13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-udp-n-acetylenolpyruvoylglucosamine-reductase-murb-bhp10514656</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP362408ENV-SDS.jpg?v=1772280128</image:loc>
      <image:title>Recombinant Escherichia coli UDP-N-acetylenolpyruvoylglucosamine reductase (murB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-5-il5-bhp10514650</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011662HUa0-SDS.jpg?v=1772280201</image:loc>
      <image:title>Recombinant Human Interleukin-5 (IL5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-dependent-phosphate-transport-protein-2b-slc34a2-partial-active-bhp10514642</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021581HU1-SDS.jpg?v=1772280187</image:loc>
      <image:title>Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-coagulation-factor-x-f10-bhp10514639</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007915MO_A4_-SDS.jpg?v=1772280137</image:loc>
      <image:title>Recombinant Mouse Coagulation factor X (F10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunoglobulin-j-chain-jchain-bhp10514647</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011337HU-SDS.jpg?v=1772280128</image:loc>
      <image:title>Recombinant Human Immunoglobulin J chain (JCHAIN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-collagen-alpha-1-iii-chain-col3a1-bhp10514619</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005740HU_A4_d7-SDS.jpg?v=1772280141</image:loc>
      <image:title>Recombinant Human Collagen alpha-1(III) chain (COL3A1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-potassium-transporting-atpase-subunit-alpha-1-atp1a1-partial-bhp10514649</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002322HU-SDS.jpg?v=1772280142</image:loc>
      <image:title>Recombinant Human Sodium/potassium-transporting ATPase subunit alpha-1 (ATP1A1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-low-affinity-immunoglobulin-gamma-fc-region-receptor-iii-a-fcgr3a-partial-active-bhp10514659</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008543HU1-SDS.jpg?v=1772280197</image:loc>
      <image:title>Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-erythropoietin-epo-active-bhp10514646</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP007743HU-SDS.jpg?v=1772280139</image:loc>
      <image:title>Recombinant Human Erythropoietin (EPO) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-gamma-ifng-bhp10514644</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011050HU1-SDS.jpg?v=1772280136</image:loc>
      <image:title>Recombinant Human Interferon gamma (IFNG)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-macrophage-colony-stimulating-factor-1-csf1-partial-bhp10514653</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP006043MOd7-SDS.jpg?v=1772280137</image:loc>
      <image:title>Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ly6-plaur-domain-containing-protein-3-lypd3-bhp10514641</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP013263HU-SDS.jpg?v=1772280198</image:loc>
      <image:title>Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-coxiella-burnetii-chaperonin-groel-groel-partial-bhp10514667</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP323108DXP-SDS.jpg?v=1772280123</image:loc>
      <image:title>Recombinant Coxiella burnetii Chaperonin GroEL (groEL), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cowpea-chlorotic-mottle-virus-capsid-protein-orf3b-bhp10514648</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361103CRC-SDS.jpg?v=1772280119</image:loc>
      <image:title>Recombinant Cowpea chlorotic mottle virus Capsid protein (ORF3b)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-macrophage-colony-stimulating-factor-1-csf1-partial-bhp10514654</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP006043MO1-SDS.jpg?v=1772280149</image:loc>
      <image:title>Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-complement-factor-h-cfh-partial-bhp10514657</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005273HU_F1_-SDS.jpg?v=1772280125</image:loc>
      <image:title>Recombinant Human Complement factor H (CFH), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-complement-factor-h-cfh-partial-bhp10514658</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005273HU_F1_d9-SDS.jpg?v=1772280131</image:loc>
      <image:title>Recombinant Human Complement factor H (CFH), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kallikrein-2-klk2-bhp10514670</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP012453HU-SDS.jpg?v=1772280149</image:loc>
      <image:title>Recombinant Human Kallikrein-2 (KLK2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-13-il13-bhp10514668</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011590MO-SDS.jpg?v=1772280138</image:loc>
      <image:title>Recombinant Mouse Interleukin-13 (Il13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-phenol-soluble-modulin-alpha-3-peptide-psma3-bhp10514662</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP315229SKV-SDS.jpg?v=1772280137</image:loc>
      <image:title>Recombinant Staphylococcus aureus Phenol-soluble modulin alpha 3 peptide (psmA3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytotoxic-t-lymphocyte-protein-4-ctla4-partial-bhp10514665</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006163HU2d7-SDS.jpg?v=1772280142</image:loc>
      <image:title>Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-oxysterol-binding-protein-1-osbp-partial-bhp10514671</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017243HU-SDS.jpg?v=1772280145</image:loc>
      <image:title>Recombinant Human Oxysterol-binding protein 1 (OSBP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-4-receptor-subunit-alpha-il4r-partial-bhp10514672</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011661HU1-SDS.jpg?v=1772280144</image:loc>
      <image:title>Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-flavin-containing-monooxygenase-3-fmo3-partial-bhp10514675</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF008749HU2-SDS.jpg?v=1772280136</image:loc>
      <image:title>Recombinant Human Flavin-containing monooxygenase 3 (FMO3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glutamine-synthetase-glul-bhp10514663</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009553HU-SDS.jpg?v=1772280143</image:loc>
      <image:title>Recombinant Human Glutamine synthetase (GLUL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-phleum-pratense-profilin-1-pro1-bhp10514676</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017824EUQ-SDS.jpg?v=1772280137</image:loc>
      <image:title>Recombinant Phleum pratense Profilin-1 (PRO1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-3-il3-active-bhp10514660</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011652HUd7-SDS.jpg?v=1772280196</image:loc>
      <image:title>Recombinant Human Interleukin-3 (IL3) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-13-il13-bhp10514678</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011590HUc7-SDS.jpg?v=1772280214</image:loc>
      <image:title>Recombinant Human Interleukin-13 (IL13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-type-18-minor-capsid-protein-l2-l2-partial-bhp10514628</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6383HMN-SDS.jpg?v=1772280125</image:loc>
      <image:title>Recombinant Human papillomavirus type 18 Minor capsid protein L2 (L2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-gastric-inhibitory-polypeptide-gip-partial-bhp10514683</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP009434MO-SDS.jpg?v=1772280141</image:loc>
      <image:title>Recombinant Mouse Gastric inhibitory polypeptide (Gip), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-phleum-pratense-pollen-allergen-phl-p-1-phlpi-bhp10514680</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP331772EUQ-SDS.jpg?v=1772280146</image:loc>
      <image:title>Recombinant Phleum pratense Pollen allergen Phl p 1 (PHLPI)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-actin-related-protein-2-actr2-bhp10514686</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001248HU-SDS.jpg?v=1772280133</image:loc>
      <image:title>Recombinant Human Actin-related protein 2 (ACTR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-13-il13-bhp10514669</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011590MOa0-SDS.jpg?v=1772280143</image:loc>
      <image:title>Recombinant Mouse Interleukin-13 (Il13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-b-cell-antigen-receptor-complex-associated-protein-beta-chain-cd79b-partial-active-bhp10514679</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004958HU1-SDS.jpg?v=1772280208</image:loc>
      <image:title>Recombinant Human B-cell antigen receptor complex-associated protein beta chain (CD79B), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-actin-related-protein-3-actr3-bhp10514685</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001249HU-SDS.jpg?v=1772280134</image:loc>
      <image:title>Recombinant Human Actin-related protein 3 (ACTR3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-vaccinia-virus-envelope-protein-h3-opg108-x27s-x28s-x29s-partial-bhp10514673</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP329027VAD-SDS.jpg?v=1772280137</image:loc>
      <image:title>Recombinant Vaccinia virus Envelope protein H3 (OPG108) (X27S,X28S,X29S), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-herpesvirus-2-tegument-protein-vp16-ul48-bhp10514689</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP301548HXA-SDS.jpg?v=1772280134</image:loc>
      <image:title>Recombinant Human herpesvirus 2 Tegument protein VP16 (UL48)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-junctional-adhesion-molecule-a-f11r-partial-bhp10514701</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP648931CA-SDS.jpg?v=1772280130</image:loc>
      <image:title>Recombinant Cat Junctional adhesion molecule A (F11R), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-lactadherin-mfge8-bhp10514691</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013752PI-SDS.jpg?v=1772280136</image:loc>
      <image:title>Recombinant Pig Lactadherin (MFGE8)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-inhibin-beta-c-chain-inhbc-bhp10514684</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011721MO-SDS.jpg?v=1772280137</image:loc>
      <image:title>Recombinant Mouse Inhibin beta C chain (Inhbc)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-nepenthes-gracilis-aspartic-proteinase-nepenthesin-2-nep2-bhp10514706</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP765721NBAV-SDS.jpg?v=1772280146</image:loc>
      <image:title>Recombinant Nepenthes gracilis Aspartic proteinase nepenthesin-2 (nep2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-actin-alpha-skeletal-muscle-acta1-bhp10514688</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001205HU-SDS.jpg?v=1772280129</image:loc>
      <image:title>Recombinant Human Actin, alpha skeletal muscle(ACTA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-sulfolobus-solfataricus-reverse-gyrase-1-rgy1-partial-bhp10514712</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP850640FPM-SDS.jpg?v=1772280132</image:loc>
      <image:title>Recombinant Sulfolobus solfataricus Reverse gyrase 1 (rgy1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-v-type-proton-atpase-subunit-d-1-atp6v0d1-bhp10514687</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002390HUd7-SDS.jpg?v=1772280143</image:loc>
      <image:title>Recombinant Human V-type proton ATPase subunit d 1 (ATP6V0D1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-platelet-glycoprotein-vi-gp6-partial-active-bhp10514715</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP872550HU-SDS.jpg?v=1772280145</image:loc>
      <image:title>Recombinant Human Platelet glycoprotein VI (GP6), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-coagulation-factor-ix-f9-bhp10514664</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007936MO_A4_-SDS.jpg?v=1772280204</image:loc>
      <image:title>Recombinant Mouse Coagulation factor IX (F9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ly6-plaur-domain-containing-protein-3-lypd3-bhp10514711</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP849681MO-SDS.jpg?v=1772280194</image:loc>
      <image:title>Recombinant Mouse Ly6/PLAUR domain-containing protein 3 (Lypd3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rickettsia-conorii-chaperonin-groel-groel-partial-biotinylated-bhp10514728</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP835785RMS-B-SDS.jpg?v=1772280141</image:loc>
      <image:title>Recombinant Rickettsia conorii Chaperonin GroEL (groEL), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-campylobacter-jejuni-subsp-jejuni-serotype-o-2-cytolethal-distending-toxin-subunit-a-cdta-bhp10514695</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP611301CZA-SDS.jpg?v=1772280131</image:loc>
      <image:title>Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Cytolethal distending toxin subunit A (cdtA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o157-h7-transcriptional-regulatory-protein-qseb-qseb-bhp10514710</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP848922EOD-SDS.jpg?v=1772280136</image:loc>
      <image:title>Recombinant Escherichia coli O157:H7 Transcriptional regulatory protein qseB (qseB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacillus-subtilis-biofilm-surface-layer-protein-a-bsla-bhp10514690</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP300296BRJ1-SDS.jpg?v=1772280147</image:loc>
      <image:title>Recombinant Bacillus subtilis Biofilm-surface layer protein A (bslA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-gastric-inhibitory-polypeptide-gip-partial-bhp10514682</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009434MO1-SDS.jpg?v=1772280192</image:loc>
      <image:title>Recombinant Mouse Gastric inhibitory polypeptide (Gip), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-6b-tnfrsf6b-bhp10514727</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023982HUd7-SDS.jpg?v=1772280133</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 6B (TNFRSF6B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-insulin-like-growth-factor-binding-protein-1-igfbp1-bhp10514681</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011095MO-SDS.jpg?v=1772280140</image:loc>
      <image:title>Recombinant Mouse Insulin-like growth factor-binding protein 1 (Igfbp1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-helicobacter-pylori-neuraminyllactose-binding-hemagglutinin-hpaa-bhp10514702</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP671877HUS-SDS.jpg?v=1772280141</image:loc>
      <image:title>Recombinant Helicobacter pylori Neuraminyllactose-binding hemagglutinin (hpaA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-general-transcription-factor-ii-i-gtf2i-partial-bhp10514714</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP875371MO-SDS.jpg?v=1772280135</image:loc>
      <image:title>Recombinant Mouse General transcription factor II-I (Gtf2i), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cynomolgus-monkey-activin-receptor-type-2b-acvr2b-partial-active-bhp10514698</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP623829HUi9-SDS.jpg?v=1772280145</image:loc>
      <image:title>Recombinant Human/Cynomolgus monkey Activin receptor type-2B (ACVR2B), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-ly6-plaur-domain-containing-3-lypd3-partial-active-bhp10514723</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6357MOV1-SDS.jpg?v=1772280137</image:loc>
      <image:title>Recombinant Macaca fascicularis LY6/PLAUR domain containing 3 (LYPD3), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-haemolyticus-cold-shock-protein-cspa-cspa-bhp10514703</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP680357SBAH-SDS.jpg?v=1772280137</image:loc>
      <image:title>Recombinant Staphylococcus haemolyticus Cold shock protein CspA (cspA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-receptor-superfamily-member-16-ngfr-partial-bhp10514721</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP6393MO-SDS.jpg?v=1772280202</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor receptor superfamily member 16 (Ngfr), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-syntaxin-binding-protein-6-stxbp6-bhp10514709</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP854512MO-SDS.jpg?v=1772280143</image:loc>
      <image:title>Recombinant Mouse Syntaxin-binding protein 6 (Stxbp6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-protease-serine-13-tmprss13-partial-bhp10514713</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP863154HU-SDS.jpg?v=1772280137</image:loc>
      <image:title>Recombinant Human Transmembrane protease serine 13 (TMPRSS13), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ly6-plaur-domain-containing-protein-3-lypd3-partial-active-bhp10514722</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP849681MO1-SDS.jpg?v=1772280137</image:loc>
      <image:title>Recombinant Mouse Ly6/PLAUR domain-containing protein 3 (Lypd3), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bk-polyomavirus-agnoprotein-partial-biotinylated-bhp10514734</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP325721BGZ-B-SDS.jpg?v=1772280146</image:loc>
      <image:title>Recombinant BK polyomavirus Agnoprotein, partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cd44-antigen-cd44-476-505aa-partial-bhp10514724</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004938HU_F3_M_-SDS.jpg?v=1772280136</image:loc>
      <image:title>Recombinant Human CD44 antigen (CD44) (△476-505aa), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-13-il13-bhp10514677</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011590HU-SDS.jpg?v=1772280143</image:loc>
      <image:title>Recombinant Human Interleukin-13 (IL13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hydroxymethylglutaryl-coa-synthase-mitochondrial-hmgcs2-bhp10514729</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010567HU-SDS.jpg?v=1772280146</image:loc>
      <image:title>Recombinant Human Hydroxymethylglutaryl-CoA synthase, mitochondrial (HMGCS2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-corylus-avellana-major-pollen-allergen-cor-a-1-isoforms-5-6-11-and-16-bhp10514693</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP600490CBAD-SDS.jpg?v=1772280138</image:loc>
      <image:title>Recombinant Corylus avellana Major pollen allergen Cor a 1 isoforms 5, 6, 11 and 16</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunoglobulin-j-chain-jchain-bhp10514730</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011337HUa2-SDS.jpg?v=1772280131</image:loc>
      <image:title>Recombinant Human Immunoglobulin J chain (JCHAIN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-netrin-4-ntn4-partial-bhp10514725</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP881014HU2-SDS.jpg?v=1772280213</image:loc>
      <image:title>Recombinant Human Netrin-4 (NTN4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-babesia-gibsoni-thrombospondin-related-adhesive-protein-bgtrap-partial-bhp10514738</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5951GXM-SDS.jpg?v=1772280138</image:loc>
      <image:title>Recombinant Babesia gibsoni Thrombospondin-related adhesive protein (BgTRAP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-saimiri-boliviensis-boliviensis-cathepsin-s-ctss-bhp10514731</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006204SWC-SDS.jpg?v=1772280140</image:loc>
      <image:title>Recombinant Saimiri boliviensis boliviensis Cathepsin S (CTSS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-n-acetylated-alpha-linked-acidic-dipeptidase-2-naalad2-partial-biotinylated-bhp10514719</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP896715HU2-B-SDS.jpg?v=1772280132</image:loc>
      <image:title>Recombinant Human N-acetylated-alpha-linked acidic dipeptidase 2 (NAALAD2), partial,Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-formamidopyrimidine-dna-glycosylase-mutm-bhp10514739</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361544ENV-SDS.jpg?v=1772280137</image:loc>
      <image:title>Recombinant Escherichia coli Formamidopyrimidine-DNA glycosylase (mutM)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-long-chain-fatty-acid-coa-ligase-1-acsl1-partial-bhp10514736</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001191HU1-SDS.jpg?v=1772280133</image:loc>
      <image:title>Recombinant Human Long-chain-fatty-acid--CoA ligase 1 (ACSL1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-eukaryotic-translation-initiation-factor-4e-type-2-eif4e2-bhp10514737</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007558HU-SDS.jpg?v=1772280138</image:loc>
      <image:title>Recombinant Human Eukaryotic translation initiation factor 4E type 2 (EIF4E2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fatty-acid-coa-ligase-acsl3-acsl3-partial-bhp10514726</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001192HU1-SDS.jpg?v=1772280135</image:loc>
      <image:title>Recombinant Human Fatty acid CoA ligase Acsl3 (ACSL3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-chloramphenicol-acetyltransferase-cat-bhp10514744</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361725FKZ-SDS.jpg?v=1772280140</image:loc>
      <image:title>Recombinant Staphylococcus aureus Chloramphenicol acetyltransferase (cat)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-helicobacter-pylori-flagellin-a-flaa-partial-bhp10514745</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP357950HUV-SDS.jpg?v=1772280139</image:loc>
      <image:title>Recombinant Helicobacter pylori Flagellin A (flaA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ryanodine-receptor-1-ryr1-partial-bhp10514732</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020619HU1-SDS.jpg?v=1772280137</image:loc>
      <image:title>Recombinant Human Ryanodine receptor 1 (RYR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-ferredoxin-thioredoxin-reductase-catalytic-chain-chloroplastic-ftrc-bhp10514747</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP871086DOA-SDS.jpg?v=1772280140</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic (FTRC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-coagulation-factor-x-f10-bhp10514704</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007915RA_A4_-SDS.jpg?v=1772280207</image:loc>
      <image:title>Recombinant Rat Coagulation factor X (F10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-alpha-actinin-1-actn1-partial-bhp10514735</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP766510MO-SDS.jpg?v=1772280133</image:loc>
      <image:title>Recombinant Mouse Alpha-actinin-1 (Actn1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-discosoma-sp-red-fluorescent-protein-drfp583-bhp10514717</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP871365DEAH-SDS.jpg?v=1772280137</image:loc>
      <image:title>Recombinant Discosoma sp. Red fluorescent protein drFP583</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-actin-binding-lim-protein-1-ablim1-partial-bhp10514740</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP809113MO-SDS.jpg?v=1772280140</image:loc>
      <image:title>Recombinant Mouse Actin-binding LIM protein 1 (Ablim1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-microfibrillar-associated-protein-2-mfap2-bhp10514743</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013746MO-SDS.jpg?v=1772280137</image:loc>
      <image:title>Recombinant Mouse Microfibrillar-associated protein 2 (Mfap2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-nad-p-h-dehydrogenase-quinone-lpda-284-301-bhp10514752</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6072FSG_M_-SDS.jpg?v=1772280143</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis NAD(P)H dehydrogenase (quinone) (lpdA) (Δ284-301)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-agalactiae-serotype-v-phosphate-import-atp-binding-protein-pstb-2-pstb2-bhp10514742</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP350534SMI-SDS.jpg?v=1772280139</image:loc>
      <image:title>Recombinant Streptococcus agalactiae serotype V Phosphate import ATP-binding protein PstB 2 (pstB2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-oryza-sativa-subsp-japonica-protein-photosystem-i-assembly-2-chloroplastic-psa2-bhp10514758</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP284910OFG-SDS.jpg?v=1772280220</image:loc>
      <image:title>Recombinant Oryza sativa subsp. japonica Protein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic (PSA2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rickettsia-helvetica-citrate-synthase-glta-bhp10514751</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006031RAAA-SDS.jpg?v=1772280143</image:loc>
      <image:title>Recombinant Rickettsia helvetica Citrate synthase (gltA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-af-9-mllt3-partial-bhp10514741</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP014635HU1-SDS.jpg?v=1772280140</image:loc>
      <image:title>Recombinant Human Protein AF-9 (MLLT3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-translationally-controlled-tumor-protein-homolog-tctp-bhp10514760</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP329057DOA-SDS.jpg?v=1772280153</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Translationally-controlled tumor protein homolog (TCTP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mumps-virus-nucleoprotein-n-bhp10514749</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP321907MJJ_A4_-SDS.jpg?v=1772280140</image:loc>
      <image:title>Recombinant Mumps virus Nucleoprotein (N)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-rna-polymerase-binding-transcription-factor-dksa-dksa-bhp10514755</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP359655ENV-SDS.jpg?v=1772280145</image:loc>
      <image:title>Recombinant Escherichia coli RNA polymerase-binding transcription factor DksA (dksA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-target-of-rapamycin-complex-subunit-lst8-1-lst8-1-bhp10514759</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6040DOA-SDS.jpg?v=1772280151</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Target of rapamycin complex subunit LST8-1 (LST8-1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-thioredoxin-m1-chloroplastic-bhp10514748</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP523718DOA-SDS.jpg?v=1772280140</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Thioredoxin M1, chloroplastic</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cavia-porcellus-lipocalin-cav-p-2-0101-lcncavp2-bhp10514772</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP306654GU-SDS.jpg?v=1772280153</image:loc>
      <image:title>Recombinant Cavia porcellus Lipocalin Cav p 2.0101 (Lcncavp2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-72-kda-type-iv-collagenase-mmp2-bhp10514765</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP014666RAa0-SDS.jpg?v=1772280216</image:loc>
      <image:title>Recombinant Rat 72 kDa type IV collagenase (Mmp2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bk-polyomavirus-small-t-antigen-biotinylated-bhp10514733</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP323595BGZ-B-SDS.jpg?v=1772280133</image:loc>
      <image:title>Recombinant BK polyomavirus Small t antigen, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-threonine-protein-phosphatase-2a-55-kda-regulatory-subunit-b-alpha-isoform-ppp2r2a-bhp10514766</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018564HU-SDS.jpg?v=1772280161</image:loc>
      <image:title>Recombinant Human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform (PPP2R2A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-autophagy-related-protein-2-homolog-a-atg2a-partial-bhp10514770</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP648779HU2-SDS.jpg?v=1772280146</image:loc>
      <image:title>Recombinant Human Autophagy-related protein 2 homolog A (ATG2A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prostaglandin-g-h-synthase-1-ptgs1-bhp10514764</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018985HU-SDS.jpg?v=1772280161</image:loc>
      <image:title>Recombinant Human Prostaglandin G/H synthase 1 (PTGS1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-orotidine-5-phosphate-decarboxylase-pyrf-bhp10514754</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP513317ENU-SDS.jpg?v=1772280150</image:loc>
      <image:title>Recombinant Escherichia coli Orotidine 5&apos;-phosphate decarboxylase (pyrF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-gossypium-hirsutum-nac-domain-protein-12-nac12-bhp10514756</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6254GHB-SDS.jpg?v=1772280209</image:loc>
      <image:title>Recombinant Gossypium hirsutum NAC domain protein 12 (NAC12)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-pup-protein-ligase-pafa-bhp10514750</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP353829MVZ-SDS.jpg?v=1772280138</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis Pup--protein ligase (pafA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-chemotaxis-protein-chey-chey-bhp10514762</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360065ENV-SDS.jpg?v=1772280151</image:loc>
      <image:title>Recombinant Escherichia coli Chemotaxis protein CheY (cheY)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kallikrein-2-klk2-bhp10514777</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012453HUg5-SDS.jpg?v=1772280235</image:loc>
      <image:title>Recombinant Human Kallikrein-2 (KLK2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-t4-small-outer-capsid-protein-soc-bhp10514753</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP366028EDZ-SDS.jpg?v=1772280145</image:loc>
      <image:title>Recombinant Enterobacteria phage T4 Small outer capsid protein (soc)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myc-proto-oncogene-protein-myc-bhp10514775</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015270HUm8-SDS.jpg?v=1772280149</image:loc>
      <image:title>Recombinant Human Myc proto-oncogene protein (MYC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-turtle-homolog-a-igsf9-partial-bhp10514782</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882181HU-SDS.jpg?v=1772280236</image:loc>
      <image:title>Recombinant Human Protein turtle homolog A (IGSF9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-enhancer-factor-tef-5-tead3-partial-bhp10514778</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP860344HU1-SDS.jpg?v=1772280152</image:loc>
      <image:title>Recombinant Human Transcriptional enhancer factor TEF-5(TEAD3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nucleoporin-p54-nup54-bhp10514773</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP800098HU-SDS.jpg?v=1772280216</image:loc>
      <image:title>Recombinant Human Nucleoporin p54 (NUP54)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-type-1-fimbrin-d-mannose-specific-adhesin-fimh-v48c-l55c-r81p-n91s-s99n-t179p-partial-bhp10514769</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP362349ENV1_M3_-SDS.jpg?v=1772280146</image:loc>
      <image:title>Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin (fimH) (V48C,L55C,R81P,N91S,S99N,T179P), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-threonine-protein-kinase-b-raf-braf-partial-bhp10514786</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002791HU3-SDS.jpg?v=1772280150</image:loc>
      <image:title>Recombinant Human Serine/threonine-protein kinase B-raf (BRAF), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-peroxisome-proliferator-activated-receptor-gamma-pparg-bhp10514796</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018424HUc7-SDS.jpg?v=1772280174</image:loc>
      <image:title>Recombinant Human Peroxisome proliferator-activated receptor gamma (PPARG)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-regakine-1-bhp10514776</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP307300BO-SDS.jpg?v=1772280227</image:loc>
      <image:title>Recombinant Bovine Regakine-1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-procollagen-c-endopeptidase-enhancer-2-pcolce2-bhp10514797</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017632MO-SDS.jpg?v=1772280229</image:loc>
      <image:title>Recombinant Mouse Procollagen C-endopeptidase enhancer 2 (Pcolce2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-danio-rerio-fatty-acid-binding-protein-10-a-liver-basic-fabp10a-bhp10514771</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP881243DIL-SDS.jpg?v=1772280150</image:loc>
      <image:title>Recombinant Danio rerio Fatty acid-binding protein 10-A, liver basic (fabp10a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-protein-phosphatase-chez-chez-bhp10514761</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP364334ENV-SDS.jpg?v=1772280220</image:loc>
      <image:title>Recombinant Escherichia coli Protein phosphatase CheZ (cheZ)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-434-protein-rexa-rexa-bhp10514757</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP303096FWQ-SDS.jpg?v=1772280144</image:loc>
      <image:title>Recombinant Enterobacteria phage 434 Protein rexA (rexA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-uricase-uox-bhp10514746</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025648MOc7-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Mouse Uricase (Uox)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-interleukin-17a-il17a-bhp10514779</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP724243BO-SDS.jpg?v=1772280227</image:loc>
      <image:title>Recombinant Bovine Interleukin-17A (IL17A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cytochrome-p450-2c55-cyp2c55-partial-bhp10514780</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP875232MO-SDS.jpg?v=1772280167</image:loc>
      <image:title>Recombinant Mouse Cytochrome P450 2C55 (Cyp2c55), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-trna-dihydrouridine-47-synthase-nad-p-and-like-dus3l-bhp10514774</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP842675HU-SDS.jpg?v=1772280226</image:loc>
      <image:title>Recombinant Human tRNA-dihydrouridine (47) synthase [NAD (P) (+)]-like (DUS3L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myelin-protein-p0-mpz-partial-bhp10514793</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP014774HUc0-SDS.jpg?v=1772280167</image:loc>
      <image:title>Recombinant Human Myelin protein P0 (MPZ), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-saccharomyces-cerevisiae-meiotic-recombination-protein-dmc1-dmc1-bhp10514785</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP338672SVG-SDS.jpg?v=1772280166</image:loc>
      <image:title>Recombinant Saccharomyces cerevisiae Meiotic recombination protein DMC1 (DMC1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transcription-factor-maff-maff-bhp10514767</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013318MO-SDS.jpg?v=1772280216</image:loc>
      <image:title>Recombinant Mouse Transcription factor MafF (Maff)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-osteoclast-stimulating-factor-1-ostf1-bhp10514799</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP737081MO-SDS.jpg?v=1772280239</image:loc>
      <image:title>Recombinant Mouse Osteoclast-stimulating factor 1 (Ostf1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nadh-dehydrogenase-ubiquinone-1-beta-subcomplex-subunit-1-ndufb1-bhp10514768</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EF015641HU_A4_-SDS.jpg?v=1772280148</image:loc>
      <image:title>Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 (NDUFB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-phage-ms2-capsid-protein-bhp10514801</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP365998ECZa2-SDS.jpg?v=1772280151</image:loc>
      <image:title>Recombinant Escherichia phage MS2 Capsid protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-eif5-mimic-protein-2-bzw1-bhp10514807</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP875108MO-SDS.jpg?v=1772280218</image:loc>
      <image:title>Recombinant Mouse eIF5-mimic protein 2 (Bzw1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gamma-aminobutyric-acid-receptor-associated-protein-like-1-gabarapl1-bhp10514802</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861986HUc7-SDS.jpg?v=1772280230</image:loc>
      <image:title>Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ferritin-light-chain-1-ftl1-bhp10514783</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009049MO-SDS.jpg?v=1772280226</image:loc>
      <image:title>Recombinant Mouse Ferritin light chain 1 (Ftl1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-polygalacturonase-inhibitor-2-pgip2-bhp10514784</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP878695DOA-SDS.jpg?v=1772280222</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Polygalacturonase inhibitor 2 (PGIP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-clathrin-interactor-1-clint1-bhp10514790</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005552HUc7-SDS.jpg?v=1772280231</image:loc>
      <image:title>Recombinant Human Clathrin interactor 1 (CLINT1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-beta-nerve-growth-factor-ngf-bhp10514798</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015779RA1g5-SDS.jpg?v=1772280226</image:loc>
      <image:title>Recombinant Rat Beta-nerve growth factor (Ngf)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-saccharomyces-cerevisiae-small-ribosomal-subunit-protein-rack1-asc1-bhp10514763</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP339901SVG-SDS.jpg?v=1772280220</image:loc>
      <image:title>Recombinant Saccharomyces cerevisiae Small ribosomal subunit protein RACK1 (ASC1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ferritin-heavy-chain-fth1-bhp10514787</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009030MO-SDS.jpg?v=1772280165</image:loc>
      <image:title>Recombinant Mouse Ferritin heavy chain (Fth1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-plasminogen-activator-inhibitor-2-macrophage-serpinb2-bhp10514794</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021070MO-SDS.jpg?v=1772280179</image:loc>
      <image:title>Recombinant Mouse Plasminogen activator inhibitor 2, macrophage (Serpinb2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-large-ribosomal-subunit-protein-ul2-rplb-bhp10514789</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP412679SUI-SDS.jpg?v=1772280170</image:loc>
      <image:title>Recombinant Staphylococcus aureus Large ribosomal subunit protein uL2 (rplB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neutral-amino-acid-transporter-9-slc38a9-partial-bhp10514795</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP836713HU-SDS.jpg?v=1772280226</image:loc>
      <image:title>Recombinant Human Neutral amino acid transporter 9 (SLC38A9),partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-19-il19-biotinylated-bhp10514800</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP883391HU-B-SDS.jpg?v=1772280155</image:loc>
      <image:title>Recombinant Human Interleukin-19 (IL19), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cyclic-amp-dependent-transcription-factor-atf-4-atf4-bhp10514804</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002272MOb0-SDS.jpg?v=1772280231</image:loc>
      <image:title>Recombinant Mouse Cyclic AMP-dependent transcription factor ATF-4 (Atf4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-h-2-class-ii-histocompatibility-antigen-a-b-alpha-chain-h2-aa-partial-bhp10514810</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP320375MO-SDS.jpg?v=1772280224</image:loc>
      <image:title>Recombinant Mouse H-2 class II histocompatibility antigen, A-B alpha chain (H2-Aa), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-l-amino-acid-oxidase-il4i1-partial-bhp10514815</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP850426HU1d7-SDS.jpg?v=1772280170</image:loc>
      <image:title>Recombinant Human L-amino-acid oxidase (IL4I1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-15-il15-bhp10514813</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011593HUc7-SDS.jpg?v=1772280231</image:loc>
      <image:title>Recombinant Human Interleukin-15 (IL15)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-threonine-protein-kinase-b-raf-braf-bhp10514811</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002791HU-SDS.jpg?v=1772280153</image:loc>
      <image:title>Recombinant Human Serine/threonine-protein kinase B-raf (BRAF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-synapsin-1-syn1-partial-bhp10514809</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023002HUc7-SDS.jpg?v=1772280232</image:loc>
      <image:title>Recombinant Human Synapsin-1 (SYN1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cytochrome-p450-2c70-cyp2c70-bhp10514791</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP820995MO-SDS.jpg?v=1772280230</image:loc>
      <image:title>Recombinant Mouse Cytochrome P450 2C70 (Cyp2c70)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-mucin-1-muc1-partial-bhp10514812</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP312543MO-SDS.jpg?v=1772280229</image:loc>
      <image:title>Recombinant Mouse Mucin-1 (Muc1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-roundabout-homolog-4-robo4-partial-bhp10514818</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP845177HU1d7-SDS.jpg?v=1772280173</image:loc>
      <image:title>Recombinant Human Roundabout homolog 4 (ROBO4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-prunus-persica-non-specific-serine-threonine-protein-kinase-bhp10514817</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5511EZKd7-SDS.jpg?v=1772280225</image:loc>
      <image:title>Recombinant Prunus persica non-specific serine/threonine protein kinase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-ly6-plaur-domain-containing-protein-3-lypd3-bhp10514823</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013263RA-SDS.jpg?v=1772280219</image:loc>
      <image:title>Recombinant Rat Ly6/PLAUR domain-containing protein 3 (Lypd3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-granzyme-a-gzma-bhp10514781</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010081MOm8-SDS.jpg?v=1772280152</image:loc>
      <image:title>Recombinant Mouse Granzyme A (Gzma)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sprouty-related-evh1-domain-containing-protein-1-spred1-bhp10514805</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP835669MO-SDS.jpg?v=1772280178</image:loc>
      <image:title>Recombinant Mouse Sprouty-related, EVH1 domain-containing protein 1 (Spred1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-influenza-b-virus-nucleoprotein-np-partial-bhp10514803</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP319610IIR-SDS.jpg?v=1772280174</image:loc>
      <image:title>Recombinant Influenza B virus Nucleoprotein (NP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-iggfc-binding-protein-fcgbp-partial-bhp10514808</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP896934HU-SDS.jpg?v=1772280234</image:loc>
      <image:title>Recombinant Human IgGFc-binding protein (FCGBP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vesicle-associated-membrane-protein-associated-protein-a-vapa-partial-bhp10514829</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP878947HU-SDS.jpg?v=1772280231</image:loc>
      <image:title>Recombinant Human Vesicle-associated membrane protein-associated protein A (VAPA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o157-h7-translation-initiation-factor-if-2-infb-partial-bhp10514831</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015164EOD-SDS.jpg?v=1772280173</image:loc>
      <image:title>Recombinant Escherichia coli O157:H7 Translation initiation factor IF-2 (infB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-thioredoxin-interacting-protein-txnip-bhp10514816</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP803849MOc7-SDS.jpg?v=1772280179</image:loc>
      <image:title>Recombinant Mouse Thioredoxin-interacting protein (Txnip)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ribosomal-protein-el39-like-2-rpl39l-bhp10514820</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP850285HU-SDS.jpg?v=1772280234</image:loc>
      <image:title>Recombinant Human Ribosomal protein eL39-like 2 (RPL39L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-13-il13-bhp10514835</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011590HUc7-SDS.jpg?v=1772280183</image:loc>
      <image:title>Recombinant Human Interleukin-13 (IL13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-tyrosine-phosphatase-ptprr-bhp10514792</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP624019HUc7-SDS.jpg?v=1772280170</image:loc>
      <image:title>Recombinant Human protein-tyrosine-phosphatase (PTPRR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-receptor-superfamily-member-16-ngfr-partial-bhp10514836</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6393MO-SDS.jpg?v=1772280175</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor receptor superfamily member 16 (Ngfr), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunoglobulin-j-chain-jchain-bhp10514839</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011337HUc7-SDS.jpg?v=1772280244</image:loc>
      <image:title>Recombinant Human Immunoglobulin J chain (JCHAIN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-yellow-fever-virus-genome-polyprotein-partial-biotinylated-bhp10514833</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP365905YAC1g10-B-SDS.jpg?v=1772280174</image:loc>
      <image:title>Recombinant Yellow fever virus Genome polyprotein, partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-macrophage-colony-stimulating-factor-1-csf1-partial-bhp10514806</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006043MO1-SDS.jpg?v=1772280223</image:loc>
      <image:title>Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-serine-protease-1-prss1-bhp10514826</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361971DOd7-SDS.jpg?v=1772280233</image:loc>
      <image:title>Recombinant Dog Serine protease 1 (PRSS1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-vaccinia-virus-envelope-protein-h3-opg108-partial-bhp10514825</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP324943VAA1d7-SDS.jpg?v=1772280228</image:loc>
      <image:title>Recombinant Vaccinia virus Envelope protein H3 (OPG108), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-thioredoxin-interacting-protein-txnip-partial-bhp10514830</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP803849MO1-SDS.jpg?v=1772280235</image:loc>
      <image:title>Recombinant Mouse Thioredoxin-interacting protein (Txnip), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rickettsia-slovaca-citrate-synthase-glta-bhp10514845</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006031RAAN-SDS.jpg?v=1772280177</image:loc>
      <image:title>Recombinant Rickettsia slovaca Citrate synthase (gltA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-11-beta-hydroxysteroid-dehydrogenase-1-hsd11b1-partial-bhp10514821</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010763HUd7-SDS.jpg?v=1772280221</image:loc>
      <image:title>Recombinant Human 11-beta-hydroxysteroid dehydrogenase 1 (HSD11B1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-sp-group-g-immunoglobulin-g-binding-protein-g-spg-partial-bhp10514844</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP322577SNDc7-SDS.jpg?v=1772280172</image:loc>
      <image:title>Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-gamma-interferon-inducible-lysosomal-thiol-reductase-ifi30-bhp10514842</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP872152MO-SDS.jpg?v=1772280180</image:loc>
      <image:title>Recombinant Mouse Gamma-interferon-inducible lysosomal thiol reductase (Ifi30)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-von-hippel-lindau-disease-tumor-suppressor-vhl-bhp10514819</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025852HUd7-SDS.jpg?v=1772280225</image:loc>
      <image:title>Recombinant Human Von Hippel-Lindau disease tumor suppressor (VHL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-conus-radiatus-iota-conotoxin-like-r11c-bhp10514834</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP770335CPD-SDS.jpg?v=1772280173</image:loc>
      <image:title>Recombinant Conus radiatus Iota-conotoxin-like r11c</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-receptor-superfamily-member-3-ltbr-partial-active-bhp10514853</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013227MO-SDS.jpg?v=1772280173</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor receptor superfamily member 3 (Ltbr), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-filamin-c-flnc-partial-bhp10514814</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP613498HU-SDS.jpg?v=1772280222</image:loc>
      <image:title>Recombinant Human Filamin-C (FLNC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-prolactin-prl-bhp10514828</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018724BOd7-SDS.jpg?v=1772280232</image:loc>
      <image:title>Recombinant Bovine Prolactin (PRL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-thermotoga-neapolitana-endonuclease-v-nfi-bhp10514859</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP495840TNL-SDS.jpg?v=1772280181</image:loc>
      <image:title>Recombinant Thermotoga neapolitana Endonuclease V (nfi)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-myristoylated-alanine-rich-c-kinase-substrate-marcks-bhp10514822</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013493MO-SDS.jpg?v=1772280174</image:loc>
      <image:title>Recombinant Mouse Myristoylated alanine-rich C-kinase substrate (Marcks)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myelin-transcription-factor-1-myt1-partial-bhp10514827</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015387HUd7-SDS.jpg?v=1772280177</image:loc>
      <image:title>Recombinant Human Myelin transcription factor 1 (MYT1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-histone-h3-1-h3c1-bhp10514824</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010418HU2b0-SDS.jpg?v=1772280230</image:loc>
      <image:title>Recombinant Human Histone H3.1 (H3C1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-enhancer-binding-factor-2-ilf2-bhp10514832</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP614262HUd7-SDS.jpg?v=1772280158</image:loc>
      <image:title>Recombinant Human Interleukin enhancer-binding factor 2 (ILF2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-granulocyte-macrophage-colony-stimulating-factor-csf2-bhp10514848</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006045MOc7-SDS.jpg?v=1772280227</image:loc>
      <image:title>Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-thermotoga-neapolitana-endonuclease-v-nfi-bhp10514847</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP495840TNL-SDS.jpg?v=1772280179</image:loc>
      <image:title>Recombinant Thermotoga neapolitana Endonuclease V (nfi)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-prunus-persica-uncharacterized-protein-bhp10514862</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP6299EZK-SDS.jpg?v=1772280173</image:loc>
      <image:title>Recombinant Prunus persica Uncharacterized protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-lymphotoxin-beta-receptor-ltbr-partial-active-bhp10514854</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6176MOV-SDS.jpg?v=1772280179</image:loc>
      <image:title>Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ccn-family-member-5-ccn5-bhp10514837</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026120HU_A4_d7-SDS.jpg?v=1772280183</image:loc>
      <image:title>Recombinant Human CCN family member 5 (CCN5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-glycoprotein-42-bzlf2-partial-bhp10514856</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP313729EFC-SDS.jpg?v=1772280173</image:loc>
      <image:title>Recombinant Epstein-Barr virus Glycoprotein 42 (BZLF2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-wnt3a-surrogate-active-bhp10514855</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6073-SDS.jpg?v=1772280238</image:loc>
      <image:title>Recombinant Human Wnt3a surrogate (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-coactivator-yap1-yap1-bhp10514850</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026244HUd7-SDS.jpg?v=1772280236</image:loc>
      <image:title>Recombinant Human Transcriptional coactivator YAP1 (YAP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-h-2-class-ii-histocompatibility-antigen-a-b-alpha-chain-h2-aa-partial-bhp10514858</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP320375MO-SDS.jpg?v=1772280178</image:loc>
      <image:title>Recombinant Mouse H-2 class II histocompatibility antigen, A-B alpha chain (H2-Aa), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-colicin-ia-cia-bhp10514838</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361926ENLa0-SDS.jpg?v=1772280234</image:loc>
      <image:title>Recombinant Escherichia coli Colicin-Ia (cia)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-feline-herpesvirus-1-envelope-glycoprotein-d-us6-partial-bhp10514875</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5353FAJ-SDS.jpg?v=1772280178</image:loc>
      <image:title>Recombinant Feline herpesvirus 1 Envelope glycoprotein D (US6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibulin-7-fbln7-bhp10514849</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP687502HU-SDS.jpg?v=1772280161</image:loc>
      <image:title>Recombinant Human Fibulin-7 (FBLN7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-alkaline-phosphatase-germ-cell-type-alpg-active-bhp10514851</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP4962MO-SDS.jpg?v=1772280176</image:loc>
      <image:title>Recombinant Mouse Alkaline phosphatase, germ cell type (Alpg) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-zinc-finger-and-btb-domain-containing-protein-10-zbtb10-partial-bhp10514840</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP853404HU-SDS.jpg?v=1772280238</image:loc>
      <image:title>Recombinant Human Zinc finger and BTB domain-containing protein 10 (ZBTB10), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-envelope-glycoprotein-gp350-bllf1-partial-bhp10514874</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP360986EFA-SDS.jpg?v=1772280179</image:loc>
      <image:title>Recombinant Epstein-Barr virus envelope glycoprotein GP350 (BLLF1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-glycine-max-protein-kinase-domain-containing-protein-partial-bhp10514871</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP5551GGV-SDS.jpg?v=1772280176</image:loc>
      <image:title>Recombinant Glycine max Protein kinase domain-containing protein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-gamma-hemolysin-component-a-hlga-bhp10514857</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP362888SKY-SDS.jpg?v=1772280182</image:loc>
      <image:title>Recombinant Staphylococcus aureus Gamma-hemolysin component A (hlgA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-desmoglein-3-dsg3-partial-bhp10514872</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP007205MOd7-SDS.jpg?v=1772280181</image:loc>
      <image:title>Recombinant Mouse Desmoglein-3 (Dsg3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-filamin-c-flnc-partial-bhp10514860</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP613498HU-SDS.jpg?v=1772280181</image:loc>
      <image:title>Recombinant Human Filamin-C (FLNC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-2-il2-active-bhp10514883</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011629HUd7-SDS.jpg?v=1772280184</image:loc>
      <image:title>Recombinant Human Interleukin-2 (IL2) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atp-dependent-rna-helicase-ddx3x-ddx3x-bhp10514868</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP006621HUd7-SDS.jpg?v=1772280177</image:loc>
      <image:title>Recombinant Human ATP-dependent RNA helicase DDX3X (DDX3X )</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-glutamine-gamma-glutamyltransferase-k-tgm1-partial-bhp10514846</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023461HU-SDS.jpg?v=1772280238</image:loc>
      <image:title>Recombinant Human Protein-glutamine gamma-glutamyltransferase K (TGM1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vesicle-associated-membrane-protein-associated-protein-a-vapa-partial-bhp10514861</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP878947HU-SDS.jpg?v=1772280173</image:loc>
      <image:title>Recombinant Human Vesicle-associated membrane protein-associated protein A (VAPA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-nephrin-nphs1-partial-bhp10514865</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP870792MO-SDS.jpg?v=1772280173</image:loc>
      <image:title>Recombinant Mouse Nephrin (Nphs1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-glycine-max-protein-kinase-domain-containing-protein-partial-bhp10514870</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP6247GGV-SDS.jpg?v=1772280176</image:loc>
      <image:title>Recombinant Glycine max Protein kinase domain-containing protein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-seoul-virus-envelopment-polyprotein-gp-partial-bhp10514867</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP330255SFE1-SDS.jpg?v=1772280174</image:loc>
      <image:title>Recombinant Seoul virus Envelopment polyprotein (GP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-conus-radiatus-iota-conotoxin-like-r11c-bhp10514864</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP770335CPD-SDS.jpg?v=1772280181</image:loc>
      <image:title>Recombinant Conus radiatus Iota-conotoxin-like r11c</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-corticotropin-releasing-factor-receptor-1-crhr1-partial-bhp10514869</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP005965HU-SDS.jpg?v=1772280174</image:loc>
      <image:title>Recombinant Human Corticotropin-releasing factor receptor 1 (CRHR1 ), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-delta-like-protein-4-dll4-partial-active-bhp10514885</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP878862HU-SDS.jpg?v=1772280184</image:loc>
      <image:title>Recombinant Human Delta-like protein 4 (DLL4), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glyceraldehyde-3-phosphate-dehydrogenase-gapdh-bhp10514889</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009232HU_A4_-SDS.jpg?v=1772280184</image:loc>
      <image:title>Recombinant Human Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-casein-kinase-i-isoform-delta-csnk1d-bhp10514866</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP006067HU-SDS.jpg?v=1772280168</image:loc>
      <image:title>Recombinant Human Casein kinase I isoform delta (CSNK1D )</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-myristoylated-alanine-rich-c-kinase-substrate-marcks-bhp10514876</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013493MO-SDS.jpg?v=1772280181</image:loc>
      <image:title>Recombinant Mouse Myristoylated alanine-rich C-kinase substrate (Marcks)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-receptor-type-tyrosine-protein-phosphatase-alpha-ptpra-partial-bhp10514882</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP019047HU1-SDS.jpg?v=1772280183</image:loc>
      <image:title>Recombinant Human Receptor-type tyrosine-protein phosphatase alpha (PTPRA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-platelet-derived-growth-factor-d-pdgfd-partial-bhp10514881</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP887935HU1-SDS.jpg?v=1772280183</image:loc>
      <image:title>Recombinant Human Platelet-derived growth factor D (PDGFD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-herv-h-ltr-associating-protein-2-hhla2-partial-bhp10514884</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP891555HU1-SDS.jpg?v=1772280184</image:loc>
      <image:title>Recombinant Human HERV-H LTR-associating protein 2 (HHLA2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-surface-glycoprotein-cd3-epsilon-chain-cd3e-partial-bhp10514888</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004931HUd7-SDS.jpg?v=1772280188</image:loc>
      <image:title>Recombinant Human T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-growth-arrest-specific-6-gas6-bhp10514898</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5039MOV-SDS.jpg?v=1772280188</image:loc>
      <image:title>Recombinant Macaca fascicularis Growth arrest specific 6 (GAS6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-serratia-marcescens-nuclease-nuca-bhp10514863</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP319580SYN-SDS.jpg?v=1772280179</image:loc>
      <image:title>Recombinant Serratia marcescens Nuclease (nucA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-muscle-skeletal-receptor-tyrosine-protein-kinase-musk-partial-bhp10514886</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP730715MO-SDS.jpg?v=1772280185</image:loc>
      <image:title>Recombinant Mouse Muscle, skeletal receptor tyrosine-protein kinase (Musk), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-6-il6-bhp10514890</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011664HUc9-SDS.jpg?v=1772280188</image:loc>
      <image:title>Recombinant Human Interleukin-6 (IL6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-alpha-beta-receptor-2-ifnar2-partial-bhp10514891</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011047HU-SDS.jpg?v=1772280185</image:loc>
      <image:title>Recombinant Human Interferon alpha/beta receptor 2 (IFNAR2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-adenylyl-cyclase-associated-protein-1-cap1-bhp10514843</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004486HUc7-SDS.jpg?v=1772280181</image:loc>
      <image:title>Recombinant Human Adenylyl cyclase-associated protein 1 (CAP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-3-ltbr-partial-active-bhp10514852</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013227HU1-SDS.jpg?v=1772280180</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibulin-7-fbln7-bhp10514873</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP687502HU-SDS.jpg?v=1772280178</image:loc>
      <image:title>Recombinant Human Fibulin-7 (FBLN7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-nectin-cell-adhesion-molecule-2-nectin2-partial-active-bhp10514897</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5776MOV-SDS.jpg?v=1772280190</image:loc>
      <image:title>Recombinant Macaca fascicularis Nectin cell adhesion molecule 2 (NECTIN2), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pro-epidermal-growth-factor-egf-partial-bhp10514896</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007473HUd9-SDS.jpg?v=1772280187</image:loc>
      <image:title>Recombinant Human Pro-epidermal growth factor (EGF), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-potassium-transporting-atpase-subunit-alpha-1-atp1a1-partial-bhp10514877</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002322HUp2-SDS.jpg?v=1772280181</image:loc>
      <image:title>Recombinant Human Sodium/potassium-transporting ATPase subunit alpha-1 (ATP1A1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-cd300a-molecule-cd300a-partial-bhp10514905</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5430MOV-SDS.jpg?v=1772280191</image:loc>
      <image:title>Recombinant Macaca fascicularis CD300a molecule (CD300A) , partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-v-type-immunoglobulin-domain-containing-suppressor-of-t-cell-activation-vsir-partial-active-bhp10514887</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP884484HU-SDS.jpg?v=1772280185</image:loc>
      <image:title>Recombinant Human V-type immunoglobulin domain-containing suppressor of T-cell activation (VSIR), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-2-receptor-subunit-alpha-il2ra-partial-active-bhp10514893</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011649MO1-SDS.jpg?v=1772280185</image:loc>
      <image:title>Recombinant Mouse Interleukin-2 receptor subunit alpha (Il2ra), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-natural-cytotoxicity-triggering-receptor-3-ncr3-partial-active-bhp10514894</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015551HU1-SDS.jpg?v=1772280188</image:loc>
      <image:title>Recombinant Human Natural cytotoxicity triggering receptor 3 (NCR3), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-single-ig-il-1-related-receptor-sigirr-partial-bhp10514910</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP743558HUd9-SDS.jpg?v=1772280192</image:loc>
      <image:title>Recombinant Human Single Ig IL-1-related receptor (SIGIRR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ciliary-neurotrophic-factor-receptor-subunit-alpha-cntfr-bhp10514899</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005684HU-SDS.jpg?v=1772280188</image:loc>
      <image:title>Recombinant Human Ciliary neurotrophic factor receptor subunit alpha (CNTFR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-toll-like-receptor-7-tlr7-partial-bhp10514921</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023606MOd9-SDS.jpg?v=1772280195</image:loc>
      <image:title>Recombinant Mouse Toll-like receptor 7 (Tlr7), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-latent-membrane-protein-1-variant-lmp1-partial-bhp10514907</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5690EFC-SDS.jpg?v=1772280192</image:loc>
      <image:title>Recombinant Epstein-Barr virus latent membrane protein 1 variant (LMP1) , partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-v-set-domain-containing-t-cell-activation-inhibitor-1-vtcn1-partial-bhp10514903</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP801822HU1-SDS.jpg?v=1772280189</image:loc>
      <image:title>Recombinant Human V-set domain-containing T-cell activation inhibitor 1 (VTCN1) , partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ciliary-neurotrophic-factor-cntf-bhp10514900</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005683HU-SDS.jpg?v=1772280187</image:loc>
      <image:title>Recombinant Human Ciliary neurotrophic factor (CNTF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-macrophage-colony-stimulating-factor-1-csf1-partial-active-bhp10514892</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006043MO-SDS.jpg?v=1772280187</image:loc>
      <image:title>Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-interleukin-13-il13-active-bhp10514925</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP868226DO-SDS.jpg?v=1772280196</image:loc>
      <image:title>Recombinant Dog Interleukin-13 (IL13) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-sp-group-g-immunoglobulin-g-binding-protein-g-spg-partial-bhp10514904</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP322577SNDd7-SDS.jpg?v=1772280189</image:loc>
      <image:title>Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg) , partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-6-il6-biotinylated-bhp10514906</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011664HUp5-B-SDS.jpg?v=1772280211</image:loc>
      <image:title>Recombinant Human Interleukin-6 (IL6), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-parathyroid-hormone-parathyroid-hormone-related-peptide-receptor-pth1r-partial-active-bhp10514901</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP018988HU-SDS.jpg?v=1772280189</image:loc>
      <image:title>Recombinant Human Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cell-adhesion-molecule-ceacam5-ceacam5-partial-bhp10514913</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005165HUd9-SDS.jpg?v=1772280195</image:loc>
      <image:title>Recombinant Human Cell adhesion molecule CEACAM5 (CEACAM5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-signal-transducer-cd24-cd24-partial-biotinylated-bhp10514902</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004902HU-B-SDS.jpg?v=1772280189</image:loc>
      <image:title>Recombinant Human Signal transducer CD24 (CD24), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-coagulation-factor-xi-f11-active-bhp10514918</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5433MOW-SDS.jpg?v=1772280207</image:loc>
      <image:title>Recombinant Macaca mulatta Coagulation factor XI (F11) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-gastric-inhibitory-polypeptide-receptor-gipr-partial-bhp10514915</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009438MO1d9-SDS.jpg?v=1772280193</image:loc>
      <image:title>Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ataxin-3-atxn3-bhp10514920</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP863445MO-SDS.jpg?v=1772280190</image:loc>
      <image:title>Recombinant Mouse Ataxin-3 (Atxn3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-natural-cytotoxicity-triggering-receptor-3-ligand-1-ncr3lg1-partial-biotinylated-active-bhp10514908</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP737873HU-B-SDS.jpg?v=1772280191</image:loc>
      <image:title>Recombinant Human Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial, Biotinylated (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-turtle-homolog-a-igsf9-partial-bhp10514930</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP882181HUd7-SDS.jpg?v=1772280196</image:loc>
      <image:title>Recombinant Human Protein turtle homolog A (IGSF9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-desmoglein-3-dsg3-partial-bhp10514923</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007205HUj8-SDS.jpg?v=1772280192</image:loc>
      <image:title>Recombinant Human Desmoglein-3 (DSG3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-early-activation-antigen-cd69-cd69-partial-bhp10514914</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004952HUd9-SDS.jpg?v=1772280205</image:loc>
      <image:title>Recombinant Human Early activation antigen CD69 (CD69), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-type-lectin-domain-family-4-member-g-clec4g-partial-bhp10514926</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP744269HU1-SDS.jpg?v=1772280200</image:loc>
      <image:title>Recombinant Human C-type lectin domain family 4 member G (CLEC4G), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-insulin-1-ins1-bhp10514931</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP355622RA-SDS.jpg?v=1772280198</image:loc>
      <image:title>Recombinant Rat Insulin-1 (Ins1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-desmoglein-3-dsg3-partial-bhp10514922</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007205HUj8-s-SDS.jpg?v=1772280193</image:loc>
      <image:title>Recombinant Human Desmoglein-3 (DSG3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-b-cell-antigen-receptor-complex-associated-protein-beta-chain-cd79b-partial-active-bhp10514945</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004958HU1p7-SDS.jpg?v=1772280197</image:loc>
      <image:title>Recombinant Human B-cell antigen receptor complex-associated protein beta chain (CD79B), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-glial-fibrillary-acidic-protein-gfap-bhp10514934</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009369MOc7-SDS.jpg?v=1772280200</image:loc>
      <image:title>Recombinant Mouse Glial fibrillary acidic protein (Gfap)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-3-il3-active-bhp10514942</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011652HU-SDS.jpg?v=1772280196</image:loc>
      <image:title>Recombinant Human Interleukin-3 (IL3) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-coagulation-factor-x-f10-bhp10514929</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007915BO_A4_-SDS.jpg?v=1772280194</image:loc>
      <image:title>Recombinant Bovine Coagulation factor X (F10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-disintegrin-and-metalloproteinase-domain-containing-protein-9-adam9-partial-bhp10514947</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP730719MO-SDS.jpg?v=1772280197</image:loc>
      <image:title>Recombinant Mouse Disintegrin and metalloproteinase domain-containing protein 9 (Adam9), Partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cavia-porcellus-lipocalin-cav-p-2-0101-lcncavp2-bhp10514932</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP306654GU-SDS.jpg?v=1772280195</image:loc>
      <image:title>Recombinant Cavia porcellus Lipocalin Cav p 2.0101 (Lcncavp2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cd79a-and-cd79b-heterodimer-protein-active-bhp10514948</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5861HU-SDS.jpg?v=1772280199</image:loc>
      <image:title>Recombinant Human CD79A&amp;CD79B Heterodimer Protein (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cd40-ligand-cd40lg-partial-active-bhp10514924</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004937MO1-SDS.jpg?v=1772280192</image:loc>
      <image:title>Recombinant Mouse CD40 ligand (Cd40lg), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-b-cell-antigen-receptor-complex-associated-protein-alpha-chain-cd79a-partial-active-bhp10514944</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004957HU1p6-SDS.jpg?v=1772280197</image:loc>
      <image:title>Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-surface-antigen-cd2-cd2-partial-active-bhp10514909</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004894HU-SDS.jpg?v=1772280193</image:loc>
      <image:title>Recombinant Human T-cell surface antigen CD2 (CD2), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-inactive-tyrosine-protein-kinase-7-ptk7-partial-bhp10514938</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP804364MO-SDS.jpg?v=1772280201</image:loc>
      <image:title>Recombinant Mouse Inactive tyrosine-protein kinase 7 (Ptk7), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-disintegrin-and-metalloproteinase-domain-containing-protein-9-adam9-partial-active-bhp10514941</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP618774HU-SDS.jpg?v=1772280196</image:loc>
      <image:title>Recombinant Human Disintegrin and metalloproteinase domain-containing protein 9 (ADAM9), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-candida-albicans-agglutinin-like-protein-3-als3-partial-bhp10514953</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6452CZF-SDS.jpg?v=1772280198</image:loc>
      <image:title>Recombinant Candida albicans Agglutinin-like protein 3 (ALS3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-muellerian-inhibiting-factor-amh-partial-bhp10514954</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001666BO1b1-SDS.jpg?v=1772280198</image:loc>
      <image:title>Recombinant Bovine Muellerian-inhibiting factor (AMH), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-amphiphysin-amph-bhp10514955</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001683HU-SDS.jpg?v=1772280199</image:loc>
      <image:title>Recombinant Human Amphiphysin (AMPH)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-13-il13-active-bhp10514940</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6408HU-SDS.jpg?v=1772280198</image:loc>
      <image:title>Recombinant Human Interleukin-13 (IL13) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chicken-bifunctional-purine-biosynthesis-protein-atic-atic-partial-bhp10514956</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002299CH-SDS.jpg?v=1772280197</image:loc>
      <image:title>Recombinant Chicken Bifunctional purine biosynthesis protein ATIC (ATIC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cd40-ligand-cd40lg-partial-bhp10514936</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP004937MO1-SDS.jpg?v=1772280196</image:loc>
      <image:title>Recombinant Mouse CD40 ligand (Cd40lg), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bbsome-complex-member-bbs1-bbs1-bhp10514962</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP836736HU-SDS.jpg?v=1772280200</image:loc>
      <image:title>Recombinant Human BBSome complex member BBS1 (BBS1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-aldehyde-dehydrogenase-mitochondrial-aldh2-bhp10514952</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001571HU-SDS.jpg?v=1772280199</image:loc>
      <image:title>Recombinant Human Aldehyde dehydrogenase, mitochondrial (ALDH2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-putative-bcor-like-protein-2-bcorp1-bhp10514963</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP843290HU-SDS.jpg?v=1772280198</image:loc>
      <image:title>Recombinant Human Putative BCoR-like protein 2 (BCORP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-leukemia-inhibitory-factor-lif-bhp10514912</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP012928RA-SDS.jpg?v=1772280210</image:loc>
      <image:title>Recombinant Rat Leukemia inhibitory factor (Lif)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cathelicidin-antimicrobial-peptide-camp-bhp10514967</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004476MO-SDS.jpg?v=1772280200</image:loc>
      <image:title>Recombinant Mouse Cathelicidin antimicrobial peptide (Camp)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-thrombopoietin-thpo-active-bhp10514943</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023509HU_A4_-SDS.jpg?v=1772280197</image:loc>
      <image:title>Recombinant Human Thrombopoietin (THPO) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacillus-phage-phi29-histone-like-protein-p6-6-bhp10514949</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356118BBC-SDS.jpg?v=1772280198</image:loc>
      <image:title>Recombinant Bacillus phage phi29 Histone-like protein p6 (6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-yth-domain-containing-family-protein-1-ythdf1-partial-bhp10514927</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP874843HU1-SDS.jpg?v=1772280194</image:loc>
      <image:title>Recombinant Human YTH domain-containing family protein 1 (YTHDF1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ataxin-3-atxn3-bhp10514960</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP863445MOa0-SDS.jpg?v=1772280198</image:loc>
      <image:title>Recombinant Mouse Ataxin-3 (Atxn3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cavia-porcellus-lipocalin-cav-p-2-0101-lcncavp2-bhp10514933</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP306654GUa4-SDS.jpg?v=1772280199</image:loc>
      <image:title>Recombinant Cavia porcellus Lipocalin Cav p 2.0101 (Lcncavp2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-potassium-transporting-atpase-subunit-alpha-1-atp1a1-partial-bhp10514958</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002322HUb1-SDS.jpg?v=1772280203</image:loc>
      <image:title>Recombinant Human Sodium/potassium-transporting ATPase subunit alpha-1 (ATP1A1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atlastin-2-atl2-partial-bhp10514957</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP836776HU1-SDS.jpg?v=1772280199</image:loc>
      <image:title>Recombinant Human Atlastin-2 (ATL2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-long-chain-fatty-acid-coa-ligase-1-acsl1-partial-biotinylated-bhp10514950</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001191HU1-B-SDS.jpg?v=1772280198</image:loc>
      <image:title>Recombinant Human Long-chain-fatty-acid--CoA ligase 1 (ACSL1), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-agalactiae-c-protein-beta-antigen-bac-partial-bhp10514961</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP028048SMF-SDS.jpg?v=1772280203</image:loc>
      <image:title>Recombinant Streptococcus agalactiae C protein beta antigen (bac), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nucleolar-rna-helicase-2-ddx21-bhp10514982</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882081HU-SDS.jpg?v=1772280204</image:loc>
      <image:title>Recombinant Human Nucleolar RNA helicase 2 (DDX21)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-disintegrin-and-metalloproteinase-domain-containing-protein-9-adam9-partial-bhp10514946</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP618774HU1-SDS.jpg?v=1772280198</image:loc>
      <image:title>Recombinant Human Disintegrin and metalloproteinase domain-containing protein 9 (ADAM9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myc-proto-oncogene-protein-myc-bhp10514935</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015270HUc7-SDS.jpg?v=1772280194</image:loc>
      <image:title>Recombinant Human Myc proto-oncogene protein (MYC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bordetella-pertussis-brka-autotransporter-brka-partial-bhp10514965</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP673803BUA2c7-SDS.jpg?v=1772280202</image:loc>
      <image:title>Recombinant Bordetella pertussis BrkA autotransporter (brkA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-acetylcholine-receptor-subunit-epsilon-chrne-partial-bhp10514976</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005400HU1a0-SDS.jpg?v=1772280201</image:loc>
      <image:title>Recombinant Human Acetylcholine receptor subunit epsilon (CHRNE), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-soluble-calcium-activated-nucleotidase-1-cant1-partial-bhp10514968</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP848824HUc7-SDS.jpg?v=1772280202</image:loc>
      <image:title>Recombinant Human Soluble calcium-activated nucleotidase 1 (CANT1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-reactive-protein-crp-bhp10514978</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005991HU-SDS.jpg?v=1772280204</image:loc>
      <image:title>Recombinant Human C-reactive protein (CRP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ataxin-3-atxn3-bhp10514959</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP863445MO-SDS.jpg?v=1772280200</image:loc>
      <image:title>Recombinant Mouse Ataxin-3 (Atxn3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-g1-s-specific-cyclin-d2-ccnd2-biotinylated-bhp10514970</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004812HU-B-SDS.jpg?v=1772280201</image:loc>
      <image:title>Recombinant Human G1/S-specific cyclin-D2 (CCND2), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-basic-helix-loop-helix-arnt-like-protein-1-bmal1-bhp10514964</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP895734MO-SDS.jpg?v=1772280202</image:loc>
      <image:title>Recombinant Mouse Basic helix-loop-helix ARNT-like protein 1 (Bmal1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calcium-homeostasis-modulator-protein-2-calhm2-partial-bhp10514966</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP888009HU1-SDS.jpg?v=1772280203</image:loc>
      <image:title>Recombinant Human Calcium homeostasis modulator protein 2 (CALHM2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-g1-s-specific-cyclin-d1-ccnd1-biotinylated-bhp10514969</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004811HU-B-SDS.jpg?v=1772280202</image:loc>
      <image:title>Recombinant Human G1/S-specific cyclin-D1 (CCND1), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alcohol-dehydrogenase-1a-adh1a-bhp10514951</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001353HU-SDS.jpg?v=1772280197</image:loc>
      <image:title>Recombinant Human Alcohol dehydrogenase 1A (ADH1A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-1-25-dihydroxyvitamin-d-3-24-hydroxylase-mitochondrial-cyp24a1-bhp10514980</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP714493MOe1-SDS.jpg?v=1772280203</image:loc>
      <image:title>Recombinant Mouse 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial(Cyp24a1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-coccidioides-immitis-endochitinase-1-cts1-bhp10514979</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP627763DUV-SDS.jpg?v=1772280205</image:loc>
      <image:title>Recombinant Coccidioides immitis Endochitinase 1 (CTS1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atp-dependent-rna-helicase-ddx39a-ddx39a-bhp10514983</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006620HU-SDS.jpg?v=1772280205</image:loc>
      <image:title>Recombinant Human ATP-dependent RNA helicase DDX39A (DDX39A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bordetella-pertussis-filamentous-hemagglutinin-fhab-partial-bhp10514987</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5214BUA2-SDS.jpg?v=1772280203</image:loc>
      <image:title>Recombinant Bordetella pertussis Filamentous hemagglutinin (fhaB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rabbit-fibroblast-growth-factor-2-fgf2-bhp10514986</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008625RBc7-SDS.jpg?v=1772280204</image:loc>
      <image:title>Recombinant Rabbit Fibroblast growth factor 2 (FGF2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glyceraldehyde-3-phosphate-dehydrogenase-gapdh-bhp10514991</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009232HUl1-SDS.jpg?v=1772280207</image:loc>
      <image:title>Recombinant Human Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cholesteryl-ester-transfer-protein-cetp-bhp10514973</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005267HUc7-SDS.jpg?v=1772280201</image:loc>
      <image:title>Recombinant Human Cholesteryl ester transfer protein (CETP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-interleukin-2-receptor-subunit-alpha-il2ra-partial-bhp10515006</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011649PI1-SDS.jpg?v=1772280211</image:loc>
      <image:title>Recombinant Pig Interleukin-2 receptor subunit alpha (IL2RA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-heterogeneous-nuclear-ribonucleoprotein-d0-hnrnpd-bhp10515000</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP618874HU-SDS.jpg?v=1772280209</image:loc>
      <image:title>Recombinant Human Heterogeneous nuclear ribonucleoprotein D0 (HNRNPD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cholesteryl-ester-transfer-protein-cetp-bhp10514974</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005267HUb1-SDS.jpg?v=1772280204</image:loc>
      <image:title>Recombinant Human Cholesteryl ester transfer protein (CETP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glyceraldehyde-3-phosphate-dehydrogenase-gapdh-bhp10514992</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009232HUa0-SDS.jpg?v=1772280206</image:loc>
      <image:title>Recombinant Human Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cerebellar-degeneration-related-protein-2-like-cdr2l-bhp10514972</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005104HU-SDS.jpg?v=1772280201</image:loc>
      <image:title>Recombinant Human Cerebellar degeneration-related protein 2-like (CDR2L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-heat-shock-70-kda-protein-1-like-hspa1l-bhp10515001</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010823MO-SDS.jpg?v=1772280216</image:loc>
      <image:title>Recombinant Mouse Heat shock 70 kDa protein 1-like (Hspa1l)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ferritin-heavy-chain-fth1-bhp10514990</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009030HU-SDS.jpg?v=1772280205</image:loc>
      <image:title>Recombinant Human Ferritin heavy chain (FTH1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-enolase-eno-bhp10514985</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP647472SKU-SDS.jpg?v=1772280203</image:loc>
      <image:title>Recombinant Staphylococcus aureus Enolase (eno)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-disabled-homolog-1-dab1-bhp10514981</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006479HU-SDS.jpg?v=1772280204</image:loc>
      <image:title>Recombinant Human Disabled homolog 1 (DAB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-acetylcholine-receptor-subunit-alpha-chrna1-partial-bhp10514975</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005386HUe9-SDS.jpg?v=1772280206</image:loc>
      <image:title>Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-flavin-containing-monooxygenase-5-fmo5-bhp10514989</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008751HU_A4_-SDS.jpg?v=1772280207</image:loc>
      <image:title>Recombinant Human Flavin-containing monooxygenase 5 (FMO5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-collagen-alpha-1-xvi-chain-col16a1-partial-bhp10514977</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP805922MO-SDS.jpg?v=1772280203</image:loc>
      <image:title>Recombinant Mouse Collagen alpha-1 (XVI) chain (Col16a1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-orexin-receptor-type-2-hcrtr2-partial-bhp10514999</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010232HU1-SDS.jpg?v=1772280208</image:loc>
      <image:title>Recombinant Human Orexin receptor type 2 (HCRTR2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-34-il34-bhp10515007</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP837125MOc7-SDS.jpg?v=1772280210</image:loc>
      <image:title>Recombinant Mouse Interleukin-34 (Il34)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glutathione-s-transferase-theta-1-gstt1-bhp10514996</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009991HU-SDS.jpg?v=1772280207</image:loc>
      <image:title>Recombinant Human Glutathione S-transferase theta-1 (GSTT1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-lysine-specific-demethylase-6a-kdm6a-partial-bhp10515011</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025774MO-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Mouse Lysine-specific demethylase 6A (Kdm6a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-candida-albicans-hyphally-regulated-cell-wall-protein-1-hyr1-partial-bhp10515002</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP781321CZD-SDS.jpg?v=1772280210</image:loc>
      <image:title>Recombinant Candida albicans Hyphally regulated cell wall protein 1 (HYR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-g1-s-specific-cyclin-d3-ccnd3-biotinylated-bhp10514971</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004814HU-B-SDS.jpg?v=1772280199</image:loc>
      <image:title>Recombinant Human G1/S-specific cyclin-D3 (CCND3), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-2-il2-bhp10515005</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011629MO-SDS.jpg?v=1772280210</image:loc>
      <image:title>Recombinant Mouse Interleukin-2 (Il2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glycogen-synthase-kinase-3-beta-gsk3b-bhp10514994</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009963HUe2-SDS.jpg?v=1772280211</image:loc>
      <image:title>Recombinant Human Glycogen synthase kinase-3 beta (GSK3B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-lrr-receptor-like-serine-threonine-protein-kinase-fls2-fls2-partial-bhp10514988</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP880781DOA-SDS.jpg?v=1772280205</image:loc>
      <image:title>Recombinant Arabidopsis thaliana LRR receptor-like serine/threonine-protein kinase FLS2 (FLS2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-japanese-encephalitis-virus-envelope-protein-e-partial-bhp10514984</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5209JAC1d7-SDS.jpg?v=1772280205</image:loc>
      <image:title>Recombinant Japanese encephalitis virus Envelope protein (E), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-10-il10-bhp10515004</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011580HUa0-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Human Interleukin-10 (IL10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-growth-differentiation-factor-15-gdf15-partial-bhp10514993</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859530HU1c7-SDS.jpg?v=1772280207</image:loc>
      <image:title>Recombinant Human Growth/differentiation factor 15 (GDF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-saponaria-officinalis-ribosome-inactivating-protein-saporin-6-sap6-and-streptococcus-sp-group-g-immunoglobulin-g-binding-protein-g-spg-bhp10515024</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6472-SDS.jpg?v=1772280213</image:loc>
      <image:title>Recombinant Saponaria officinalis Ribosome-inactivating protein saporin-6 (SAP6)&amp;Streptococcus sp. group G Immunoglobulin G-binding protein G (spg)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-galectin-9-lgals9-partial-bhp10515014</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012895HU2a0-SDS.jpg?v=1772280210</image:loc>
      <image:title>Recombinant Human Galectin-9 (LGALS9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-galectin-9-lgals9-partial-bhp10515013</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012895HU2-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Human Galectin-9 (LGALS9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myocyte-specific-enhancer-factor-2c-mef2c-bhp10515019</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP804958HUf2-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Human Myocyte-specific enhancer factor 2C (MEF2C)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-inhibin-beta-a-chain-inhba-bhp10515009</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011719HUc7-SDS.jpg?v=1772280213</image:loc>
      <image:title>Recombinant Human Inhibin beta A chain (INHBA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-integration-host-factor-subunit-alpha-ihfa-bhp10515003</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP467124ENW-SDS.jpg?v=1772280207</image:loc>
      <image:title>Recombinant Escherichia coli Integration host factor subunit alpha (ihfA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-uncharacterized-protein-c11orf86-homolog-bhp10515025</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP855316MO-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Mouse Uncharacterized protein C11orf86 homolog</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-keratin-type-ii-cytoskeletal-2-epidermal-krt2-bhp10515012</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012535HUc7-SDS.jpg?v=1772280216</image:loc>
      <image:title>Recombinant Human Keratin, type II cytoskeletal 2 epidermal (KRT2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-avian-paramyxovirus-4-nucleocapsid-np-bhp10515030</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6450b1-SDS.jpg?v=1772280213</image:loc>
      <image:title>Recombinant avian paramyxovirus 4 Nucleocapsid (NP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-l-amino-acid-oxidase-il4i1-partial-bhp10515008</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP850426HU1g5-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Human L-amino-acid oxidase (IL4I1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interferon-regulatory-factor-9-irf9-bhp10515010</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011824MO-SDS.jpg?v=1772280211</image:loc>
      <image:title>Recombinant Mouse Interferon regulatory factor 9 (Irf9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-map-kinase-activating-death-domain-protein-madd-partial-bhp10515017</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP819910HU-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Human MAP kinase-activating death domain protein (MADD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nucleosome-assembly-protein-1-like-1-nap1l1-bhp10515026</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015441HU-SDS.jpg?v=1772280214</image:loc>
      <image:title>Recombinant Human Nucleosome assembly protein 1-like 1 (NAP1L1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myc-associated-zinc-finger-protein-maz-bhp10515018</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013528HU-SDS.jpg?v=1772280216</image:loc>
      <image:title>Recombinant Human Myc-associated zinc finger protein (MAZ)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-pituitary-homeobox-3-pitx3-bhp10515034</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018044MOf0-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Mouse Pituitary homeobox 3 (Pitx3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-growth-differentiation-factor-8-mstn-bhp10515020</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015057HUd7-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Human Growth/differentiation factor 8 (MSTN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-threonine-protein-kinase-nek9-nek9-partial-bhp10515027</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP837435HU-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Human Serine/threonine-protein kinase Nek9 (NEK9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-piscinibacter-sakaiensis-poly-ethylene-terephthalate-hydrolase-partial-bhp10515022</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP2729GQM-SDS.jpg?v=1772280215</image:loc>
      <image:title>Recombinant Piscinibacter sakaiensis Poly(ethylene terephthalate) hydrolase, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-containing-g-protein-coupled-receptor-5-lgr5-partial-biotinylated-bhp10515015</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012906HU-B-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-granzyme-a-gzma-bhp10514997</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010081MOc7-SDS.jpg?v=1772280210</image:loc>
      <image:title>Recombinant Mouse Granzyme A (Gzma)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ornithine-transcarbamylase-mitochondrial-otc-bhp10515032</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017270HUc7-SDS.jpg?v=1772280211</image:loc>
      <image:title>Recombinant Human Ornithine transcarbamylase, mitochondrial (OTC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-acinetobacter-baumannii-outer-membrane-protein-omp38-omp38-biotinylated-bhp10515031</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP387720AUD-B-SDS.jpg?v=1772280213</image:loc>
      <image:title>Recombinant Acinetobacter baumannii Outer membrane protein Omp38 (omp38), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-camp-dependent-protein-kinase-catalytic-subunit-alpha-prkaca-bhp10515038</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018688HUe2-SDS.jpg?v=1772280214</image:loc>
      <image:title>Recombinant Human cAMP-dependent protein kinase catalytic subunit alpha (PRKACA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-paraneoplastic-antigen-ma1-pnma1-bhp10515035</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018266HUc7-SDS.jpg?v=1772280215</image:loc>
      <image:title>Recombinant Human Paraneoplastic antigen Ma1 (PNMA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-staphylocoagulase-partial-bhp10515023</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP357199FKZ-SDS.jpg?v=1772280215</image:loc>
      <image:title>Recombinant Staphylococcus aureus Staphylocoagulase, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-receptor-activity-modifying-protein-3-ramp3-partial-bhp10515047</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP896247MO-SDS.jpg?v=1772280216</image:loc>
      <image:title>Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-rna-binding-protein-nova-1-nova1-bhp10515028</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015957HU-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Human RNA-binding protein Nova-1 (NOVA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prostaglandin-h2-d-isomerase-ptgds-145-156-matlysrtqtpr-missing-bhp10515042</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018969HU_M_-SDS.jpg?v=1772280214</image:loc>
      <image:title>Recombinant Human Prostaglandin-H2 D-isomerase (PTGDS) (145-156:MATLYSRTQTPR→Missing)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-polymerase-delta-interacting-protein-2-poldip2-bhp10515036</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP896496HU-SDS.jpg?v=1772280215</image:loc>
      <image:title>Recombinant Human Polymerase delta-interacting protein 2 (POLDIP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-ribonuclease-4-rnase4-bhp10515048</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP019796BO-SDS.jpg?v=1772280214</image:loc>
      <image:title>Recombinant Bovine Ribonuclease 4 (RNASE4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bordetella-pertussis-pertussis-toxin-subunit-1-ptxa-r43k-e163g-bhp10515045</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356423BUA_M_-SDS.jpg?v=1772280214</image:loc>
      <image:title>Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA) (R43K, E163G)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pyruvate-dehydrogenase-acetyl-transferring-kinase-isozyme-1-mitochondrial-pdk1-bhp10515033</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP613584HU-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Human [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial (PDK1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bordetella-pertussis-pertactin-autotransporter-prn-partial-bhp10515040</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP321224BUA2-SDS.jpg?v=1772280214</image:loc>
      <image:title>Recombinant Bordetella pertussis Pertactin autotransporter (prn), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-aeruginosa-lps-assembly-protein-lptd-lptd-partial-bhp10515016</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP492739EZY-SDS.jpg?v=1772280213</image:loc>
      <image:title>Recombinant Pseudomonas aeruginosa LPS-assembly protein lptD (lptD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gelsolin-gsn-bhp10514995</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009965HUc7-SDS.jpg?v=1772280205</image:loc>
      <image:title>Recombinant Human Gelsolin (GSN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-ppe-family-immunomodulator-ppe68-ppe68-bhp10515037</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6485FSG-SDS.jpg?v=1772280212</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis PPE family immunomodulator PPE68 (PPE68)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-micrococcus-luteus-large-ribosomal-subunit-protein-bl12-rpll-bhp10515050</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP514550MTP-SDS.jpg?v=1772280216</image:loc>
      <image:title>Recombinant Micrococcus luteus Large ribosomal subunit protein bL12 (rplL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-aeruginosa-large-ribosomal-subunit-protein-bl12-rpll-bhp10515051</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP881170EZX-SDS.jpg?v=1772280216</image:loc>
      <image:title>Recombinant Pseudomonas aeruginosa Large ribosomal subunit protein bL12 (rplL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-large-ribosomal-subunit-protein-bl12-rpll-bhp10515049</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP536829ENP-SDS.jpg?v=1772280214</image:loc>
      <image:title>Recombinant Escherichia coli Large ribosomal subunit protein bL12 (rplL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-sp-eg-sa-26-large-ribosomal-subunit-protein-ul22-rplv-bhp10515052</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6440GZV-SDS.jpg?v=1772280216</image:loc>
      <image:title>Recombinant Staphylococcus sp. EG-SA-26 Large ribosomal subunit protein uL22 (rplV)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-fusarium-oxysporum-f-sp-lycopersici-ribonuclease-t1-bhp10515021</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6416FFP-SDS.jpg?v=1772280214</image:loc>
      <image:title>Recombinant Fusarium oxysporum f. sp. lycopersici ribonuclease T1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-and-chloride-dependent-neutral-and-basic-amino-acid-transporter-b-0-and-slc6a14-partial-bhp10515062</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP890764HU-SDS.jpg?v=1772280217</image:loc>
      <image:title>Recombinant Human Sodium- and chloride-dependent neutral and basic amino acid transporter B (0+) (SLC6A14), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-solute-carrier-family-22-member-4-slc22a4-partial-bhp10515058</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861980HU-SDS.jpg?v=1772280218</image:loc>
      <image:title>Recombinant Human Solute carrier family 22 member 4 (SLC22A4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-murine-coronavirus-spike-glycoprotein-s-partial-bhp10515055</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP318118MJY-SDS.jpg?v=1772280215</image:loc>
      <image:title>Recombinant Murine coronavirus Spike glycoprotein (S), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calcium-manganese-antiporter-slc30a10-slc30a10-partial-bhp10515060</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP747695HU3-SDS.jpg?v=1772280218</image:loc>
      <image:title>Recombinant Human Calcium/manganese antiporter SLC30A10 (SLC30A10), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bluetongue-virus-10-core-protein-vp7-segment-7-bhp10515056</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP303980BHQ-SDS.jpg?v=1772280215</image:loc>
      <image:title>Recombinant Bluetongue virus 10 Core protein VP7 (Segment-7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-protease-inhibitor-kazal-type-9-spink9-bhp10515063</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP707717HU-SDS.jpg?v=1772280217</image:loc>
      <image:title>Recombinant Human Serine protease inhibitor Kazal-type 9 (SPINK9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bordetella-pertussis-pertactin-autotransporter-prn-partial-bhp10515041</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP321224BUA3-SDS.jpg?v=1772280216</image:loc>
      <image:title>Recombinant Bordetella pertussis Pertactin autotransporter (prn), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-small-ribosomal-subunit-protein-bs1-rpsa-bhp10515053</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP314176ENV-SDS.jpg?v=1772280217</image:loc>
      <image:title>Recombinant Escherichia coli Small ribosomal subunit protein bS1 (rpsA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-small-ribosomal-subunit-protein-bs16-rpsp-bhp10515054</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP640123SKZ-SDS.jpg?v=1772280215</image:loc>
      <image:title>Recombinant Staphylococcus aureus Small ribosomal subunit protein bS16 (rpsP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sepiapterin-reductase-spr-biotinylated-bhp10515064</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022605HU-B-SDS.jpg?v=1772280219</image:loc>
      <image:title>Recombinant Human Sepiapterin reductase (SPR), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcription-factor-eb-tfeb-bhp10515068</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023429HU-SDS.jpg?v=1772280221</image:loc>
      <image:title>Recombinant Human Transcription factor EB (TFEB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-crambe-hispanica-subsp-abyssinica-crambin-thi2-bhp10515070</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP355677CRO-SDS.jpg?v=1772280219</image:loc>
      <image:title>Recombinant Crambe hispanica subsp. abyssinica Crambin (THI2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-kinase-c-gamma-type-prkcg-bhp10515039</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018705HU-SDS.jpg?v=1772280216</image:loc>
      <image:title>Recombinant Human Protein kinase C gamma type (PRKCG)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-bifunctional-protein-pyrr-pyrr-bhp10515046</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP412421FLG-SDS.jpg?v=1772280214</image:loc>
      <image:title>Recombinant Staphylococcus aureus Bifunctional protein pyrR (pyrR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-avian-paramyxovirus-4-nucleocapsid-np-bhp10515029</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6450-SDS.jpg?v=1772280213</image:loc>
      <image:title>Recombinant avian paramyxovirus 4 Nucleocapsid (NP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prostaglandin-h2-d-isomerase-ptgds-176-185-tivflpqtdk-missing-bhp10515043</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018969HU_M1_-SDS.jpg?v=1772280215</image:loc>
      <image:title>Recombinant Human Prostaglandin-H2 D-isomerase (PTGDS) (176-185:TIVFLPQTDK→Missing)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-synemin-synm-partial-bhp10515066</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023019HU-SDS.jpg?v=1772280217</image:loc>
      <image:title>Recombinant Human Synemin (SYNM), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-falciparum-thrombospondin-related-anonymous-protein-trap-partial-bhp10515071</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP323735PLO-SDS.jpg?v=1772280220</image:loc>
      <image:title>Recombinant Plasmodium falciparum Thrombospondin-related anonymous protein (TRAP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serpin-b5-serpinb5-bhp10515057</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021073HU-SDS.jpg?v=1772280217</image:loc>
      <image:title>Recombinant Human Serpin B5 (SERPINB5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-organic-cation-carnitine-transporter-2-slc22a5-partial-bhp10515059</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021460HU-SDS.jpg?v=1772280216</image:loc>
      <image:title>Recombinant Human Organic cation/carnitine transporter 2 (SLC22A5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-trim65-trim65-bhp10515073</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP750884HU-SDS.jpg?v=1772280219</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase TRIM65 (TRIM65)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transforming-growth-factor-beta-1-proprotein-tgfb1-partial-bhp10515069</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023446MOe0-SDS.jpg?v=1772280219</image:loc>
      <image:title>Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-taf15-rna-polymerase-ii-tata-box-binding-protein-tbp-associated-factor-taf15-partial-bhp10515067</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6308MO-SDS.jpg?v=1772280218</image:loc>
      <image:title>Recombinant Mouse TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-pregnancy-associated-glycoprotein-1-bhp10515080</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP644917BOc7-SDS.jpg?v=1772280223</image:loc>
      <image:title>Recombinant Bovine Pregnancy-associated glycoprotein 1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-udp-glucuronosyltransferase-1a4-ugt1a4-partial-bhp10515075</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025577HU1-SDS.jpg?v=1772280219</image:loc>
      <image:title>Recombinant Human UDP-glucuronosyltransferase 1A4 (UGT1A4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-sodium-dependent-phosphate-transport-protein-2b-slc34a2-partial-bhp10515061</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP872848RA-SDS.jpg?v=1772280218</image:loc>
      <image:title>Recombinant Rat Sodium-dependent phosphate transport protein 2B (Slc34a2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-junin-arenavirus-ring-finger-protein-z-z-bhp10515079</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP746943JAM-SDS.jpg?v=1772280219</image:loc>
      <image:title>Recombinant Junin arenavirus RING finger protein Z (Z)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-glucagon-like-peptide-1-receptor-glp1r-partial-bhp10515091</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP4826MOV-SDS.jpg?v=1772280222</image:loc>
      <image:title>Recombinant Macaca fascicularis Glucagon-like peptide 1 receptor (GLP1R), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-elongation-factor-tu-tuf-bhp10515074</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025342SKY-SDS.jpg?v=1772280220</image:loc>
      <image:title>Recombinant Staphylococcus aureus Elongation factor Tu (tuf)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-uricase-uox-bhp10515076</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP822639MOV-SDS.jpg?v=1772280221</image:loc>
      <image:title>Recombinant Macaca fascicularis Uricase (UOX)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tripartite-motif-containing-protein-43-trim43-biotinylated-bhp10515072</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP836189HU-B-SDS.jpg?v=1772280219</image:loc>
      <image:title>Recombinant Human Tripartite motif-containing protein 43 (TRIM43), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-helicobacter-pylori-vacuolating-cytotoxin-autotransporter-vaca-partial-bhp10515077</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP675247HUS1-SDS.jpg?v=1772280220</image:loc>
      <image:title>Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter (vacA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glypican-3-gpc3-partial-active-bhp10515085</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009705HUc7-SDS.jpg?v=1772280222</image:loc>
      <image:title>Recombinant Human Glypican-3 (GPC3), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kidney-associated-antigen-1-kaag1-bhp10515110</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP871385HU-SDS.jpg?v=1772280225</image:loc>
      <image:title>Recombinant Human Kidney-associated antigen 1(KAAG1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-differentiation-antigen-cd6-cd6-partial-bhp10515101</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP326953HU-SDS.jpg?v=1772280290</image:loc>
      <image:title>Recombinant Human T-cell differentiation antigen CD6(CD6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alkaline-phosphatase-germ-cell-type-alpg-bhp10515102</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP001633HUf3-SDS.jpg?v=1772280243</image:loc>
      <image:title>Recombinant Human Alkaline phosphatase, germ cell type(ALPG)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-glucagon-like-peptide-1-receptor-glp1r-partial-bhp10515090</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP009514MO1-SDS.jpg?v=1772280239</image:loc>
      <image:title>Recombinant Mouse Glucagon-like peptide 1 receptor(Glp1r), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mucin-13-muc13-partial-bhp10515109</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP887973HU1-SDS.jpg?v=1772280230</image:loc>
      <image:title>Recombinant Human Mucin-13(MUC13), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-star-related-lipid-transfer-protein-6-stard6-bhp10515065</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022805HU-SDS.jpg?v=1772280218</image:loc>
      <image:title>Recombinant Human StAR-related lipid transfer protein 6 (STARD6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-fibroleukin-fgl2-bhp10515087</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP008654MO-SDS.jpg?v=1772280239</image:loc>
      <image:title>Recombinant Mouse Fibroleukin(Fgl2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-leukemia-inhibitory-factor-lif-bhp10515107</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP5062MOV-SDS.jpg?v=1772280225</image:loc>
      <image:title>Recombinant Macaca fascicularis Leukemia inhibitory factor (LIF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-saccharomyces-cerevisiae-nadph-dependent-methylglyoxal-reductase-gre2-gre2-bhp10515096</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP609123SVG-SDS.jpg?v=1772280293</image:loc>
      <image:title>Recombinant Saccharomyces cerevisiae NADPH-dependent methylglyoxal reductase GRE2 (GRE2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytochrome-b5-type-b-cyb5b-partial-bhp10515099</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP006310HU1-SDS.jpg?v=1772280224</image:loc>
      <image:title>Recombinant Human Cytochrome b5 type B(CYB5B) , partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-single-ig-il-1-related-receptor-sigirr-partial-bhp10515104</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP743558HU-SDS.jpg?v=1772280298</image:loc>
      <image:title>Recombinant Human Single Ig IL-1-related receptor(SIGIRR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-gastric-inhibitory-polypeptide-receptor-gipr-partial-bhp10515093</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP009438RA1-SDS.jpg?v=1772280289</image:loc>
      <image:title>Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-sugar-phosphatase-yida-yida-bhp10515078</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP364244ENV-SDS.jpg?v=1772280221</image:loc>
      <image:title>Recombinant Escherichia coli Sugar phosphatase YidA (yidA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-threonine-protein-kinase-receptor-r3-acvrl1-partial-bhp10515100</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP001262HU1-SDS.jpg?v=1772280301</image:loc>
      <image:title>Recombinant Human Serine/threonine-protein kinase receptor R3(ACVRL1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-arginase-1-arg1-bhp10515097</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP002005HU-SDS.jpg?v=1772280297</image:loc>
      <image:title>Recombinant Human Arginase-1(ARG1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-differentiation-antigen-cd6-cd6-partial-bhp10515105</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP326953HUa0-SDS.jpg?v=1772280227</image:loc>
      <image:title>Recombinant Human T-cell differentiation antigen CD6(CD6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-gastric-inhibitory-polypeptide-receptor-gipr-partial-bhp10515094</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP009438MO1-SDS.jpg?v=1772280299</image:loc>
      <image:title>Recombinant Mouse Gastric inhibitory polypeptide receptor(Gipr), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cmrf35-like-molecule-5-cd300ld-partial-bhp10515113</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP757797HU1-SDS.jpg?v=1772280230</image:loc>
      <image:title>Recombinant Human CMRF35-like molecule 5 (CD300LD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-surface-glycoprotein-cd8-alpha-chain-cd8a-partial-bhp10515103</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP004966HUf3-SDS.jpg?v=1772280303</image:loc>
      <image:title>Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-legumain-lgmn-bhp10515098</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP012903HU_A4_-SDS.jpg?v=1772280225</image:loc>
      <image:title>Recombinant Human Legumain(LGMN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interferon-alpha-4-ifna4-bhp10515089</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011040MOf3-SDS.jpg?v=1772280222</image:loc>
      <image:title>Recombinant Mouse Interferon alpha-4(Ifna4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-b-and-t-lymphocyte-associated-btla-partial-bhp10515108</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP4897MOV-SDS.jpg?v=1772280247</image:loc>
      <image:title>Recombinant Macaca fascicularis B and T lymphocyte associated (BTLA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-clumping-factor-b-clfb-partial-bhp10515095</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP527082FLG-SDS.jpg?v=1772280308</image:loc>
      <image:title>Recombinant Staphylococcus aureus Clumping factor B(clfB) , partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-15-il15-bhp10515106</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011593HU-SDS.jpg?v=1772280231</image:loc>
      <image:title>Recombinant Human Interleukin-15 (IL15)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-signal-transducer-cd24-cd24-partial-bhp10515111</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP004902HU-SDS.jpg?v=1772280243</image:loc>
      <image:title>Recombinant Human Signal transducer CD24 (CD24), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-fibroblast-growth-factor-fgf2-partial-bhp10515122</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP008625PI-SDS.jpg?v=1772280248</image:loc>
      <image:title>Recombinant Pig Fibroblast growth factor (FGF2), Partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interferon-alpha-4-ifna4-bhp10515088</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011040MO-SDS.jpg?v=1772280236</image:loc>
      <image:title>Recombinant Mouse Interferon alpha-4(Ifna4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cathepsin-d-ctsd-bhp10515112</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP006187HU_A4_-SDS.jpg?v=1772280250</image:loc>
      <image:title>Recombinant Human Cathepsin D (CTSD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-3-il3-bhp10515125</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011652MOa0-SDS.jpg?v=1772280227</image:loc>
      <image:title>Recombinant Mouse Interleukin-3 (Il3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cmrf35-like-molecule-5-cd300ld-partial-bhp10515115</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP840832MO-SDS.jpg?v=1772280307</image:loc>
      <image:title>Recombinant Mouse CMRF35-like molecule 5 (Cd300ld), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-ligand-superfamily-member-15-tnfsf15-bhp10515121</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP023992HU_F2_-SDS.jpg?v=1772280226</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor ligand superfamily member 15(TNFSF15)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tissue-factor-f3-partial-bhp10515120</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP007928HU1-SDS.jpg?v=1772280226</image:loc>
      <image:title>Recombinant Human Tissue factor (F3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-gamma-interferon-inducible-lysosomal-thiol-reductase-ifi30-bhp10515130</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP872152MO-SDS.jpg?v=1772280242</image:loc>
      <image:title>Recombinant Mouse Gamma-interferon-inducible lysosomal thiol reductase (Ifi30)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dipeptidase-2-dpep2-bhp10515114</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP007124HUd7-SDS.jpg?v=1772280227</image:loc>
      <image:title>Recombinant Human Dipeptidase 2 (DPEP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transcription-factor-maff-maff-bhp10515131</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP013318MO-SDS.jpg?v=1772280234</image:loc>
      <image:title>Recombinant Mouse Transcription factor MafF (Maff)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-aquaporin-7-aqp7-partial-bhp10515132</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP001967MO1f5-SDS.jpg?v=1772280298</image:loc>
      <image:title>Recombinant Mouse Aquaporin-7 (Aqp7), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-3-il3-bhp10515124</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011652MO-SDS.jpg?v=1772280229</image:loc>
      <image:title>Recombinant Mouse Interleukin-3 (Il3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-glucagon-like-peptide-1-receptor-glp1r-partial-bhp10515092</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP009514RA2-SDS.jpg?v=1772280223</image:loc>
      <image:title>Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-spinacia-oleracea-phosphoribulokinase-chloroplastic-bhp10515138</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP362728FKI-SDS.jpg?v=1772280230</image:loc>
      <image:title>Recombinant Spinacia oleracea Phosphoribulokinase, chloroplastic</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-inositol-1-4-5-trisphosphate-receptor-interacting-protein-like-1-itpripl1-partial-active-bhp10515084</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6125MOV-SDS.jpg?v=1772280222</image:loc>
      <image:title>Recombinant Macaca fascicularis Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-protein-106b-tmem106b-partial-bhp10515135</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP023674HU3-SDS.jpg?v=1772280235</image:loc>
      <image:title>Recombinant Human Transmembrane protein 106B (TMEM106B), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-low-affinity-immunoglobulin-gamma-fc-region-receptor-iii-b-fcgr3b-bhp10515118</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP008544HU-SDS.jpg?v=1772280240</image:loc>
      <image:title>Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-danio-rerio-fatty-acid-binding-protein-10-a-liver-basic-fabp10a-bhp10515144</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP881243DILc7-SDS.jpg?v=1772280250</image:loc>
      <image:title>Recombinant Danio rerio Fatty acid-binding protein 10-A, liver basic (fabp10a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-interleukin-13-il13-bhp10515116</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP868226DO-SDS.jpg?v=1772280228</image:loc>
      <image:title>Recombinant Dog Interleukin-13 (IL13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-hypoxia-inducible-factor-1-alpha-hif1a-partial-bhp10515127</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP010351RA1-SDS.jpg?v=1772280249</image:loc>
      <image:title>Recombinant Rat Hypoxia-inducible factor 1-alpha（Hif1a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-interleukin-2-receptor-subunit-alpha-il2ra-partial-bhp10515141</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011649PI1-SDS.jpg?v=1772280230</image:loc>
      <image:title>Recombinant Pig Interleukin-2 receptor subunit alpha (IL2RA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-low-affinity-immunoglobulin-gamma-fc-region-receptor-ii-a-fcgr2a-partial-bhp10515119</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP008540HU1-SDS.jpg?v=1772280248</image:loc>
      <image:title>Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-interleukin-17a-il17a-bhp10515133</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP724243BO-SDS.jpg?v=1772280230</image:loc>
      <image:title>Recombinant Bovine Interleukin-17A (IL17A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transcription-factor-maff-maff-bhp10515139</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP013318MOa4-SDS.jpg?v=1772280308</image:loc>
      <image:title>Recombinant Mouse Transcription factor MafF (Maff)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-25-tnfrsf25-partial-bhp10515123</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP839000HU-SDS.jpg?v=1772280228</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 25 (TNFRSF25), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-integrin-beta-6-itgb6-partial-bhp10515117</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP011890HU1-SDS.jpg?v=1772280233</image:loc>
      <image:title>Recombinant Human Integrin beta-6 (ITGB6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rickettsia-slovaca-citrate-synthase-glta-bhp10515134</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP006031RAAN-SDS.jpg?v=1772280230</image:loc>
      <image:title>Recombinant Rickettsia slovaca Citrate synthase (gltA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neutral-amino-acid-transporter-9-slc38a9-partial-bhp10515145</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP836713HU-SDS.jpg?v=1772280246</image:loc>
      <image:title>Recombinant Human Neutral amino acid transporter 9 (SLC38A9),partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-hypoxia-inducible-factor-1-alpha-hif1a-partial-bhp10515126</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP010351RA1b0-SDS.jpg?v=1772280229</image:loc>
      <image:title>Recombinant Rat Hypoxia-inducible factor 1-alpha（Hif1a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcription-factor-eb-tfeb-bhp10515140</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP023429HU-SDS.jpg?v=1772280234</image:loc>
      <image:title>Recombinant Human Transcription factor EB (TFEB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-alternaria-alternata-superoxide-dismutase-cu-zn-bhp10515129</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP6372GZN-SDS.jpg?v=1772280227</image:loc>
      <image:title>Recombinant Alternaria alternata Superoxide dismutase [Cu-Zn]</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-coccidioides-immitis-endochitinase-1-cts1-bhp10515142</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP627763DUV-SDS.jpg?v=1772280230</image:loc>
      <image:title>Recombinant Coccidioides immitis Endochitinase 1 (CTS1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-natural-cytotoxicity-triggering-receptor-3-ligand-1-ncr3lg1-partial-bhp10515157</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP737873HU-SDS.jpg?v=1772280306</image:loc>
      <image:title>Recombinant Human Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-synaptogyrin-2-syngr2-partial-bhp10515158</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP023012HU1-SDS.jpg?v=1772280238</image:loc>
      <image:title>Recombinant Human Synaptogyrin-2 (SYNGR2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-regakine-1-bhp10515146</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP307300BO-SDS.jpg?v=1772280298</image:loc>
      <image:title>Recombinant Bovine Regakine-1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-danio-rerio-fatty-acid-binding-protein-10-a-liver-basic-fabp10a-bhp10515136</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP881243DIL-SDS.jpg?v=1772280231</image:loc>
      <image:title>Recombinant Danio rerio Fatty acid-binding protein 10-A, liver basic (fabp10a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neurogenic-differentiation-factor-1-neurod1-bhp10515152</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP720182MO-SDS.jpg?v=1772280233</image:loc>
      <image:title>Recombinant Mouse Neurogenic differentiation factor 1 (Neurod1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-microtubule-associated-protein-tau-mapt-bhp10515161</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP013481HU_F8_L5-SDS.jpg?v=1772280302</image:loc>
      <image:title>Recombinant Human Microtubule-associated protein tau (MAPT)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gamma-taxilin-txlng-bhp10515154</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP865141HU-SDS.jpg?v=1772280245</image:loc>
      <image:title>Recombinant Human Gamma-taxilin (TXLNG)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-enhancer-factor-tef-5-tead3-partial-bhp10515159</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP860344HU-SDS.jpg?v=1772280245</image:loc>
      <image:title>Recombinant Human Transcriptional enhancer factor TEF-5 (TEAD3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-hypoxia-inducible-factor-1-alpha-hif1a-partial-bhp10515148</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP730731MO-SDS.jpg?v=1772280314</image:loc>
      <image:title>Recombinant Mouse Hypoxia-inducible factor 1-alpha (Hif1a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neurogenic-differentiation-factor-1-neurod1-h241a-bhp10515155</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP720182MO_M3_-SDS.jpg?v=1772280232</image:loc>
      <image:title>Recombinant Mouse Neurogenic differentiation factor 1 (Neurod1)(H241A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-intracellulare-lipoprotein-lpqh-lpqh-bhp10515175</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP333609MVM-SDS.jpg?v=1772280234</image:loc>
      <image:title>Recombinant Mycobacterium intracellulare Lipoprotein LpqH（lpqH)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-biliverdin-reductase-a-blvra-bhp10515169</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP002721MO-SDS.jpg?v=1772280236</image:loc>
      <image:title>Recombinant Mouse Biliverdin reductase A (Blvra)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-receptor-activity-modifying-protein-3-ramp3-partial-bhp10515170</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP896247MO-SDS.jpg?v=1772280236</image:loc>
      <image:title>Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-porcine-reproductive-and-respiratory-syndrome-virus-glycoprotein-4-gp4-partial-bhp10515167</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP368832PYZ1-SDS.jpg?v=1772280305</image:loc>
      <image:title>Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 4 (GP4),partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-72-kda-type-iv-collagenase-mmp2-bhp10515177</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP014666HU1-SDS.jpg?v=1772280236</image:loc>
      <image:title>Recombinant Human 72 kDa type IV collagenase (MMP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neurogenic-differentiation-factor-1-neurod1-h115a-bhp10515153</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP720182MO_M2_-SDS.jpg?v=1772280233</image:loc>
      <image:title>Recombinant Mouse Neurogenic differentiation factor 1 (Neurod1)(H115A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-saccharomyces-cerevisiae-meiotic-recombination-protein-dmc1-dmc1-bhp10515137</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP338672SVG-SDS.jpg?v=1772280242</image:loc>
      <image:title>Recombinant Saccharomyces cerevisiae Meiotic recombination protein DMC1 (DMC1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-eosinophil-peroxidase-epx-bhp10515174</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP007756HU-SDS.jpg?v=1772280235</image:loc>
      <image:title>Recombinant Human Eosinophil peroxidase (EPX)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-netrin-receptor-unc5c-unc5c-a150v-partial-bhp10515168</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP025630HU_F_M_-SDS.jpg?v=1772280235</image:loc>
      <image:title>Recombinant Human Netrin receptor UNC5C (UNC5C) (A150V),partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-growth-differentiation-factor-9-gdf9-bhp10515162</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009352HU_A4_-SDS.jpg?v=1772280239</image:loc>
      <image:title>Recombinant Human Growth/differentiation factor 9 (GDF9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-dna-gyrase-subunit-b-gyrb-partial-bhp10515156</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP360158ENV-SDS.jpg?v=1772280251</image:loc>
      <image:title>Recombinant Escherichia coli DNA gyrase subunit B (gyrB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-delta-and-notch-like-epidermal-growth-factor-related-receptor-dner-partial-bhp10515173</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP818784HU-SDS.jpg?v=1772280249</image:loc>
      <image:title>Recombinant Human Delta and Notch-like epidermal growth factor-related receptor (DNER), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-s-adenosylmethionine-synthase-isoform-type-2-mat2a-bhp10515160</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP013517HUa0-SDS.jpg?v=1772280232</image:loc>
      <image:title>Recombinant Human S-adenosylmethionine synthase isoform type-2 (MAT2A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-25-tnfrsf25-partial-bhp10515181</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP839000HU-SDS.jpg?v=1772280303</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 25 (TNFRSF25), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serpin-b5-serpinb5-bhp10515143</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP021073HU-SDS.jpg?v=1772280243</image:loc>
      <image:title>Recombinant Human Serpin B5 (SERPINB5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neurogenic-differentiation-factor-1-neurod1-m114a-h115a-bhp10515151</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP720182MO_M4_-SDS.jpg?v=1772280232</image:loc>
      <image:title>Recombinant Mouse Neurogenic differentiation factor 1 (Neurod1)(M114A,H115A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alkaline-phosphatase-tissue-nonspecific-isozyme-alpl-active-bhp10515180</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001631HU-SDS.jpg?v=1772280250</image:loc>
      <image:title>Recombinant Human Alkaline phosphatase, tissue-nonspecific isozyme (ALPL) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transforming-growth-factor-beta-1-proprotein-tgfb1-c33s-biotinylated-bhp10515191</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023446HU_A4_M_-B-SDS.jpg?v=1772280314</image:loc>
      <image:title>Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1) (C33S), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nucleosome-assembly-protein-1-like-1-nap1l1-bhp10515164</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP015441HU-SDS.jpg?v=1772280234</image:loc>
      <image:title>Recombinant Human Nucleosome assembly protein 1-like 1 (NAP1L1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fragile-x-mental-retardation-syndrome-related-protein-1-fxr1-bhp10515166</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP009087HU_A4_-SDS.jpg?v=1772280235</image:loc>
      <image:title>Recombinant Human Fragile X mental retardation syndrome-related protein 1 (FXR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytomegalovirus-enhanced-green-fluorescent-protein-egfp-bhp10515128</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP2069HIZp4-SDS.jpg?v=1772280303</image:loc>
      <image:title>Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-mucin-1-muc1-partial-bhp10515165</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP312543MO-SDS.jpg?v=1772280235</image:loc>
      <image:title>Recombinant Mouse Mucin-1 (Muc1),partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-falciparum-thrombospondin-related-anonymous-protein-trap-partial-bhp10515149</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP323735PLO-SDS.jpg?v=1772280245</image:loc>
      <image:title>Recombinant Plasmodium falciparum Thrombospondin-related anonymous protein (TRAP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-heat-shock-70-kda-protein-1-like-hspa1l-bhp10515163</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP010823MO-SDS.jpg?v=1772280234</image:loc>
      <image:title>Recombinant Mouse Heat shock 70 kDa protein 1-like (Hspa1l)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-enamelin-enam-partial-bhp10515150</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP007662HU-SDS.jpg?v=1772280235</image:loc>
      <image:title>Recombinant Human Enamelin (ENAM),partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacteriophage-h30-shiga-like-toxin-1-subunit-b-stxb-bhp10515171</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP303961BDK-SDS.jpg?v=1772280234</image:loc>
      <image:title>Recombinant Bacteriophage H30 Shiga-like toxin 1 subunit B (stxB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-microtubule-associated-protein-tau-mapt-bhp10515178</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013481HU_F8_L5-SDS.jpg?v=1772280235</image:loc>
      <image:title>Recombinant Human Microtubule-associated protein tau（MAPT)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-tumor-necrosis-factor-receptor-superfamily-member-13b-partial-active-bhp10515192</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6427MOV-SDS.jpg?v=1772280256</image:loc>
      <image:title>Recombinant Macaca fascicularis Tumor necrosis factor receptor superfamily member 13B, partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-b-and-t-lymphocyte-attenuator-btla-partial-active-bhp10515186</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP4897MOV-SDS.jpg?v=1772280309</image:loc>
      <image:title>Recombinant Macaca fascicularis B- and T-lymphocyte attenuator (BTLA), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bromodomain-containing-protein-2-brd2-partial-bhp10515147</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP002800HUp3-SDS.jpg?v=1772280245</image:loc>
      <image:title>Recombinant Human Bromodomain-containing protein 2 (BRD2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunoglobulin-j-chain-jchain-bhp10515187</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011337HUd9-SDS.jpg?v=1772280320</image:loc>
      <image:title>Recombinant Human Immunoglobulin J chain (JCHAIN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-growth-differentiation-factor-8-mstn-bhp10515183</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015057HU-SDS.jpg?v=1772280236</image:loc>
      <image:title>Recombinant Human Growth/differentiation factor 8 (MSTN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transferrin-receptor-protein-2-tfr2-partial-bhp10515189</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP891794HU-SDS.jpg?v=1772280238</image:loc>
      <image:title>Recombinant Human Transferrin receptor protein 2 (TFR2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sialic-acid-binding-ig-like-lectin-10-alpg-partial-bhp10515188</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP842706HU-SDS.jpg?v=1772280323</image:loc>
      <image:title>Recombinant Human Sialic acid-binding Ig-like lectin 10 (Alpg), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-3-il3-bhp10515184</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011652MO-SDS.jpg?v=1772280313</image:loc>
      <image:title>Recombinant Mouse Interleukin-3 (Il3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-keratin-type-i-cytoskeletal-18-krt18-partial-bhp10515202</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012519MO-SDS.jpg?v=1772280256</image:loc>
      <image:title>Recombinant Mouse Keratin, type I cytoskeletal 18 (KRT18), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytotoxic-granule-associated-rna-binding-protein-tia1-tia1-bhp10515172</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP023527HU-SDS.jpg?v=1772280234</image:loc>
      <image:title>Recombinant Human Cytotoxic granule associated RNA binding protein TIA1 (TIA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-5-ctsc-bhp10515194</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011662HUd7-SDS.jpg?v=1772280255</image:loc>
      <image:title>Recombinant Human Interleukin-5(CTSC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-10b-tnfrsf10b-partial-active-bhp10515179</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023965HU1-SDS.jpg?v=1772280307</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-beta-nerve-growth-factor-ngf-r121g-bhp10515182</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015779HU_A4_M1_-SDS.jpg?v=1772280315</image:loc>
      <image:title>Recombinant Human Beta-nerve growth factor (NGF) (R121G)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-keratin-type-i-cytoskeletal-18-krt18-partial-bhp10515203</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012519MOd7-SDS.jpg?v=1772280256</image:loc>
      <image:title>Recombinant Mouse Keratin, type I cytoskeletal 18 (KRT18), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-aquaporin-7-aqp7-partial-bhp10515198</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001967MO1f5-SDS.jpg?v=1772280245</image:loc>
      <image:title>Recombinant Mouse Aquaporin-7 (Aqp7), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-plasminogen-activator-inhibitor-2-macrophage-serpinb2-bhp10515199</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021070MO-SDS.jpg?v=1772280239</image:loc>
      <image:title>Recombinant Mouse Plasminogen activator inhibitor 2, macrophage (Serpinb2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-34-il34-bhp10515206</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP837125MO-SDS.jpg?v=1772280252</image:loc>
      <image:title>Recombinant Mouse Interleukin-34 (Il34)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dipeptidyl-peptidase-1-ctsc-active-bhp10515193</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006186HU-SDS.jpg?v=1772280312</image:loc>
      <image:title>Recombinant Human Dipeptidyl peptidase 1 (CTSC) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-growth-arrest-specific-protein-6-gas6-bhp10515197</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5038RA-SDS.jpg?v=1772280317</image:loc>
      <image:title>Recombinant Rat Growth arrest-specific protein 6 (Gas6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytomegalovirus-enhanced-green-fluorescent-protein-egfp-v164a-s176g-bhp10515176</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-YP2069HIZ_M_p8-SDS.jpg?v=1772280239</image:loc>
      <image:title>Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp) (V164A,S176G)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-enhancer-factor-tef-1-tead1-bhp10515208</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023363HU-SDS.jpg?v=1772280240</image:loc>
      <image:title>Recombinant Human Transcriptional enhancer factor TEF-1 (TEAD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-reticulocalbin-2-rcn2-bhp10515200</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP621768HUd7-SDS.jpg?v=1772280256</image:loc>
      <image:title>Recombinant Human Reticulocalbin-2 (RCN2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-enhancer-factor-tef-1-tead1-partial-bhp10515196</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023363HU1-SDS.jpg?v=1772280310</image:loc>
      <image:title>Recombinant Human Transcriptional enhancer factor TEF-1 (TEAD1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcription-factor-sox-2-sox2-bhp10515185</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022426HU-SDS.jpg?v=1772280238</image:loc>
      <image:title>Recombinant Human Transcription factor SOX-2 (SOX2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-complement-component-c1q-receptor-cd93-partial-bhp10515211</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004970MOd9-SDS.jpg?v=1772280331</image:loc>
      <image:title>Recombinant Mouse Complement component C1q receptor (Cd93), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-1-receptor-accessory-protein-il1rap-partial-active-bhp10515217</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP730751MO-SDS.jpg?v=1772280263</image:loc>
      <image:title>Recombinant Mouse Interleukin-1 receptor accessory protein (Il1rap), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-heterogeneous-nuclear-ribonucleoprotein-d0-hnrnpd-bhp10515204</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP618874HUc0-SDS.jpg?v=1772280240</image:loc>
      <image:title>Recombinant Human Heterogeneous nuclear ribonucleoprotein D0 (HNRNPD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-containing-protein-15-lrrc15-partial-active-bhp10515212</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP819484HU-SDS.jpg?v=1772280321</image:loc>
      <image:title>Recombinant Human Leucine-rich repeat-containing protein 15 (LRRC15), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myosin-regulatory-light-chain-12b-myl12b-bhp10515213</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015308HU-SDS.jpg?v=1772280320</image:loc>
      <image:title>Recombinant Human Myosin regulatory light chain 12B (MYL12B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-containing-protein-15-lrrc15-partial-bhp10515215</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP819484HUd9-SDS.jpg?v=1772280317</image:loc>
      <image:title>Recombinant Human Leucine-rich repeat-containing protein 15 (LRRC15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-integrin-beta-6-itgb6-partial-bhp10515226</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011890HU1-SDS.jpg?v=1772280249</image:loc>
      <image:title>Recombinant Human Integrin beta-6 (ITGB6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-interleukin-1-receptor-accessory-protein-il1rap-partial-active-bhp10515216</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP733954RA-SDS.jpg?v=1772280328</image:loc>
      <image:title>Recombinant Rat Interleukin-1 receptor accessory protein (Il1rap), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-r-spondin-1-rspo1-bhp10515233</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP644834HU-SDS.jpg?v=1772280326</image:loc>
      <image:title>Recombinant Human R-spondin-1 (RSPO1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-cd93-molecule-cd93-partial-bhp10515210</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP4279MOVd9-SDS.jpg?v=1772280257</image:loc>
      <image:title>Recombinant Macaca fascicularis CD93 molecule (CD93), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cadherin-17-cdh17-partial-bhp10515224</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP613267HUh8-SDS.jpg?v=1772280244</image:loc>
      <image:title>Recombinant Human Cadherin-17 (CDH17), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-poly-adp-ribose-polymerase-1-parp1-bhp10515227</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017457HU_A4_-SDS.jpg?v=1772280325</image:loc>
      <image:title>Recombinant Human Poly [ADP-ribose] polymerase 1 (PARP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-asialoglycoprotein-receptor-1-asgr1-partial-bhp10515214</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002207MO-SDS.jpg?v=1772280246</image:loc>
      <image:title>Recombinant Mouse Asialoglycoprotein receptor 1 (Asgr1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-ligand-superfamily-member-15-tnfsf15-partial-active-bhp10515219</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023992HU1-SDS.jpg?v=1772280328</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-netrin-1-ntn1-partial-active-bhp10515229</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP016127HU_A4_-SDS.jpg?v=1772280328</image:loc>
      <image:title>Recombinant Human Netrin-1 (NTN1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-tumor-necrosis-factor-ligand-superfamily-member-15-tnfsf15-partial-active-bhp10515195</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5305MOW-SDS.jpg?v=1772280256</image:loc>
      <image:title>Recombinant Macaca mulatta Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-japanese-encephalitis-virus-envelope-protein-e-partial-bhp10515240</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5209JAC2-SDS.jpg?v=1772280324</image:loc>
      <image:title>Recombinant Japanese encephalitis virus Envelope protein (E), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-programmed-cell-death-1-ligand-1-cd274-partial-bhp10515236</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP878942HU1d7-SDS.jpg?v=1772280254</image:loc>
      <image:title>Recombinant Human Programmed cell death 1 ligand 1 (CD274), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-13b-tnfrsf13b-partial-bhp10515242</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023971HU-SDS.jpg?v=1772280323</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 13B (TNFRSF13B), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mucin-13-muc13-partial-bhp10515218</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP887973HU1-SDS.jpg?v=1772280246</image:loc>
      <image:title>Recombinant Human Mucin-13 (MUC13), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-leucine-rich-repeat-containing-protein-15-lrrc15-partial-active-bhp10515207</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP773929MO-SDS.jpg?v=1772280313</image:loc>
      <image:title>Recombinant Mouse Leucine-rich repeat-containing protein 15 (Lrrc15), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ectonucleotide-pyrophosphatase-phosphodiesterase-family-member-3-enpp3-partial-bhp10515209</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007681HUd9-SDS.jpg?v=1772280313</image:loc>
      <image:title>Recombinant Human Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 (ENPP3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-integrin-beta-itgb6-partial-bhp10515230</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5472MOV-SDS.jpg?v=1772280328</image:loc>
      <image:title>Recombinant Macaca fascicularis Integrin beta (ITGB6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-1a-tnfrsf1a-partial-bhp10515232</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023977HU1n6-SDS.jpg?v=1772280263</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-1b-tnfrsf1b-partial-bhp10515239</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023978HU2n6-SDS.jpg?v=1772280262</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/virus-like-particles-vlps-isotype-control-bhp10515264</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-avian-paramyxovirus-4-nucleocapsid-np-bhp10515205</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6450-SDS.jpg?v=1772280241</image:loc>
      <image:title>Recombinant avian paramyxovirus 4 Nucleocapsid (NP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sushi-repeat-containing-protein-srpx2-srpx2-bhp10515247</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022690HU-SDS.jpg?v=1772280247</image:loc>
      <image:title>Recombinant Human Sushi repeat-containing protein SRPX2（SRPX2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-integrin-beta-6-itgb6-partial-bhp10515251</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5471MO-SDS.jpg?v=1772280334</image:loc>
      <image:title>Recombinant Mouse Integrin beta-6 (Itgb6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-seizure-related-6-homolog-sez6-partial-active-bhp10515255</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6419MOV-SDS.jpg?v=1772280247</image:loc>
      <image:title>Recombinant Macaca fascicularis Seizure related 6 homolog (SEZ6), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-inhibin-beta-a-chain-inhba-bhp10515237</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011719HU1-SDS.jpg?v=1772280319</image:loc>
      <image:title>Recombinant Human Inhibin beta A chain (INHBA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calreticulin-calr-bhp10515245</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004458HUd6-SDS.jpg?v=1772280264</image:loc>
      <image:title>Recombinant Human Calreticulin (CALR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-36-gamma-il36g-biotinylated-bhp10515248</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP873706HU1-B-SDS.jpg?v=1772280249</image:loc>
      <image:title>Recombinant Human Interleukin-36 gamma (IL36G), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vitamin-k-dependent-protein-c-proc-bhp10515246</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP018742HU_A4_-SDS.jpg?v=1772280327</image:loc>
      <image:title>Recombinant Human Vitamin K-dependent protein C（PROC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-c-c-motif-chemokine-17-ccl17-active-bhp10515268</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP811562MOW-SDS.jpg?v=1772280328</image:loc>
      <image:title>Recombinant Macaca mulatta C-C motif chemokine 17 (CCL17) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-n-acetylgalactosamine-6-sulfatase-galns-bhp10515235</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009202HU-SDS.jpg?v=1772280323</image:loc>
      <image:title>Recombinant Human N-acetylgalactosamine-6-sulfatase (GALNS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mousev-set-domain-containing-t-cell-activation-inhibitor-1-vtcn1-bhp10515272</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP742524MO-SDS.jpg?v=1772280316</image:loc>
      <image:title>Recombinant MouseV-set domain containing T-cell activation inhibitor 1 (Vtcn1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-heterogeneous-nuclear-ribonucleoprotein-h2-il36g-bhp10515249</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP346289HU-SDS.jpg?v=1772280245</image:loc>
      <image:title>Recombinant Human Heterogeneous nuclear ribonucleoprotein H2 (IL36G)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-motif-chemokine-17-ccl17-active-bhp10515267</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP856406HU-SDS.jpg?v=1772280330</image:loc>
      <image:title>Recombinant Human C-C motif chemokine 17 (CCL17) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-heat-shock-protein-hsp-90-beta-hsp90ab1-bhp10515265</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP010808MO-SDS.jpg?v=1772280247</image:loc>
      <image:title>Recombinant Mouse Heat shock protein HSP 90-beta (Hsp90ab1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-siglec9-partial-bhp10515275</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5403MOV-SDS.jpg?v=1772280326</image:loc>
      <image:title>Recombinant Macaca fascicularis (SIGLEC9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-porcine-reproductive-and-respiratory-syndrome-virus-glycoprotein-4-gp4-partial-bhp10515280</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP368832PYZ1-SDS.jpg?v=1772280262</image:loc>
      <image:title>Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 4 (GP4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-polypeptide-related-sequence-b-micb-partial-bhp10515244</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013813HU-SDS.jpg?v=1772280326</image:loc>
      <image:title>Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-10-receptor-subunit-alpha-il10ra-partial-bhp10515261</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP621688HUd7-SDS.jpg?v=1772280325</image:loc>
      <image:title>Recombinant Human Interleukin-10 receptor subunit alpha (IL10RA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c-c-motif-chemokine-17-ccl17-active-bhp10515273</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6512MO-SDS.jpg?v=1772280316</image:loc>
      <image:title>Recombinant Mouse C-C motif chemokine 17 (Ccl17) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-teratocarcinoma-derived-growth-factor-1-tdgf1-bhp10515270</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023343HU-SDS.jpg?v=1772280325</image:loc>
      <image:title>Recombinant Human Teratocarcinoma-derived growth factor 1 (TDGF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neutrophil-elastase-elane-partial-bhp10515256</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007587HU1-SDS.jpg?v=1772280264</image:loc>
      <image:title>Recombinant Human Neutrophil elastase (ELANE), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-13-il13-bhp10515253</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011590MO-SDS.jpg?v=1772280325</image:loc>
      <image:title>Recombinant Mouse Interleukin-13 (Il13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pro-neuregulin-1-membrane-bound-isoform-nrg1-partial-bhp10515234</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP016077HU-SDS.jpg?v=1772280332</image:loc>
      <image:title>Recombinant Human Pro-neuregulin-1, membrane-bound isoform (NRG1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-cd274-molecule-pdl1-partial-bhp10515271</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5015DO1j9-SDS.jpg?v=1772280254</image:loc>
      <image:title>Recombinant Dog CD274 molecule (PDL1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-gamma-ifng-active-bhp10515269</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011050HU1d7-SDS.jpg?v=1772280326</image:loc>
      <image:title>Recombinant Human Interferon gamma (IFNG) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-integrin-alpha-v-and-integrin-beta-6-itgav-and-itgb6-heterodimer-protein-bhp10515258</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011877MO-SDS.jpg?v=1772280321</image:loc>
      <image:title>Recombinant Mouse Integrin alpha-V&amp;Integrin beta-6 (Itgav&amp;Itgb6) Heterodimer Protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-inhibin-beta-a-chain-inhba-active-bhp10515238</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011719HU1b0-SDS.jpg?v=1772280329</image:loc>
      <image:title>Recombinant Human Inhibin beta A chain (INHBA) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-turtle-homolog-a-igsf9-partial-bhp10515281</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP882181HU-SDS.jpg?v=1772280261</image:loc>
      <image:title>Recombinant Human Protein turtle homolog A (IGSF9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-dependent-phosphate-transport-protein-2b-slc34a2-partial-bhp10515263</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021581HU1h8-SDS.jpg?v=1772280248</image:loc>
      <image:title>Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-tissue-factor-f3-partial-active-bhp10515288</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6582MOV-SDS.jpg?v=1772280285</image:loc>
      <image:title>Recombinant Macaca fascicularis Tissue factor (F3), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-2-il2-bhp10515259</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011629MO-SDS.jpg?v=1772280262</image:loc>
      <image:title>Recombinant Mouse Interleukin-2 (Il2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-integrin-alpha-v-and-integrin-beta-6-itgav-and-itgb6-heterodimer-protein-bhp10515257</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011877HU-SDS.jpg?v=1772280274</image:loc>
      <image:title>Recombinant Human Integrin alpha-V&amp;Integrin beta-6 (ITGAV&amp;ITGB6) Heterodimer Protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-25-tnfrsf25-partial-active-bhp10515282</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP839000HUn6-SDS.jpg?v=1772280264</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 25 (TNFRSF25), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-mhc-class-i-polypeptide-related-sequence-b-micb-partial-bhp10515290</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6584MOV-SDS.jpg?v=1772280250</image:loc>
      <image:title>Recombinant Macaca fascicularis MHC class I polypeptide-related sequence B (MICB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-lymphocyte-antigen-6e-ly6e-bhp10515231</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP717533MO-SDS.jpg?v=1772280249</image:loc>
      <image:title>Recombinant Mouse Lymphocyte antigen 6E (Ly6e)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-macrophage-colony-stimulating-factor-1-csf1-partial-active-bhp10515274</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006043HU1-SDS.jpg?v=1772280319</image:loc>
      <image:title>Recombinant Human Macrophage colony-stimulating factor 1 (CSF1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-potassium-transporting-atpase-subunit-alpha-1-atp1a1-partial-biotinylated-bhp10515279</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP002322HU-B-SDS.jpg?v=1772280265</image:loc>
      <image:title>Recombinant Human Sodium/potassium-transporting ATPase subunit alpha-1 (ATP1A1), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-13b-tnfrsf13b-partial-bhp10515260</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023971HU1-SDS.jpg?v=1772280323</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 13B (TNFRSF13B), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-alkaline-phosphatase-alpp-partial-active-bhp10515283</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6583RA-SDS.jpg?v=1772280331</image:loc>
      <image:title>Recombinant Rat Alkaline phosphatase (Alpp), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-arginine-deiminase-type-4-padi4-bhp10515303</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP890757HU-SDS.jpg?v=1772280327</image:loc>
      <image:title>Recombinant Human
Protein-arginine deiminase type-4 (PADI4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-arginine-deiminase-type-1-padi1-bhp10515302</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP891543HU-SDS.jpg?v=1772280339</image:loc>
      <image:title>Recombinant Human Protein-arginine deiminase type-1 (PADI1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-pbmucl2-hcg22-bhp10515291</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP522205HU-SDS.jpg?v=1772280254</image:loc>
      <image:title>Recombinant Human Protein PBMUCL2 (HCG22)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-ligand-superfamily-member-1-tnfsf15-partial-bhp10515276</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023992HU_F3_-SDS.jpg?v=1772280265</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor ligand superfamily member 1 (TNFSF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-cadherin-17-cdh17-partial-active-bhp10515277</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005042RA-SDS.jpg?v=1772280320</image:loc>
      <image:title>Recombinant Rat Cadherin-17 (Cdh17), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-adp-ribosyl-cyclase-cyclic-adp-ribose-hydrolase-1-cd38-partial-active-bhp10515285</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004929HU1c7-SDS.jpg?v=1772280330</image:loc>
      <image:title>Recombinant Human ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 (CD38), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-and-immunoglobulin-domain-containing-protein-2-tmigd2-partial-bhp10515284</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP850263HU-SDS.jpg?v=1772280284</image:loc>
      <image:title>Recombinant Human Transmembrane and immunoglobulin domain-containing protein 2 (TMIGD2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-natural-cytotoxicity-triggering-receptor-3-ncr3-partial-active-bhp10515289</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015551MOV1-SDS.jpg?v=1772280345</image:loc>
      <image:title>Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3 (NCR3), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-chain-related-molecule-b-micb-partial-active-bhp10515286</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5607HU1-SDS.jpg?v=1772280254</image:loc>
      <image:title>Recombinant Human MHC class I chain-related molecule B (MICB), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-receptor-type-tyrosine-protein-phosphatase-c-ptprc-partial-active-bhp10515292</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP019049HUc7-SDS.jpg?v=1772280339</image:loc>
      <image:title>Recombinant Human Receptor-type tyrosine-protein phosphatase C (PTPRC), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-chain-related-protein-mica-partial-active-bhp10515309</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5071MOV-SDS_a19d0785-c91d-40f3-a3b2-cc1dd0e0b6ba.jpg?v=1772280334</image:loc>
      <image:title>Recombinant Human MHC Class I chain-related protein (MICA), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-tumor-associated-calcium-signal-transducer-2-tacstd2-partial-active-bhp10515308</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6581MOV-SDS.jpg?v=1772280266</image:loc>
      <image:title>Recombinant Macaca fascicularis tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-cytokine-receptor-like-factor-2-crlf2-partial-active-bhp10515316</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5357MOV-SDS.jpg?v=1772280335</image:loc>
      <image:title>Recombinant Macaca fascicularis cytokine receptor-like factor 2 (CRLF2), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-arginine-deiminase-type-3-padi3-bhp10515304</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP891552HU-SDS.jpg?v=1772280279</image:loc>
      <image:title>Recombinant Human
Protein-arginine deiminase type-3 (PADI3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-protein-pvrig-pvrig-partial-biotinylated-bhp10515322</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP721905HU1-B-SDS.jpg?v=1772280337</image:loc>
      <image:title>Recombinant Human Transmembrane protein PVRIG (PVRIG), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-protein-arginine-deiminase-type-2-padi2-bhp10515306</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP017377RA-SDS.jpg?v=1772280270</image:loc>
      <image:title>Recombinant Rat 
Protein-arginine deiminase type-2 (Padi2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-associated-calcium-signal-transducer-2-tacstd2-partial-bhp10515307</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023072MO-SDS.jpg?v=1772280337</image:loc>
      <image:title>Recombinant Mouse Tumor-associated calcium signal transducer 2 (Tacstd2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-polypeptide-related-sequence-b-micb-partial-bhp10515287</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5607HU2-SDS.jpg?v=1772280252</image:loc>
      <image:title>Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-surface-glycoprotein-cd4-cd4-partial-active-bhp10515317</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004935HU1-SDS.jpg?v=1772280283</image:loc>
      <image:title>Recombinant Human T-cell surface glycoprotein CD4 (CD4), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-molecule-micb-partial-active-bhp10515321</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5608HU-SDS.jpg?v=1772280281</image:loc>
      <image:title>Recombinant Human MHC class I molecule (MICB), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-chain-related-protein-mica-partial-active-bhp10515323</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5606HU-SDS.jpg?v=1772280334</image:loc>
      <image:title>Recombinant Human MHC Class I chain-related protein (MICA), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tissue-factor-f3-partial-bhp10515310</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007928MO1-SDS.jpg?v=1772280341</image:loc>
      <image:title>Recombinant Mouse Tissue factor (F3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-angiopoietin-1-angpt1-partial-bhp10515324</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP622996HU1-SDS.jpg?v=1772280276</image:loc>
      <image:title>Recombinant Human Angiopoietin-1 (ANGPT1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-arginine-deiminase-type-6-padi6-bhp10515305</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP744226HU-SDS.jpg?v=1772280342</image:loc>
      <image:title>Recombinant Human Protein-arginine deiminase type-6 (PADI6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-programmed-cell-death-protein-1-precursor-partial-biotinylated-bhp10515314</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5072DOj8-B-SDS.jpg?v=1772280334</image:loc>
      <image:title>Recombinant Dog Programmed Cell Death Protein 1 precursor, partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-coagulation-factor-ix-f9-bhp10515320</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6650MOW-SDS.jpg?v=1772280268</image:loc>
      <image:title>Recombinant Macaca mulatta Coagulation factor IX (F9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-1-alpha-il1a-bhp10515311</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011613HUd7-SDS.jpg?v=1772280344</image:loc>
      <image:title>Recombinant Human
Interleukin-1 alpha(IL1A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-procathepsin-l-ctsl-active-bhp10515318</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006193HU_A4_-SDS.jpg?v=1772280327</image:loc>
      <image:title>Recombinant Human Procathepsin L (CTSL) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-killer-cell-lectin-like-receptor-subfamily-g-member-1-klrg1-partial-biotinylated-bhp10515339</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012472MO-B-SDS.jpg?v=1772280337</image:loc>
      <image:title>Recombinant Mouse Killer cell lectin-like receptor subfamily G member 1 (Klrg1), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-angiopoietin-1-angpt1-partial-bhp10515331</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001706MO1-SDS.jpg?v=1772280343</image:loc>
      <image:title>Recombinant Mouse Angiopoietin-1 (Angpt1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-4-il4-biotinylated-bhp10515328</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011659HUd7-B-SDS.jpg?v=1772280326</image:loc>
      <image:title>Recombinant Human Interleukin-4 (IL4), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-kit-ligand-kitlg-partial-active-bhp10515315</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012376MO1-SDS.jpg?v=1772280319</image:loc>
      <image:title>Recombinant Mouse Kit ligand (Kitlg), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-coagulation-factor-x-f10-bhp10515327</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6651MOW-SDS.jpg?v=1772280267</image:loc>
      <image:title>Recombinant Macaca mulatta Coagulation factor X (F10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-10b-tnfrsf10b-partial-active-bhp10515330</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023965HU1d9-SDS.jpg?v=1772280333</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-threonine-protein-phosphatase-2a-65-kda-regulatory-subunit-a-alpha-isoform-ppp2r1a-bhp10515354</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018562HUa0-SDS.jpg?v=1772280266</image:loc>
      <image:title>Recombinant Human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (PPP2R1A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-thymic-stromal-lymphopoietin-tslp-biotinylated-active-bhp10515336</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5042MOVd7-B-SDS.jpg?v=1772280333</image:loc>
      <image:title>Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP), Biotinylated (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-thymic-stromal-lymphopoietin-tslp-active-bhp10515312</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5042MOVd7-SDS.jpg?v=1772280328</image:loc>
      <image:title>Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glutamate-carboxypeptidase-2-folh1-partial-active-bhp10515347</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008782HU1-SDS.jpg?v=1772280336</image:loc>
      <image:title>Recombinant Human Glutamate carboxypeptidase 2 (FOLH1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-lymphocyte-activation-gene-3-protein-lag3-partial-biotinylated-bhp10515343</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP720261MO-B-SDS.jpg?v=1772280332</image:loc>
      <image:title>Recombinant Mouse Lymphocyte activation gene 3 protein (Lag3), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-growth-differentiation-factor-9-gdf9-g391r-bhp10515319</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009352HU_M1_-SDS.jpg?v=1772280284</image:loc>
      <image:title>Recombinant Human Growth/differentiation factor 9 (GDF9) (G391R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-v-type-immunoglobulin-domain-containing-suppressor-of-t-cell-activation-vsir-partial-bhp10515341</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP884484HUh8-SDS.jpg?v=1772280336</image:loc>
      <image:title>Recombinant Human V-type immunoglobulin domain-containing suppressor of T-cell activation (VSIR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-3-ltbr-partial-active-bhp10515361</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013227HU1d9-SDS.jpg?v=1772280272</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-lymphotoxin-beta-receptor-ltbr-partial-active-bhp10515359</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6176MOVd9-SDS.jpg?v=1772280271</image:loc>
      <image:title>Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-receptor-superfamily-member-3-ltbr-partial-active-bhp10515363</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP013227MOd9-SDS.jpg?v=1772280282</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor receptor superfamily member 3 (Ltbr), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-glucagon-receptor-gcgr-partial-active-bhp10515329</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009316RA1-SDS.jpg?v=1772280277</image:loc>
      <image:title>Recombinant Rat Glucagon receptor (Gcgr), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-heat-shock-protein-hsp-90-beta-hsp90ab1-bhp10515344</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP686992MOV-SDS.jpg?v=1772280275</image:loc>
      <image:title>Recombinant Macaca fascicularis Heat shock protein HSP 90-beta (HSP90AB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-eukaryotic-translation-initiation-factor-4e-binding-protein-1-eif4ebp1-bhp10515340</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP623815HU_A4_-SDS.jpg?v=1772280282</image:loc>
      <image:title>Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 1 (EIF4EBP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-1-receptor-accessory-protein-like-1-il1rapl1-partial-active-bhp10515365</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005511HU1-D-SDS.jpg?v=1772280270</image:loc>
      <image:title>Recombinant Human Interleukin-1 receptor accessory protein-like 1 (IL1RAPL1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-active-bhp10515358</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP684467HU2-SDS.jpg?v=1772280278</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-6-il6-bhp10515342</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP305249MOV-SDS.jpg?v=1772280279</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin-6 (IL6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-insulin-like-growth-factor-2-igf2-bhp10515335</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011088BO-SDS.jpg?v=1772280276</image:loc>
      <image:title>Recombinant Bovine Insulin-like growth factor 2 (IGF2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunoglobulin-superfamily-member-11-igf1r-partial-bhp10515349</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP691547HU-SDS.jpg?v=1772280344</image:loc>
      <image:title>Recombinant Human Immunoglobulin superfamily member 11 (IGF1R), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-1-beta-il1b-active-bhp10515325</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011614HU-SDS.jpg?v=1772280324</image:loc>
      <image:title>Recombinant Human Interleukin-1 beta (IL1B) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-apoptosis-associated-speck-like-protein-containing-a-card-pycard-bhp10515332</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-containing-g-protein-coupled-receptor-5-lgr5-partial-bhp10515326</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012906HU-SDS.jpg?v=1772280274</image:loc>
      <image:title>Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-inositol-1-4-5-trisphosphate-receptor-interacting-protein-like-1-itpripl1-partial-active-bhp10515352</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011916MO1-SDS.jpg?v=1772280284</image:loc>
      <image:title>Recombinant Mouse Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (Itpripl1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-itgav-and-itgb6-heterodimer-protein-active-bhp10515362</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6686MO-SDS.jpg?v=1772280264</image:loc>
      <image:title>Recombinant Mouse Itgav&amp;Itgb6 Heterodimer Protein (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atrial-natriuretic-peptide-receptor-3-npr3-partial-bhp10515353</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP016025HU2-SDS.jpg?v=1772280338</image:loc>
      <image:title>Recombinant Human Atrial natriuretic peptide receptor 3 (NPR3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-natural-cytotoxicity-triggering-receptor-3-ligand-1-ncr3lg1-partial-active-bhp10515355</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP737873HU-SDS.jpg?v=1772280275</image:loc>
      <image:title>Recombinant Human Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lymphocyte-activation-gene-3-protein-lag3-partial-active-bhp10515357</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012719HU3-SDS.jpg?v=1772280278</image:loc>
      <image:title>Recombinant Human Lymphocyte activation gene 3 protein (LAG3), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-growth-differentiation-factor-9-gdf9-bhp10515334</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009352HUp2-SDS.jpg?v=1772280288</image:loc>
      <image:title>Recombinant Human Growth/differentiation factor 9 (GDF9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cathepsin-g-ctsg-bhp10515435</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP006190HU-SDS.jpg?v=1772280270</image:loc>
      <image:title>Recombinant Human Cathepsin G (CTSG)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-1-receptor-type-2-il1r2-partial-active-bhp10515345</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011622HU1-SDS.jpg?v=1772280346</image:loc>
      <image:title>Recombinant Human Interleukin-1 receptor type 2 (IL1R2), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cerebellar-degeneration-related-protein-2-like-cdr2l-bhp10515433</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP005104HU-SDS.jpg?v=1772280281</image:loc>
      <image:title>Recombinant Human Cerebellar degeneration-related protein 2-like (CDR2L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-itgav-and-itgb6-heterodimer-protein-active-bhp10515360</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6145HU-SDS.jpg?v=1772280278</image:loc>
      <image:title>Recombinant Human ITGAV&amp;ITGB6 Heterodimer Protein (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-receptor-superfamily-member-4-tnfrsf4-partial-active-bhp10515346</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023981HU1d7-SDS.jpg?v=1772280284</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor receptor superfamily member 4 (TNFRSF4), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-dipeptidase-3-dpep3-bhp10515436</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP007125MOV-SDS.jpg?v=1772280280</image:loc>
      <image:title>Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mitotic-checkpoint-protein-bub3-bub3-bhp10515430</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP002884HUj9-SDS.jpg?v=1772280267</image:loc>
      <image:title>Recombinant Human Mitotic checkpoint protein BUB3 (BUB3）</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-inactive-tyrosine-protein-kinase-transmembrane-receptor-ror1-ror1-partial-active-bhp10515338</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP4008MO-SDS.jpg?v=1772280274</image:loc>
      <image:title>Recombinant Mouse Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Ror1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-induced-double-stranded-rna-activated-protein-kinase-eif2ak2-partial-bhp10515438</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP007511HUd7-SDS.jpg?v=1772280282</image:loc>
      <image:title>Recombinant Human Interferon-induced, double-stranded RNA-activated protein kinase (EIF2AK2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cerebellar-degeneration-related-protein-2-cdr2-bhp10515432</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP005103HU-SDS.jpg?v=1772280287</image:loc>
      <image:title>Recombinant Human Cerebellar degeneration-related protein 2(CDR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-ligand-superfamily-member-13-tnfsf13-active-bhp10515366</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023989HU-SDS.jpg?v=1772280279</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor ligand superfamily member 13 (TNFSF13) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-heat-shock-protein-hsp-90-alpha-hsp90aa1-bhp10515444</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP010802RA-SDS.jpg?v=1772280285</image:loc>
      <image:title>Recombinant Rat Heat shock protein HSP 90-alpha (Hsp90aa1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-insulin-like-growth-factor-1-receptor-igf1r-partial-active-bhp10515348</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011087HU1-SDS.jpg?v=1772280282</image:loc>
      <image:title>Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-induced-double-stranded-rna-activated-protein-kinase-eif2ak2-partial-bhp10515437</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP007511HU-SDS.jpg?v=1772280340</image:loc>
      <image:title>Recombinant Human Interferon-induced, double-stranded RNA-activated protein kinase (EIF2AK2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-o-glcnacase-oga-bhp10515446</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP013786HU_A4_-SDS.jpg?v=1772280287</image:loc>
      <image:title>Recombinant Human Protein O-GlcNAcase (OGA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-heat-shock-protein-hsp-90-beta-hsp90ab1-bhp10515445</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP010808MO-SDS.jpg?v=1772280276</image:loc>
      <image:title>Recombinant Mouse Heat shock protein HSP 90-beta (Hsp90ab1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-folate-receptor-alpha-folr1-partial-bhp10515440</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP008784HU-SDS.jpg?v=1772280283</image:loc>
      <image:title>Recombinant Human Folate receptor alpha (FOLR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-galactose-1-phosphate-uridylyltransferase-galt-bhp10515442</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP009226HUa0-SDS.jpg?v=1772280288</image:loc>
      <image:title>Recombinant Human Galactose-1-phosphate uridylyltransferase (GALT)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pendrin-slc26a4-partial-bhp10515453</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP021527HU2-SDS.jpg?v=1772280277</image:loc>
      <image:title>Recombinant Human Pendrin (SLC26A4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-thrombopoietin-thpo-bhp10515455</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP023509HU_A4_-SDS.jpg?v=1772280278</image:loc>
      <image:title>Recombinant Human Thrombopoietin (THPO)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-galactose-1-phosphate-uridylyltransferase-galt-bhp10515441</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP009226HU-SDS.jpg?v=1772280280</image:loc>
      <image:title>Recombinant Human Galactose-1-phosphate uridylyltransferase (GALT)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-gastric-inhibitory-polypeptide-receptor-gipr-partial-bhp10515443</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP009438RA1-SDS.jpg?v=1772280353</image:loc>
      <image:title>Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myosin-regulatory-light-chain-12b-myl12b-bhp10515448</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP015308HU-SDS.jpg?v=1772280284</image:loc>
      <image:title>Recombinant Human Myosin regulatory light chain 12B (MYL12B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-homeobox-protein-nkx-3-2-nkx3-2-partial-bhp10515449</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcription-factor-pu-1-spi1-bhp10515454</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP022567HU-SDS.jpg?v=1772280278</image:loc>
      <image:title>Recombinant Human Transcription factor PU.1 (SPI1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tyrosinase-tyr-partial-bhp10515456</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP025394HU1-SDS.jpg?v=1772280283</image:loc>
      <image:title>Recombinant Human Tyrosinase (TYR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-poly-adp-ribose-polymerase-1-parp1-bhp10515452</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP017457HU_A5_-SDS.jpg?v=1772280296</image:loc>
      <image:title>Recombinant Human Poly [ADP-ribose] polymerase 1 (PARP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cadherin-16-cdh16-partial-bhp10515431</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP005041HU-SDS.jpg?v=1772280338</image:loc>
      <image:title>Recombinant Human Cadherin-16 (CDH16), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-strain-zh-548-m12-nucleoprotein-n-bhp10515462</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP322011REV-SDS.jpg?v=1772280283</image:loc>
      <image:title>Recombinant strain ZH-548 M12 Nucleoprotein (N)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-bifunctional-epoxide-hydrolase-2-ephx2-bhp10515439</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP007735RA-SDS.jpg?v=1772280284</image:loc>
      <image:title>Recombinant Rat Bifunctional epoxide hydrolase 2 (Ephx2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-newcastle-disease-virus-hemagglutinin-neuraminidase-hn-partial-bhp10515464</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP336075NCW1a0-SDS.jpg?v=1772280284</image:loc>
      <image:title>Recombinant Newcastle disease virus Hemagglutinin-neuraminidase (HN), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tyrosinase-tyr-partial-bhp10515457</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP025394HU2-SDS.jpg?v=1772280283</image:loc>
      <image:title>Recombinant Human Tyrosinase (TYR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-rna-binding-protein-nova-1-nova1-bhp10515450</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP015957HU-SDS.jpg?v=1772280280</image:loc>
      <image:title>Recombinant Human RNA-binding protein Nova-1 (NOVA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-udp-n-acetylglucosamine-peptide-n-acetylglucosaminyltransferase-110-kda-subunit-ogt-bhp10515451</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP016315HU_A4_-SDS.jpg?v=1772280280</image:loc>
      <image:title>Recombinant Human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (OGT )</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rice-os05g0317700-protein-partial-bhp10515476</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP6636OFG-SDS.jpg?v=1772280290</image:loc>
      <image:title>Recombinant Rice Os05g0317700 protein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myosin-regulatory-light-chain-12a-myl12a-bhp10515447</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP015307HU-SDS.jpg?v=1772280283</image:loc>
      <image:title>Recombinant Human Myosin regulatory light chain 12A (MYL12A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-udp-glucuronosyltransferase-1a4-ugt1a4-partial-bhp10515458</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP025577HU1-SDS.jpg?v=1772280282</image:loc>
      <image:title>Recombinant Human UDP-glucuronosyltransferase 1A4 (UGT1A4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plutella-xylostella-n6-adenosine-methyltransferase-subunit-mettl14-bhp10515475</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP6489EXE-SDS.jpg?v=1772280287</image:loc>
      <image:title>Recombinant Plutella xylostella N6-adenosine-methyltransferase subunit METTL14</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-herpesvirus-4-capsid-scaffolding-protein-bvrf2-bdrf1-partial-bhp10515466</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP360995EFA-SDS.jpg?v=1772280286</image:loc>
      <image:title>Recombinant Human herpesvirus 4 Capsid scaffolding protein (BVRF2/BdRF1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-heat-shock-protein-hsp-90-beta-hsp90ab1-bhp10515477</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP686992MOV-SDS.jpg?v=1772280289</image:loc>
      <image:title>Recombinant Macaca fascicularis Heat shock protein HSP 90-beta (HSP90AB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-wnt-5a-wnt5a-bhp10515459</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP026138HUm8-SDS.jpg?v=1772280296</image:loc>
      <image:title>Recombinant Human Protein Wnt-5a (WNT5A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-delta-and-notch-like-epidermal-growth-factor-related-receptor-dner-partial-bhp10515481</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP818784HU-SDS.jpg?v=1772280291</image:loc>
      <image:title>Recombinant Human Delta and Notch-like epidermal growth factor-related receptor (DNER), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-rna-binding-protein-nova-1-nova1-bhp10515479</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP772155RA-SDS.jpg?v=1772280289</image:loc>
      <image:title>Recombinant Rat RNA-binding protein Nova-1 (Nova1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plutella-xylostella-nadh-dehydrogenase-ubiquinone-1-beta-subcomplex-subunit-9-partial-bhp10515472</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP6162EXEc7-SDS.jpg?v=1772280286</image:loc>
      <image:title>Recombinant Plutella xylostella NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-serine-threonine-protein-kinase-receptor-acvrl1-partial-active-bhp10515469</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP5806MOV-SDS.jpg?v=1772280287</image:loc>
      <image:title>Recombinant Macaca fascicularis Serine/threonine-protein kinase receptor (ACVRL1), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-severe-acute-respiratory-syndrome-coronavirus-2-replicase-polyprotein-1ab-rep-partial-bhp10515465</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP3420GND1-SDS.jpg?v=1772280285</image:loc>
      <image:title>Recombinant Severe acute respiratory syndrome coronavirus 2 Replicase polyprotein 1ab (rep), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-influenza-a-virus-nucleoprotein-np-bhp10515468</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP395556ILQ-SDS.jpg?v=1772280285</image:loc>
      <image:title>Recombinant Influenza A virus Nucleoprotein (NP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-falciparum-thrombospondin-related-anonymous-protein-trap-partial-bhp10515463</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP323735PLO-SDS.jpg?v=1772280283</image:loc>
      <image:title>Recombinant Plasmodium falciparum Thrombospondin-related anonymous protein (TRAP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-ndnf-ndnf-bhp10515480</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP807450MO-SDS.jpg?v=1772280291</image:loc>
      <image:title>Recombinant Mouse Protein NDNF (Ndnf)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-rna-binding-protein-nova-1-nova1-bhp10515489</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP881336MO-SDS.jpg?v=1772280295</image:loc>
      <image:title>Recombinant Mouse RNA-binding protein Nova-1 (Nova1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plutella-xylostella-nadh-dehydrogenase-ubiquinone-1-beta-subcomplex-subunit-9-partial-bhp10515471</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP6162EXE-SDS.jpg?v=1772280286</image:loc>
      <image:title>Recombinant Plutella xylostella NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dihydropyrimidinase-related-protein-5-dpysl5-bhp10515484</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP857765HU-SDS.jpg?v=1772280290</image:loc>
      <image:title>Recombinant Human Dihydropyrimidinase-related protein 5 (DPYSL5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-niban-1-niban1-bhp10515492</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP883649HU_A4_-SDS.jpg?v=1772280293</image:loc>
      <image:title>Recombinant Human Protein Niban 1 (NIBAN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-influenza-b-virus-nucleoprotein-np-partial-bhp10515461</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP319610IIR-SDS.jpg?v=1772280283</image:loc>
      <image:title>Recombinant Influenza B virus Nucleoprotein (NP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pseudouridylate-synthase-pus7l-pus7l-bhp10515487</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP867121HU-SDS.jpg?v=1772280295</image:loc>
      <image:title>Recombinant Human Pseudouridylate synthase PUS7L (PUS7L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-interleukin-13-il13-bhp10515488</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP8682269DO-SDS.jpg?v=1772280295</image:loc>
      <image:title>Recombinant Dog Interleukin-13 (IL13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-werner-syndrome-atp-dependent-helicase-isoform-x2-partial-bhp10515470</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP5942DO-SDS.jpg?v=1772280286</image:loc>
      <image:title>Recombinant Dog Werner syndrome ATP-dependent helicase isoform X2, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-toll-like-receptor-2-tlr2-bhp10515533</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023601HU-SDS.jpg?v=1772280294</image:loc>
      <image:title>Recombinant Human Toll-like receptor 2 (TLR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-histidine-kinase-agrc-nanodisc-bhp10515561</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF7131FKZ-N-SDS.jpg?v=1772280296</image:loc>
      <image:title>Recombinant Staphylococcus aureus Histidine kinase (agrC), Nanodisc</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cyclin-dependent-kinase-12-cdk12-partial-bhp10515491</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP882147HUa0-SDS.jpg?v=1772280293</image:loc>
      <image:title>Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-repair-protein-rad50-rad50-partial-bhp10515483</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP838816HU1-SDS.jpg?v=1772280291</image:loc>
      <image:title>Recombinant Human DNA repair protein RAD50 (RAD50), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-melanocyte-stimulating-hormone-receptor-mc1r-bhp10515541</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF086369HU-SDS.jpg?v=1772280295</image:loc>
      <image:title>Recombinant Human Melanocyte-stimulating hormone receptor (MC1R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cyclin-dependent-kinase-12-cdk12-partial-bhp10515490</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP882147HU-SDS.jpg?v=1772280294</image:loc>
      <image:title>Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-traip-traip1-bhp10515486</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP866296HUb1-SDS.jpg?v=1772280295</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase TRAIP (TRAIP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prohibitin-2-phb2-bhp10515584</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF859937HUc7-SDS.jpg?v=1772280298</image:loc>
      <image:title>Recombinant Human Prohibitin-2 (PHB2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-origin-recognition-complex-subunit-1-orc1-r297e-s450y-t593y-r846e-bhp10515474</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP621667HU_A4_M_-SDS.jpg?v=1772280289</image:loc>
      <image:title>Recombinant Human Origin recognition complex subunit 1 (ORC1)(R297E,S450Y,T593Y,R846E)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacteriophage-h30-shiga-like-toxin-1-subunit-b-stxb-bhp10515460</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP303961BDK-SDS.jpg?v=1772280282</image:loc>
      <image:title>Recombinant Bacteriophage H30 Shiga-like toxin 1 subunit B (stxB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-nadph-oxidase-4-nox4-bhp10515522</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF015961MO_A4_-SDS.jpg?v=1772280295</image:loc>
      <image:title>Recombinant Mouse NADPH oxidase 4 (Nox4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-4-l6-family-member-4-tm4sf4-bhp10515534</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023619HU-SDS.jpg?v=1772280293</image:loc>
      <image:title>Recombinant Human Transmembrane 4 L6 family member 4 (TM4SF4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-protein-hapless-2-hap2-bhp10515550</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF518991DOA_A4_d7-SDS.jpg?v=1772280295</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Protein HAPLESS 2 (HAP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-protease-serine-3-tmprss3-bhp10515537</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023925HU-SDS.jpg?v=1772280294</image:loc>
      <image:title>Recombinant Human Transmembrane protease serine 3 (TMPRSS3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-long-chain-fatty-acid-transport-protein-4-slc27a4-bhp10515566</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF761274HU-SDS.jpg?v=1772280297</image:loc>
      <image:title>Recombinant Human Long-chain fatty acid transport protein 4 (SLC27A4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-long-chain-fatty-acid-coa-ligase-4-acsl4-bhp10515597</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001193RA-SDS.jpg?v=1772280298</image:loc>
      <image:title>Recombinant Rat Long-chain-fatty-acid--CoA ligase 4 (Acsl4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-zea-mays-transcription-factor-teosinte-branched-1-tb1-bhp10515482</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP835951ZAX-SDS.jpg?v=1772280289</image:loc>
      <image:title>Recombinant Zea mays Transcription factor TEOSINTE BRANCHED 1 (TB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-aldo-keto-reductase-family-1-member-b10-akr1b10-k125l-bhp10515606</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001540HU_M_-SDS.jpg?v=1772280298</image:loc>
      <image:title>Recombinant Human Aldo-keto reductase family 1 member B10 (AKR1B10) (K125L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-probable-g-protein-coupled-receptor-27-gpr27-bhp10515506</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF009799MO-SDS.jpg?v=1772280294</image:loc>
      <image:title>Recombinant Mouse Probable G-protein coupled receptor 27 (Gpr27)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-alpha-actinin-4-actn4-partial-bhp10515598</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001244MO-SDS.jpg?v=1772280298</image:loc>
      <image:title>Recombinant Mouse Alpha-actinin-4 (Actn4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-metalloendopeptidase-oma1-mitochondrial-oma1-active-bhp10515582</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF856923HUb0-SDS.jpg?v=1772280296</image:loc>
      <image:title>Recombinant Human Metalloendopeptidase OMA1, mitochondrial (OMA1) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kinesin-like-protein-kif22-kif22-bhp10515473</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP619894HU-SDS.jpg?v=1772280286</image:loc>
      <image:title>Recombinant Human Kinesin-like protein KIF22 (KIF22)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calcium-load-activated-calcium-channel-tmco1-bhp10515593</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF891784HU-SDS.jpg?v=1772280297</image:loc>
      <image:title>Recombinant Human Calcium load-activated calcium channel (TMCO1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-aryl-hydrocarbon-receptor-ahr-partial-bhp10515603</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001481MO1-SDS.jpg?v=1772280299</image:loc>
      <image:title>Recombinant Mouse Aryl hydrocarbon receptor (Ahr), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sphingosine-1-phosphate-receptor-5-s1pr5-bhp10515575</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF838693MO-SDS.jpg?v=1772280296</image:loc>
      <image:title>Recombinant Mouse Sphingosine 1-phosphate receptor 5 (S1pr5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-muellerian-inhibiting-factor-amh-bhp10515612</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001666RA-SDS.jpg?v=1772280301</image:loc>
      <image:title>Recombinant Rat Muellerian-inhibiting factor (Amh)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-a-disintegrin-and-metalloproteinase-with-thrombospondin-motifs-12-adamts12-partial-bhp10515600</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001300HU-SDS.jpg?v=1772280297</image:loc>
      <image:title>Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 12 (ADAMTS12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-medium-chain-specific-acyl-coa-dehydrogenase-mitochondrial-acadm-bhp10515595</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001126HUc7-SDS.jpg?v=1772280297</image:loc>
      <image:title>Recombinant Human Medium-chain specific acyl-CoA dehydrogenase, mitochondrial (ACADM)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hepatitis-delta-virus-genotype-i-small-delta-antigen-bhp10515467</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP361989HFN-SDS.jpg?v=1772280286</image:loc>
      <image:title>Recombinant Hepatitis delta virus genotype I Small delta antigen</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-growth-arrest-specific-protein-6-gas6-bhp10515478</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP723418MO-SDS.jpg?v=1772280293</image:loc>
      <image:title>Recombinant Mouse Growth arrest-specific protein 6 (Gas6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-long-chain-fatty-acid-coa-ligase-4-acsl4-partial-bhp10515596</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001193HU2-SDS.jpg?v=1772280297</image:loc>
      <image:title>Recombinant Human Long-chain-fatty-acid--CoA ligase 4 (ACSL4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-traip-traip1-bhp10515485</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP866296HU-SDS.jpg?v=1772280293</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase TRAIP (TRAIP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fructose-bisphosphate-aldolase-b-aldob-bhp10515611</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001586HU-SDS.jpg?v=1772280300</image:loc>
      <image:title>Recombinant Human Fructose-bisphosphate aldolase B (ALDOB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-disintegrin-and-metalloproteinase-domain-containing-protein-23-adam23-bhp10515599</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001285HUc7-SDS.jpg?v=1772280296</image:loc>
      <image:title>Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-aquaporin-4-aqp4-partial-biotinylated-bhp10515615</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001964HU-B-SDS.jpg?v=1772280299</image:loc>
      <image:title>Recombinant Human Aquaporin-4 (AQP4), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-aflatoxin-b1-aldehyde-reductase-member-2-akr7a2-bhp10515607</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001550HU-SDS.jpg?v=1772280299</image:loc>
      <image:title>Recombinant Human Aflatoxin B1 aldehyde reductase member 2 (AKR7A2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-inducible-protein-aim2-aim2-biotinylated-bhp10515605</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001499HU-B-SDS.jpg?v=1772280299</image:loc>
      <image:title>Recombinant Human Interferon-inducible protein AIM2 (AIM2), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-inducible-protein-aim2-aim2-bhp10515604</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001499HU-SDS.jpg?v=1772280299</image:loc>
      <image:title>Recombinant Human Interferon-inducible protein AIM2 (AIM2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-delta-1-pyrroline-5-carboxylate-dehydrogenase-mitochondrial-aldh4a1-bhp10515610</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001576HU-SDS.jpg?v=1772280299</image:loc>
      <image:title>Recombinant Human Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial (ALDH4A1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-translocator-protein-tspo-bhp10515540</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF025168HU-SDS.jpg?v=1772280294</image:loc>
      <image:title>Recombinant Human Translocator protein (TSPO)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-osteocalcin-bglap-bhp10515627</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002682MOe3-SDS.jpg?v=1772280305</image:loc>
      <image:title>Recombinant Mouse Osteocalcin (Bglap)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alpha-2a-adrenergic-receptor-adra2a-partial-bhp10515601</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001388HU1-SDS.jpg?v=1772280297</image:loc>
      <image:title>Recombinant Human Alpha-2A adrenergic receptor (ADRA2A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bifunctional-purine-biosynthesis-protein-atic-atic-bhp10515617</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002299HU-SDS.jpg?v=1772280302</image:loc>
      <image:title>Recombinant Human Bifunctional purine biosynthesis protein ATIC (ATIC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-aryl-hydrocarbon-receptor-ahr-partial-bhp10515602</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001481HU6-SDS.jpg?v=1772280297</image:loc>
      <image:title>Recombinant Human Aryl hydrocarbon receptor (AHR) , partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-basic-leucine-zipper-transcriptional-factor-atf-like-batf-bhp10515623</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002570MO-SDS.jpg?v=1772280304</image:loc>
      <image:title>Recombinant Mouse Basic leucine zipper transcriptional factor ATF-like (Batf)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-apolipoprotein-a-i-apoa1-partial-bhp10515614</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001913RA-SDS.jpg?v=1772280300</image:loc>
      <image:title>Recombinant Rat Apolipoprotein A-I (Apoa1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-rac-alpha-serine-threonine-protein-kinase-akt1-bhp10515608</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001553HUc7-SDS.jpg?v=1772280299</image:loc>
      <image:title>Recombinant Human RAC-alpha serine/threonine-protein kinase (AKT1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transcription-regulator-protein-bach1-bach1-bhp10515622</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002526MO-SDS.jpg?v=1772280305</image:loc>
      <image:title>Recombinant Mouse Transcription regulator protein BACH1 (Bach1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serum-amyloid-p-component-apcs-bhp10515613</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001898HUe1-SDS.jpg?v=1772280303</image:loc>
      <image:title>Recombinant Human Serum amyloid P-component (APCS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcription-regulator-protein-bach1-bach1-bhp10515621</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002526HU-SDS.jpg?v=1772280305</image:loc>
      <image:title>Recombinant Human Transcription regulator protein BACH1 (BACH1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bcl-2-like-protein-1-bcl2l1-partial-bhp10515626</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002613HUc7-SDS.jpg?v=1772280304</image:loc>
      <image:title>Recombinant Human Bcl-2-like protein 1(BCL2L1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-biliverdin-reductase-a-blvra-bhp10515630</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002721MO-SDS.jpg?v=1772280306</image:loc>
      <image:title>Recombinant Mouse Biliverdin reductase A (Blvra)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-amphiregulin-areg-partial-bhp10515616</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001986MO1-SDS.jpg?v=1772280301</image:loc>
      <image:title>Recombinant Mouse Amphiregulin (Areg), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-potassium-transporting-atpase-subunit-alpha-2-atp1a2-partial-bhp10515618</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002323HU-SDS.jpg?v=1772280303</image:loc>
      <image:title>Recombinant Human Sodium/potassium-transporting ATPase subunit alpha-2 (ATP1A2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-bone-morphogenetic-protein-15-bmp15-bhp10515631</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002735MO-SDS.jpg?v=1772280307</image:loc>
      <image:title>Recombinant Mouse Bone morphogenetic protein 15 (Bmp15)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bactericidal-permeability-increasing-protein-bpi-biotinylated-bhp10515634</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002783HU-B-SDS.jpg?v=1772280308</image:loc>
      <image:title>Recombinant Human Bactericidal permeability-increasing protein (BPI), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-2-oxoisovalerate-dehydrogenase-subunit-alpha-mitochondrial-bckdha-bhp10515625</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-albumin-alb-bhp10515609</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP001561CA-SDS.jpg?v=1772280299</image:loc>
      <image:title>Recombinant Cat Albumin (ALB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-v-type-proton-atpase-subunit-b-brain-isoform-atp6v1b2-bhp10515619</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002398HUc7-SDS.jpg?v=1772280302</image:loc>
      <image:title>Recombinant Human V-type proton ATPase subunit B,brain isoform (ATP6V1B2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-bone-morphogenetic-protein-6-bmp6-bhp10515633</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002742MO-SDS.jpg?v=1772280306</image:loc>
      <image:title>Recombinant Mouse Bone morphogenetic protein 6 (Bmp6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-caspase-9-casp9-partial-bhp10515647</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004555HU1-SDS.jpg?v=1772280308</image:loc>
      <image:title>Recombinant Human Caspase-9 (CASP9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-bone-morphogenetic-protein-4-bmp4-bhp10515632</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002740MO-SDS.jpg?v=1772280308</image:loc>
      <image:title>Recombinant Mouse Bone morphogenetic protein 4 (Bmp4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-complement-c1q-subcomponent-subunit-c-c1qc-partial-bhp10515643</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP003641HU1-SDS.jpg?v=1772280308</image:loc>
      <image:title>Recombinant Human Complement C1q subcomponent subunit C (C1QC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-basigin-bsg-partial-bhp10515637</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP117574h-SDS.jpg?v=1772280306</image:loc>
      <image:title>Recombinant Human Basigin (BSG), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-recq-like-dna-helicase-blm-blm-partial-bhp10515628</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-v-type-proton-atpase-subunit-c-1-atp6v1c1-bhp10515620</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002399HU-SDS.jpg?v=1772280304</image:loc>
      <image:title>Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tyrosine-protein-kinase-btk-btk-c481s-partial-bhp10515639</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002867HU1_M_-SDS.jpg?v=1772280308</image:loc>
      <image:title>Recombinant Human Tyrosine-protein kinase BTK (BTK) (C481S), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cadherin-16-cdh16-partial-bhp10515652</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005041MO-SDS.jpg?v=1772280310</image:loc>
      <image:title>Recombinant Mouse Cadherin-16 (Cdh16), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-probetacellulin-btc-partial-bhp10515638</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002853MO-SDS.jpg?v=1772280308</image:loc>
      <image:title>Recombinant Mouse Probetacellulin (Btc), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bactericidal-permeability-increasing-protein-bpi-bhp10515635</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002783HUj9-SDS.jpg?v=1772280307</image:loc>
      <image:title>Recombinant Human Bactericidal permeability-increasing protein (BPI)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-breast-cancer-type-1-susceptibility-protein-brca1-partial-bhp10515636</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP096594h_N_-SDS.jpg?v=1772280307</image:loc>
      <image:title>Recombinant Human Breast cancer type 1 susceptibility protein (BRCA1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-branched-chain-amino-acid-aminotransferase-mitochondrial-bcat2-l39k-bhp10515624</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002601HU_M_-SDS.jpg?v=1772280304</image:loc>
      <image:title>Recombinant Human Branched-chain-amino-acid aminotransferase, mitochondrial (BCAT2) (L39K)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-motif-chemokine-2-ccl2-bhp10515648</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004783HUf0-SDS.jpg?v=1772280308</image:loc>
      <image:title>Recombinant Human C-C motif chemokine 2 (CCL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tyrosine-protein-kinase-btk-btk-bhp10515641</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002867MO-SDS.jpg?v=1772280308</image:loc>
      <image:title>Recombinant Mouse Tyrosine-protein kinase BTK (Btk)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neuronal-acetylcholine-receptor-subunit-alpha-7-chrna7-c212a-partial-bhp10515662</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005393MO_M1_-SDS.jpg?v=1772280309</image:loc>
      <image:title>Recombinant Mouse Neuronal acetylcholine receptor subunit alpha-7 (Chrna7) (C212A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-surface-antigen-cd2-cd2-partial-bhp10515650</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004894HUc7-SDS.jpg?v=1772280310</image:loc>
      <image:title>Recombinant Human T-cell surface antigen CD2 (CD2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tyrosine-protein-kinase-btk-btk-m437r-partial-bhp10515640</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP002867HU1_M1_-SDS.jpg?v=1772280306</image:loc>
      <image:title>Recombinant Human Tyrosine-protein kinase BTK (BTK) (M437R), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ccaat-enhancer-binding-protein-alpha-cebpa-bhp10515653</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-g1-s-specific-cyclin-d2-ccnd2-bhp10515649</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004812HUc7-SDS.jpg?v=1772280310</image:loc>
      <image:title>Recombinant Human G1/S-specific cyclin-D2 (CCND2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ccaat-enhancer-binding-protein-beta-cebpb-bhp10515654</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005181HU-SDS.jpg?v=1772280309</image:loc>
      <image:title>Recombinant Human CCAAT/enhancer-binding protein beta (CEBPB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neuronal-acetylcholine-receptor-subunit-alpha-3-chrna3-partial-bhp10515657</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005389HU1d7-SDS.jpg?v=1772280310</image:loc>
      <image:title>Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-chromogranin-a-chga-partial-bhp10515655</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005344HU1d7-SDS.jpg?v=1772280310</image:loc>
      <image:title>Recombinant Human Chromogranin-A (CHGA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neuronal-acetylcholine-receptor-subunit-alpha-7-chrna7-partial-bhp10515659</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005393HUg2-SDS.jpg?v=1772280310</image:loc>
      <image:title>Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-terminal-binding-protein-2-ctbp2-partial-bhp10515670</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-complement-c3-c3-partial-bhp10515645</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-caspase-1-casp1-partial-biotinylated-bhp10515646</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP004543HU2-B-SDS.jpg?v=1772280309</image:loc>
      <image:title>Recombinant Human Caspase-1 (CASP1), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calcium-activated-chloride-channel-regulator-1-clca1-partial-bhp10515666</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005474HU2-SDS.jpg?v=1772280310</image:loc>
      <image:title>Recombinant Human Calcium-activated chloride channel regulator 1 (CLCA1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-clarin-1-clrn1-partial-bhp10515667</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005583HU1a0-SDS.jpg?v=1772280310</image:loc>
      <image:title>Recombinant Human Clarin-1 (CLRN1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neuronal-acetylcholine-receptor-subunit-alpha-7-chrna7-partial-bhp10515660</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005393MO-SDS.jpg?v=1772280310</image:loc>
      <image:title>Recombinant Mouse Neuronal acetylcholine receptor subunit alpha-7 (Chrna7), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cysteine-rich-secretory-protein-3-crisp3-partial-bhp10515668</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005976HU1-SDS.jpg?v=1772280310</image:loc>
      <image:title>Recombinant Human Cysteine-rich secretory protein 3 (CRISP3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calcium-activated-chloride-channel-regulator-1-clca1-partial-bhp10515665</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005474HU1-SDS.jpg?v=1772280310</image:loc>
      <image:title>Recombinant Human Calcium-activated chloride channel regulator 1 (CLCA1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cell-division-control-protein-42-homolog-cdc42-bhp10515651</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005008MO-SDS.jpg?v=1772280310</image:loc>
      <image:title>Recombinant Mouse Cell division control protein 42 homolog (Cdc42)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neuronal-acetylcholine-receptor-subunit-alpha-7-chrna7-c212a-c213a-partial-bhp10515663</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005393MO_M2_-SDS.jpg?v=1772280311</image:loc>
      <image:title>Recombinant Mouse Neuronal acetylcholine receptor subunit alpha-7 (Chrna7) (C212A, C213A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c-x-c-motif-chemokine-2-cxcl2-bhp10515673</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP092274m-SDS.jpg?v=1772280314</image:loc>
      <image:title>Recombinant Mouse C-X-C motif chemokine 2 (Cxcl2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-catenin-beta-1-ctnnb1-bhp10515671</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neuronal-acetylcholine-receptor-subunit-alpha-7-chrna7-partial-bhp10515661</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-sheep-granulocyte-macrophage-colony-stimulating-factor-csf2-bhp10515669</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytochrome-c-cycs-bhp10515677</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006328HUc7-SDS.jpg?v=1772280316</image:loc>
      <image:title>Recombinant Human Cytochrome c (CYCS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-deformed-epidermal-autoregulatory-factor-1-homolog-deaf1-bhp10515684</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006644HUd7-SDS.jpg?v=1772280322</image:loc>
      <image:title>Recombinant Human Deformed epidermal autoregulatory factor 1 homolog (DEAF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cathepsin-f-ctsf-partial-bhp10515672</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP152794h-SDS.jpg?v=1772280315</image:loc>
      <image:title>Recombinant Human Cathepsin F (CTSF), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dihydrolipoyllysine-residue-acetyltransferase-component-of-pyruvate-dehydrogenase-complex-mitochondrial-dlat-partial-bhp10515688</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006926HUc7-SDS.jpg?v=1772280318</image:loc>
      <image:title>Recombinant Human Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (DLAT), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atp-dependent-rna-helicase-ddx3x-ddx3x-bhp10515683</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006621HUd7-SDS.jpg?v=1772280316</image:loc>
      <image:title>Recombinant Human ATP-dependent RNA helicase DDX3X (DDX3X)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytochrome-c1-heme-protein-mitochondrial-cyc1-bhp10515676</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006327HUc7-SDS.jpg?v=1772280317</image:loc>
      <image:title>Recombinant Human Cytochrome c1, heme protein, mitochondrial (CYC1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-recq-like-dna-helicase-blm-blm-k24a-partial-bhp10515629</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-eukaryotic-elongation-factor-2-kinase-eef2k-bhp10515693</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007435HU-SDS.jpg?v=1772280319</image:loc>
      <image:title>Recombinant Human Eukaryotic elongation factor 2 kinase (EEF2K)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dihydroorotate-dehydrogenase-quinone-mitochondrial-dhodh-partial-bhp10515687</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006852HU1d7-SDS.jpg?v=1772280315</image:loc>
      <image:title>Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytochrome-p450-11b2-mitochondrial-cyp11b2-bhp10515679</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006391HUa0-SDS.jpg?v=1772280315</image:loc>
      <image:title>Recombinant Human Cytochrome P450 11B2, mitochondrial (CYP11B2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-l-dopachrome-tautomerase-dct-partial-bhp10515681</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006562MO1c7-SDS.jpg?v=1772280315</image:loc>
      <image:title>Recombinant Mouse L-dopachrome tautomerase (Dct), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-dystrophin-dmd-partial-bhp10515689</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006963MO-SDS.jpg?v=1772280317</image:loc>
      <image:title>Recombinant Mouse Dystrophin (Dmd), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-beta-defensin-2-defb2-bhp10515686</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006705BO-SDS.jpg?v=1772280314</image:loc>
      <image:title>Recombinant Bovine Beta-defensin 2 (DEFB2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neuronal-acetylcholine-receptor-subunit-alpha-7-chrna7-partial-biotinylated-bhp10515658</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005393HU-B-SDS.jpg?v=1772280309</image:loc>
      <image:title>Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-creatine-kinase-u-type-mitochondrial-ckmt1a-bhp10515664</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytochrome-p450-11b1-mitochondrial-cyp11b1-bhp10515678</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006390HUd7-SDS.jpg?v=1772280317</image:loc>
      <image:title>Recombinant Human Cytochrome P450 11B1, mitochondrial (CYP11B1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-eva-1-homolog-c-eva1c-partial-bhp10515644</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-steroid-17-alpha-hydroxylase-17-20-lyase-cyp17a1-bhp10515680</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006392HUc7-SDS.jpg?v=1772280316</image:loc>
      <image:title>Recombinant Human Steroid 17-alpha-hydroxylase/17,20 lyase (CYP17A1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytochrome-c1-heme-protein-mitochondrial-cyc1-bhp10515675</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006327HUa0-SDS.jpg?v=1772280315</image:loc>
      <image:title>Recombinant Human Cytochrome c1,heme protein, mitochondrial (CYC1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-bifunctional-epoxide-hydrolase-2-ephx2-bhp10515699</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcription-factor-e2f3-e2f3-bhp10515691</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007342HUc7-SDS.jpg?v=1772280317</image:loc>
      <image:title>Recombinant Human Transcription factor E2F3 (E2F3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neuronal-acetylcholine-receptor-subunit-alpha-3-chrna3-partial-biotinylated-bhp10515656</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP005389HU1-B-SDS.jpg?v=1772280310</image:loc>
      <image:title>Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-pro-epidermal-growth-factor-egf-partial-bhp10515695</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007473BO1c4-SDS.jpg?v=1772280318</image:loc>
      <image:title>Recombinant Bovine pro-epidermal growth factor (EGF), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-pro-epidermal-growth-factor-egf-partial-bhp10515694</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007473BO1-SDS.jpg?v=1772280318</image:loc>
      <image:title>Recombinant Bovine pro-epidermal growth factor (EGF), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-coagulation-factor-ix-f9-partial-bhp10515709</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007936HU2-SDS.jpg?v=1772280322</image:loc>
      <image:title>Recombinant Human Coagulation factor IX (F9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-dipeptidase-3-dpep3-bhp10515690</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007125MOV-SDS.jpg?v=1772280318</image:loc>
      <image:title>Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atp-dependent-rna-helicase-ddx3x-ddx3x-bhp10515682</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006621HUc7-SDS.jpg?v=1772280316</image:loc>
      <image:title>Recombinant Human ATP-dependent RNA helicase DDX3X (DDX3X)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-epithelial-membrane-protein-2-emp2-partial-bhp10515697</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007649HU1-SDS.jpg?v=1772280319</image:loc>
      <image:title>Recombinant Human Epithelial membrane protein 2 (EMP2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-epithelial-cell-adhesion-molecule-epcam-partial-bhp10515698</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007717HUc7-SDS.jpg?v=1772280322</image:loc>
      <image:title>Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-pro-epidermal-growth-factor-egf-partial-bhp10515696</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007473BO2-SDS.jpg?v=1772280320</image:loc>
      <image:title>Recombinant Bovine pro-epidermal growth factor (EGF), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-endoplasmic-reticulum-resident-protein-29-erp29-partial-bhp10515704</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP053444h-SDS.jpg?v=1772280320</image:loc>
      <image:title>Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-beta-defensin-1-defb1-bhp10515685</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP006662BO-SDS.jpg?v=1772280313</image:loc>
      <image:title>Recombinant Bovine Beta-defensin 1 (DEFB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mitotic-checkpoint-protein-bub3-bub3-bhp10515642</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-exocyst-complex-component-5-exoc5-bhp10515706</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007883HU-SDS.jpg?v=1772280321</image:loc>
      <image:title>Recombinant Human Exocyst complex component 5 (EXOC5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-x-c-motif-chemokine-9-cxcl9-bhp10515674</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-erythropoietin-epo-bhp10515700</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-regulator-erg-erg-bhp10515703</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007781HUc7-SDS.jpg?v=1772280321</image:loc>
      <image:title>Recombinant Human Transcriptional regulator ERG (ERG)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-coagulation-factor-x-f10-partial-bhp10515708</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007915HU2g5-SDS.jpg?v=1772280320</image:loc>
      <image:title>Recombinant Human Coagulation factor X (F10), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ubiquitin-like-fubi-ribosomal-protein-es30-fusion-protein-fau-bhp10515713</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-eosinophil-peroxidase-epx-bhp10515701</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007756HUc7-SDS.jpg?v=1772280318</image:loc>
      <image:title>Recombinant Human Eosinophil peroxidase (EPX)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fatty-acid-synthase-fasn-partial-bhp10515712</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008435HU1-SDS.jpg?v=1772280322</image:loc>
      <image:title>Recombinant Human Fatty acid synthase (FASN), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-1-fgf1-bhp10515715</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008615HUa0-SDS.jpg?v=1772280323</image:loc>
      <image:title>Recombinant Human Fibroblast growth factor 1 (FGF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-fibroblast-growth-factor-9-fgf9-bhp10515720</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008638MO-SDS.jpg?v=1772280321</image:loc>
      <image:title>Recombinant Mouse Fibroblast growth factor 9 (Fgf9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-steroid-hormone-receptor-err1-esrra-bhp10515705</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007834HUa0-SDS.jpg?v=1772280334</image:loc>
      <image:title>Recombinant Human Steroid hormone receptor ERR1 (ESRRA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-endothelin-2-edn2-partial-bhp10515692</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007401MO-SDS.jpg?v=1772280335</image:loc>
      <image:title>Recombinant Mouse Endothelin-2 (Edn2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-coagulation-factor-ix-f9-partial-bhp10515710</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007936HU3-SDS.jpg?v=1772280320</image:loc>
      <image:title>Recombinant Human Coagulation factor IX (F9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-10-fgf10-partial-bhp10515716</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008616HUf0-SDS.jpg?v=1772280324</image:loc>
      <image:title>Recombinant Human Fibroblast growth factor 10(FGF10), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-folliculin-flcn-bhp10515722</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008711HU-SDS.jpg?v=1772280326</image:loc>
      <image:title>Recombinant Human Folliculin (FLCN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-excision-repair-protein-ercc-1-ercc1-bhp10515702</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007769HU-SDS.jpg?v=1772280319</image:loc>
      <image:title>Recombinant Human DNA excision repair protein ERCC-1 (ERCC1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-somatotropin-gh1-bhp10515742</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009407MOWd7-SDS.jpg?v=1772280326</image:loc>
      <image:title>Recombinant Macaca mulatta Somatotropin (GH1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-growth-differentiation-factor-11-gdf11-bhp10515735</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009344MO-SDS.jpg?v=1772280324</image:loc>
      <image:title>Recombinant Mouse Growth/differentiation factor 11 (Gdf11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-growth-differentiation-factor-9-gdf9-bhp10515736</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009352MO-SDS.jpg?v=1772280326</image:loc>
      <image:title>Recombinant Mouse Growth/differentiation factor 9 (Gdf9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-filamin-b-flnb-t2177a-v2354a-r2374a-partial-bhp10515724</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008725HU1_M_-SDS.jpg?v=1772280322</image:loc>
      <image:title>Recombinant Human Filamin-B (FLNB) (T2177A,V2354A,R2374A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-vascular-endothelial-growth-factor-d-vegfd-bhp10515721</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008674RA-SDS.jpg?v=1772280325</image:loc>
      <image:title>Recombinant Rat Vascular endothelial growth factor D (Vegfd)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-fatty-acid-binding-protein-adipocyte-fabp4-bhp10515711</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007945MOq8-SDS.jpg?v=1772280322</image:loc>
      <image:title>Recombinant Mouse Fatty acid-binding protein, adipocyte (Fabp4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-galactose-1-phosphate-uridylyltransferase-galt-bhp10515732</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009226HUc7-SDS.jpg?v=1772280325</image:loc>
      <image:title>Recombinant Human Galactose-1-phosphate uridylyltransferase (GALT)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-rna-binding-protein-fus-fus-bhp10515729</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009069HUc7-SDS.jpg?v=1772280321</image:loc>
      <image:title>Recombinant Human RNA-binding protein FUS (FUS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gamma-aminobutyric-acid-receptor-subunit-alpha-3-gabra3-partial-bhp10515731</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009142HU-SDS.jpg?v=1772280324</image:loc>
      <image:title>Recombinant Human Gamma-aminobutyric acid receptor subunit alpha-3 (GABRA3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-fibroblast-growth-factor-8-fgf8-bhp10515719</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008637MO-SDS.jpg?v=1772280323</image:loc>
      <image:title>Recombinant Mouse Fibroblast growth factor 8 (Fgf8)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-coagulation-factor-x-f10-partial-bhp10515707</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP007915HU2-SDS.jpg?v=1772280319</image:loc>
      <image:title>Recombinant Human Coagulation factor X (F10), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-fibroblast-growth-factor-21-fgf21-bhp10515717</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008627MOc7-SDS.jpg?v=1772280324</image:loc>
      <image:title>Recombinant Mouse Fibroblast growth factor 21 (Fgf21)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pro-glucagon-gcg-partial-bhp10515733</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009315HU1-SDS.jpg?v=1772280322</image:loc>
      <image:title>Recombinant Human Pro-glucagon (GCG), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pongo-abelii-glial-fibrillary-acidic-protein-gfap-bhp10515739</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009369PYXe1-SDS.jpg?v=1772280327</image:loc>
      <image:title>Recombinant Pongo abelii Glial fibrillary acidic protein (GFAP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-somatotropin-gh1-bhp10515741</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-guanine-nucleotide-binding-protein-g-i-subunit-alpha-2-gnai2-bhp10515745</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009589HU-SDS.jpg?v=1772280328</image:loc>
      <image:title>Recombinant Human Guanine nucleotide-binding protein G(i) subunit alpha-2 (GNAI2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gtp-binding-protein-gem-gem-bhp10515737</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009362HU-SDS.jpg?v=1772280328</image:loc>
      <image:title>Recombinant Human GTP-binding protein GEM (GEM)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fos-related-antigen-1-fosl1-bhp10515726</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008792HU-SDS.jpg?v=1772280327</image:loc>
      <image:title>Recombinant Human Fos-related antigen 1 (FOSL1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-filamin-b-flnb-partial-bhp10515723</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008725HU1-SDS.jpg?v=1772280323</image:loc>
      <image:title>Recombinant Human Filamin-B (FLNB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-glial-fibrillary-acidic-protein-gfap-bhp10515738</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009369MOa0-SDS.jpg?v=1772280325</image:loc>
      <image:title>Recombinant Mouse Glial fibrillary acidic protein (Gfap)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fad-linked-sulfhydryl-oxidase-alr-gfer-bhp10515740</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009370HU_A4_-SDS.jpg?v=1772280324</image:loc>
      <image:title>Recombinant Human FAD-linked sulfhydryl oxidase ALR (GFER)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glycogen-synthase-kinase-3-beta-gsk3b-bhp10515749</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009963HUc7-SDS.jpg?v=1772280327</image:loc>
      <image:title>Recombinant Human Glycogen synthase kinase-3 beta (GSK3B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-metabotropic-glutamate-receptor-5-grm5-partial-bhp10515748</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009935HUc7-SDS.jpg?v=1772280329</image:loc>
      <image:title>Recombinant Human Metabotropic glutamate receptor 5 (GRM5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibrinogen-beta-chain-fgb-bhp10515714</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibroblast-growth-factor-5-fgf5-partial-bhp10515718</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP095144h-SDS.jpg?v=1772280321</image:loc>
      <image:title>Recombinant Human Fibroblast growth factor 5 (FGF5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-horse-follitropin-subunit-beta-fshb-bhp10515728</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009018HO-SDS.jpg?v=1772280321</image:loc>
      <image:title>Recombinant Horse Follitropin subunit beta (FSHB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-hyaluronan-and-proteoglycan-link-protein-1-hapln1-bhp10515758</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010130MO-SDS.jpg?v=1772280328</image:loc>
      <image:title>Recombinant Mouse Hyaluronan and proteoglycan link protein 1 (Hapln1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-growth-hormone-releasing-hormone-receptor-ghrhr-partial-bhp10515743</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gdp-mannose-4-6-dehydratase-gmds-partial-bhp10515744</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009569HU1-SDS.jpg?v=1772280327</image:loc>
      <image:title>Recombinant Human GDP-mannose 4,6 dehydratase (GMDS), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gamma-aminobutyric-acid-receptor-subunit-alpha-2-gabra2-partial-bhp10515730</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009141HU-SDS.jpg?v=1772280323</image:loc>
      <image:title>Recombinant Human Gamma-aminobutyric acid receptor subunit alpha-2 (GABRA2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glutathione-peroxidase-3-gpx3-u73c-bhp10515747</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009868HU-SDS.jpg?v=1772280325</image:loc>
      <image:title>Recombinant Human Glutathione peroxidase 3 (GPX3) (U73C)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glutamate-cysteine-ligase-regulatory-subunit-gclm-bhp10515734</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-glutathione-s-transferase-mu-1-gstm1-partial-bhp10515755</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009979HUa0-SDS.jpg?v=1772280330</image:loc>
      <image:title>Recombinant Mouse Glutathione S-transferase Mu 1 (Gstm1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-granzyme-b-gzmb-bhp10515757</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010082HUc7-SDS.jpg?v=1772280327</image:loc>
      <image:title>Recombinant Human Granzyme B (GZMB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hepatocyte-nuclear-factor-3-alpha-foxa1-bhp10515727</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glycogen-synthase-kinase-3-beta-gsk3b-k85p-bhp10515750</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009963HU_M1_c7-SDS.jpg?v=1772280327</image:loc>
      <image:title>Recombinant Human Glycogen synthase kinase-3 beta (GSK3B)(K85P)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-histone-deacetylase-9-hdac9-partial-bhp10515762</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP179094h-SDS.jpg?v=1772280328</image:loc>
      <image:title>Recombinant Human Histone deacetylase 9 (HDAC9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-histidine-decarboxylase-hdc-partial-bhp10515764</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010246HU2c7-SDS.jpg?v=1772280332</image:loc>
      <image:title>Recombinant Human Histidine decarboxylase (HDC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-hexim1-hexim1-bhp10515766</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010318HU-SDS.jpg?v=1772280333</image:loc>
      <image:title>Recombinant Human Protein HEXIM1 (HEXIM1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gtpase-hras-hras-partial-biotinylated-bhp10515773</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010726HU-B-SDS.jpg?v=1772280333</image:loc>
      <image:title>Recombinant Human GTPase HRas (HRAS), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ragulator-complex-protein-lamtor5-lamtor5-bhp10515759</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glutathione-s-transferase-kappa-1-gstk1-partial-bhp10515753</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009978HUf0-SDS.jpg?v=1772280331</image:loc>
      <image:title>Recombinant Human Glutathione S-transferase kappa 1 (GSTK1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-insulin-like-growth-factor-1-igf1-bhp10515784</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011086MO-SDS.jpg?v=1772280337</image:loc>
      <image:title>Recombinant Mouse Insulin-like growth factor 1 (Igf1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-hexokinase-2-hk2-partial-bhp10515767</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010469MO-SDS.jpg?v=1772280330</image:loc>
      <image:title>Recombinant Mouse Hexokinase-2 (Hk2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-endoplasmic-reticulum-chaperone-bip-hspa5-bhp10515779</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010827MOc7-SDS.jpg?v=1772280331</image:loc>
      <image:title>Recombinant Mouse Endoplasmic reticulum chaperone BiP (Hspa5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glycogen-synthase-kinase-3-beta-gsk3b-y134p-bhp10515751</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009963HU_M2_c7-SDS.jpg?v=1772280327</image:loc>
      <image:title>Recombinant Human Glycogen synthase kinase-3 beta (GSK3B)(Y134P)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-histone-deacetylase-2-hdac2-bhp10515760</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010238HU-SDS.jpg?v=1772280328</image:loc>
      <image:title>Recombinant Human Histone deacetylase 2 (HDAC2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-interferon-gamma-ifng-bhp10515783</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011050RAa0-SDS.jpg?v=1772280334</image:loc>
      <image:title>Recombinant Rat Interferon gamma (Ifng)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-heat-shock-protein-hsp-90-beta-hsp90ab1-bhp10515777</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010808MOb1-SDS.jpg?v=1772280333</image:loc>
      <image:title>Recombinant Mouse Heat shock protein HSP 90-beta (Hsp90ab1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-heat-shock-protein-hsp-90-alpha-hsp90aa1-bhp10515774</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010802RA-SDS.jpg?v=1772280333</image:loc>
      <image:title>Recombinant Rat Heat shock protein HSP 90-alpha (Hsp90aa1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-fosb-fosb-bhp10515725</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP008791MO-SDS.jpg?v=1772280322</image:loc>
      <image:title>Recombinant Mouse Protein fosB (Fosb)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-insulin-like-growth-factor-2-igf2-bhp10515786</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011088MOc7-SDS.jpg?v=1772280336</image:loc>
      <image:title>Recombinant Mouse Insulin-like growth factor 2 (Igf2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-11-il11-bhp10515789</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011583HUa0-SDS.jpg?v=1772280332</image:loc>
      <image:title>Recombinant Human Interleukin-11 (IL11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-3-hydroxy-3-methylglutaryl-coenzyme-a-reductase-hmgcr-partial-bhp10515769</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010565HU2-SDS.jpg?v=1772280329</image:loc>
      <image:title>Recombinant Human 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGCR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-histone-deacetylase-3-hdac3-bhp10515761</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010239HUc7-SDS.jpg?v=1772280329</image:loc>
      <image:title>Recombinant Human Histone deacetylase 3 (HDAC3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glycogen-synthase-kinase-3-beta-gsk3b-d200p-bhp10515752</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009963HU_M3_c7-SDS.jpg?v=1772280326</image:loc>
      <image:title>Recombinant Human Glycogen synthase kinase-3 beta (GSK3B)(D200P)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-heat-shock-protein-hsp-90-alpha-hsp90aa1-bhp10515775</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010802RAb1-SDS.jpg?v=1772280331</image:loc>
      <image:title>Recombinant Rat Heat shock protein HSP 90-alpha (Hsp90aa1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-heparanase-hpse-partial-bhp10515772</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010716HUc7-SDS.jpg?v=1772280330</image:loc>
      <image:title>Recombinant Human Heparanase (HPSE), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-glutathione-s-transferase-mu-1-gstm1-partial-bhp10515754</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009979HU-SDS.jpg?v=1772280327</image:loc>
      <image:title>Recombinant Mouse Glutathione S-transferase Mu 1 (Gstm1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-endoplasmin-hsp90b1-bhp10515778</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010814HU-SDS.jpg?v=1772280332</image:loc>
      <image:title>Recombinant Human Endoplasmin (HSP90B1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-1-beta-il1b-bhp10515793</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011614MOV-SDS.jpg?v=1772280334</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin-1 beta (IL1B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-insulin-like-growth-factor-binding-protein-6-igfbp6-bhp10515787</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011100MO-SDS.jpg?v=1772280335</image:loc>
      <image:title>Recombinant Mouse Insulin-like growth factor-binding protein 6 (Igfbp6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-insulin-like-growth-factor-ii-igf2-e30r-f43l-s63p-bhp10515785</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011088HU_A4_M_-SDS.jpg?v=1772280336</image:loc>
      <image:title>Recombinant Human Insulin-like growth factor II (IGF2) (E30R, F43L, S63P)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-interleukin-4-il4-bhp10515798</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011659BO-SDS.jpg?v=1772280337</image:loc>
      <image:title>Recombinant Bovine Interleukin-4 (IL4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-antiviral-innate-immune-response-effector-ifit1-ifit1-bhp10515782</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011018MO-SDS.jpg?v=1772280333</image:loc>
      <image:title>Recombinant Mouse Antiviral innate immune response effector IFIT1 (Ifit1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-histidine-decarboxylase-hdc-partial-bhp10515763</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010246HU2-SDS.jpg?v=1772280331</image:loc>
      <image:title>Recombinant Human Histidine decarboxylase (HDC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-heat-shock-protein-hsp-90-alpha-hsp90aa1-bhp10515776</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010802RAd7-SDS.jpg?v=1772280332</image:loc>
      <image:title>Recombinant Rat Heat shock protein HSP 90-alpha (Hsp90aa1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-biotin-protein-ligase-hlcs-bhp10515768</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010518HU-SDS.jpg?v=1772280333</image:loc>
      <image:title>Recombinant Human Biotin--protein ligase (HLCS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-granzyme-a-gzma-bhp10515756</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010081MOa2-SDS.jpg?v=1772280328</image:loc>
      <image:title>Recombinant Mouse Granzyme A (Gzma)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-heme-oxygenase-1-hmox1-partial-bhp10515770</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010583HU1m10-SDS.jpg?v=1772280328</image:loc>
      <image:title>Recombinant Human Heme oxygenase 1 (HMOX1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-11-il11-bhp10515791</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011583MOa0-SDS.jpg?v=1772280335</image:loc>
      <image:title>Recombinant Mouse Interleukin-11 (Il11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-9-il9-bhp10515799</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011675HUa0-SDS.jpg?v=1772280336</image:loc>
      <image:title>Recombinant Human Interleukin-9 (IL9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-indian-hedgehog-protein-ihh-partial-bhp10515788</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011569MO-SDS.jpg?v=1772280350</image:loc>
      <image:title>Recombinant Mouse Indian hedgehog protein (Ihh), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-binding-protein-inhibitor-id-3-id3-bhp10515781</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010969HU-SDS.jpg?v=1772280332</image:loc>
      <image:title>Recombinant Human DNA-binding protein inhibitor ID-3 (ID3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-interleukin-17a-il17a-bhp10515792</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011597MOV-SDS.jpg?v=1772280335</image:loc>
      <image:title>Recombinant Macaca mulatta Interleukin 17A (IL17A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interleukin-11-il11-bhp10515790</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011583MO-SDS.jpg?v=1772280334</image:loc>
      <image:title>Recombinant Mouse Interleukin-11 (Il11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-2-il2-bhp10515794</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011629HUd7-SDS.jpg?v=1772280339</image:loc>
      <image:title>Recombinant Human Interleukin-2 (IL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-integrin-alpha-m-itgam-partial-bhp10515807</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011876HUc7-SDS.jpg?v=1772280336</image:loc>
      <image:title>Recombinant Human Integrin alpha-M (ITGAM), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-insulin-receptor-substrate-1-irs1-partial-bhp10515803</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011829RA-SDS.jpg?v=1772280335</image:loc>
      <image:title>Recombinant Rat Insulin receptor substrate 1 (Irs1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ras-gtpase-activating-like-protein-iqgap1-iqgap1-partial-bhp10515802</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011800HU-SDS.jpg?v=1772280335</image:loc>
      <image:title>Recombinant Human Ras GTPase-activating-like protein IQGAP1 (IQGAP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-33-il33-bhp10515797</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011656HU-SDS.jpg?v=1772280335</image:loc>
      <image:title>Recombinant Human Interleukin-33 (IL33)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-islet-amyloid-polypeptide-iapp-bhp10515780</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010931HU_A4_-SDS.jpg?v=1772280334</image:loc>
      <image:title>Recombinant Human Islet amyloid polypeptide (IAPP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hephaestin-heph-partial-bhp10515765</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-interleukin-2-il2-bhp10515795</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011629MOWc7-SDS.jpg?v=1772280336</image:loc>
      <image:title>Recombinant Macaca mulatta Interleukin-2 (IL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hepatocyte-nuclear-factor-4-alpha-hnf4a-partial-bhp10515771</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP010594HU1-SDS.jpg?v=1772280331</image:loc>
      <image:title>Recombinant Human Hepatocyte nuclear factor 4-alpha (HNF4A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-inhibin-beta-e-chain-inhbe-bhp10515800</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011722HUh2-SDS.jpg?v=1772280336</image:loc>
      <image:title>Recombinant Human Inhibin beta E chain (INHBE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-interleukin-2-il2-bhp10515796</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011629RA-SDS.jpg?v=1772280337</image:loc>
      <image:title>Recombinant Rat Interleukin-2 (Il2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-integrin-alpha-iib-itga2b-partial-bhp10515805</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011865HUa0-SDS.jpg?v=1772280336</image:loc>
      <image:title>Recombinant Human Integrin alpha-IIb (ITGA2B), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcription-factor-jun-jun-bhp10515809</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-tonin-klk2-bhp10515810</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012453RA-SDS.jpg?v=1772280338</image:loc>
      <image:title>Recombinant Rat Tonin (Klk2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gtpase-kras-kras-g12d-partial-bhp10515816</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-keratin-type-i-cytoskeletal-17-krt17-bhp10515818</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012516HU-SDS.jpg?v=1772280338</image:loc>
      <image:title>Recombinant Human Keratin, type I cytoskeletal 17 (KRT17)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-integrin-alpha-l-itgal-partial-bhp10515806</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011875HUa0-SDS.jpg?v=1772280352</image:loc>
      <image:title>Recombinant Human Integrin alpha-L (ITGAL), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunoglobulin-superfamily-containing-leucine-rich-repeat-protein-islr-bhp10515804</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011848HU-SDS.jpg?v=1772280336</image:loc>
      <image:title>Recombinant Human Immunoglobulin superfamily containing leucine-rich repeat protein (ISLR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-alpha-lactalbumin-lalba-bhp10515819</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-isovaleryl-coa-dehydrogenase-mitochondrial-ivd-bhp10515808</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011921HU-SDS.jpg?v=1772280335</image:loc>
      <image:title>Recombinant Human Isovaleryl-CoA dehydrogenase, mitochondrial (IVD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gtpase-kras-kras-bhp10515811</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012493HU-SDS.jpg?v=1772280335</image:loc>
      <image:title>Recombinant Human GTPase KRas (KRAS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-insulin-ins-bhp10515801</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP011742HU-SDS.jpg?v=1772280339</image:loc>
      <image:title>Recombinant Human Insulin (INS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-low-density-lipoprotein-receptor-ldlr-partial-bhp10515821</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012846HU-SDS.jpg?v=1772280337</image:loc>
      <image:title>Recombinant Human Low-density lipoprotein receptor (LDLR), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gtpase-kras-g12v-partial-bhp10515817</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gtpase-kras-kras-g12c-partial-bhp10515815</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012493HU_F2_M1_b0-SDS.jpg?v=1772280341</image:loc>
      <image:title>Recombinant Human GTPase KRas (KRAS) (G12C), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gtpase-kras-kras-g12c-partial-bhp10515812</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012493HU_F2_M1_-SDS.jpg?v=1772280339</image:loc>
      <image:title>Recombinant Human GTPase KRas (KRAS) (G12C), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-lutropin-subunit-beta-lhb-bhp10515830</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012910MO-SDS.jpg?v=1772280342</image:loc>
      <image:title>Recombinant Mouse Lutropin subunit beta (Lhb)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-leptin-lep-bhp10515822</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012870MO-SDS.jpg?v=1772280339</image:loc>
      <image:title>Recombinant Mouse Leptin (Lep)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gtpase-kras-kras-g12c-partial-biotinylated-bhp10515814</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012493HU_F2_M1_-B-SDS.jpg?v=1772280341</image:loc>
      <image:title>Recombinant Human GTPase KRas (KRAS) (G12C), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lactase-phlorizin-hydrolase-lct-partial-bhp10515820</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-leptin-lep-bhp10515824</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012870RA-SDS.jpg?v=1772280341</image:loc>
      <image:title>Recombinant Rat Leptin (Lep)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-horse-lutropin-choriogonadotropin-subunit-beta-lhb-bhp10515829</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012910HO-SDS.jpg?v=1772280338</image:loc>
      <image:title>Recombinant Horse Lutropin/choriogonadotropin subunit beta (LHB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gtpase-kras-kras-g12c-partial-bhp10515813</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012493HU_F2_M1_a0-SDS.jpg?v=1772280337</image:loc>
      <image:title>Recombinant Human GTPase KRas (KRAS) (G12C), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-ligase-1-lig1-bhp10515832</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012930HUf0-SDS.jpg?v=1772280339</image:loc>
      <image:title>Recombinant Human DNA ligase 1 (LIG1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-galectin-9-lgals9-bhp10515826</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012895MO-SDS.jpg?v=1772280338</image:loc>
      <image:title>Recombinant Mouse Galectin-9 (Lgals9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-galectin-9-lgals9-bhp10515825</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012895HUc7-SDS.jpg?v=1772280340</image:loc>
      <image:title>Recombinant Human Galectin-9 (LGALS9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mitogen-activated-protein-kinase-8-mapk8-bhp10515840</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013466HU_A4_-SDS.jpg?v=1772280342</image:loc>
      <image:title>Recombinant Human Mitogen-activated protein kinase 8 (MAPK8)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-lutropin-subunit-beta-lhb-bhp10515831</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012910RA-SDS.jpg?v=1772280339</image:loc>
      <image:title>Recombinant Rat Lutropin subunit beta (Lhb)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-acyl-protein-thioesterase-1-lypla1-bhp10515836</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-leucine-zipper-putative-tumor-suppressor-1-lzts1-bhp10515837</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013291MO-SDS.jpg?v=1772280339</image:loc>
      <image:title>Recombinant Mouse Leucine zipper putative tumor suppressor 1 (Lzts1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-lutropin-subunit-beta-lhb-bhp10515828</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012910CA-SDS.jpg?v=1772280341</image:loc>
      <image:title>Recombinant Cat Lutropin subunit beta (LHB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-rhombotin-1-lmo1-bhp10515833</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013008HU-SDS.jpg?v=1772280341</image:loc>
      <image:title>Recombinant Human Rhombotin-1 (LMO1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lymphocyte-antigen-6-complex-locus-protein-g6c-ly6g6c-bhp10515835</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013245HU-SDS.jpg?v=1772280341</image:loc>
      <image:title>Recombinant Human Lymphocyte antigen 6 complex locus protein G6c (LY6G6C)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myristoylated-alanine-rich-c-kinase-substrate-marcks-partial-bhp10515842</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013493HU1-SDS.jpg?v=1772280342</image:loc>
      <image:title>Recombinant Human Myristoylated alanine-rich C-kinase substrate (MARCKS), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-o-glcnacase-oga-bhp10515844</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013786HU_A4_-SDS.jpg?v=1772280344</image:loc>
      <image:title>Recombinant Human Protein O-GlcNAcase (OGA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-galectin-9-lgals9-partial-bhp10515827</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012895MO1_F_-SDS.jpg?v=1772280340</image:loc>
      <image:title>Recombinant Mouse Galectin-9 (Lgals9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-polypeptide-related-sequence-a-mica-partial-bhp10515846</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ragulator-complex-protein-lamtor3-lamtor3-bhp10515841</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-polypeptide-related-sequence-b-micb-partial-bhp10515847</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-collagenase-3-mmp13-bhp10515850</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP014660RA-SDS.jpg?v=1772280347</image:loc>
      <image:title>Recombinant Rat Collagenase 3 (Mmp13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-nicotinamide-phosphoribosyltransferase-nampt-bhp10515861</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015422MOa0-SDS.jpg?v=1772280345</image:loc>
      <image:title>Recombinant Mouse Nicotinamide phosphoribosyltransferase (Nampt)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-microtubule-associated-protein-1s-map1s-partial-bhp10515838</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP135494h-SDS.jpg?v=1772280339</image:loc>
      <image:title>Recombinant Human Microtubule-associated protein 1S (MAP1S), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dual-specificity-mitogen-activated-protein-kinase-kinase-1-map2k1-bhp10515839</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013409HU-SDS.jpg?v=1772280340</image:loc>
      <image:title>Recombinant Human Dual specificity mitogen-activated protein kinase kinase 1 (MAP2K1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mevalonate-kinase-mvk-bhp10515856</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015247HU-SDS.jpg?v=1772280341</image:loc>
      <image:title>Recombinant Human Mevalonate kinase (MVK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-leptin-lep-bhp10515823</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP012870PI-SDS.jpg?v=1772280340</image:loc>
      <image:title>Recombinant Pig Leptin (LEP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-mismatch-repair-protein-msh3-msh3-partial-bhp10515853</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015029HU-SDS.jpg?v=1772280341</image:loc>
      <image:title>Recombinant Human DNA mismatch repair protein Msh3 (MSH3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-rhombotin-2-lmo2-bhp10515834</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013009HU-SDS.jpg?v=1772280340</image:loc>
      <image:title>Recombinant Human Rhombotin-2 (LMO2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nadh-dehydrogenase-ubiquinone-iron-sulfur-protein-6-mitochondrial-ndufs6-bhp10515862</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015665HU-SDS.jpg?v=1772280345</image:loc>
      <image:title>Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial (NDUFS6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myc-proto-oncogene-protein-myc-bhp10515859</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015270HUe1-SDS.jpg?v=1772280345</image:loc>
      <image:title>Recombinant Human Myc proto-oncogene protein (MYC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-homeobox-protein-nkx-2-1-nkx2-1-bhp10515864</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-major-vault-protein-mvp-partial-bhp10515857</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015248MO-SDS.jpg?v=1772280342</image:loc>
      <image:title>Recombinant Mouse Major vault protein (Mvp), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-matrix-metalloproteinase-14-mmp14-partial-bhp10515851</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP014661HU1-SDS.jpg?v=1772280343</image:loc>
      <image:title>Recombinant Human Matrix metalloproteinase-14 (MMP14), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-midkine-mdk-bhp10515843</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013624MOc7-SDS.jpg?v=1772280339</image:loc>
      <image:title>Recombinant Mouse Midkine (Mdk)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-major-vault-protein-mvp-partial-bhp10515858</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015248MO1-SDS.jpg?v=1772280344</image:loc>
      <image:title>Recombinant Mouse Major vault protein (Mvp), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-dna-mismatch-repair-protein-msh3-msh3-partial-bhp10515854</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015029MO-SDS.jpg?v=1772280345</image:loc>
      <image:title>Recombinant Mouse DNA mismatch repair protein Msh3 (Msh3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myosin-regulatory-light-chain-2-ventricular-cardiac-muscle-isoform-myl2-partial-bhp10515860</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP100574h-SDS.jpg?v=1772280342</image:loc>
      <image:title>Recombinant Human Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-collagenase-3-mmp13-partial-bhp10515849</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP014660HU3-SDS.jpg?v=1772280343</image:loc>
      <image:title>Recombinant Human Collagenase 3 (MMP13), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-matrix-gla-protein-mgp-bhp10515845</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP013789HUe1-SDS.jpg?v=1772280345</image:loc>
      <image:title>Recombinant Human Matrix Gla protein (MGP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-stromelysin-3-mmp11-bhp10515848</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP014658HU-SDS.jpg?v=1772280340</image:loc>
      <image:title>Recombinant Human Stromelysin-3 (MMP11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-matrix-metalloproteinase-14-mmp14-partial-bhp10515852</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP014661MO1-SDS.jpg?v=1772280344</image:loc>
      <image:title>Recombinant Mouse Matrix metalloproteinase-14 (Mmp14), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-homeobox-protein-nkx-3-2-nkx3-2-partial-bhp10515865</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-nitric-oxide-synthase-endothelial-nos3-partial-bhp10515869</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015946MO-SDS.jpg?v=1772280343</image:loc>
      <image:title>Recombinant Mouse Nitric oxide synthase, endothelial (Nos3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-nitric-oxide-synthase-inducible-nos2-partial-bhp10515868</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015943MO-SDS.jpg?v=1772280345</image:loc>
      <image:title>Recombinant Mouse Nitric oxide synthase, inducible (Nos2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-muscle-skeletal-receptor-tyrosine-protein-kinase-musk-partial-biotinylated-bhp10515855</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015241HU-B-SDS.jpg?v=1772280343</image:loc>
      <image:title>Recombinant Human Muscle, skeletal receptor tyrosine-protein kinase (MUSK), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-nuclear-factor-nf-kappa-b-p105-subunit-nfkb1-partial-bhp10515863</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015759MO-SDS.jpg?v=1772280343</image:loc>
      <image:title>Recombinant Mouse Nuclear factor NF-kappa-B p105 subunit (Nfkb1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nephrin-nphs1-partial-bhp10515871</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015988HUc7-SDS.jpg?v=1772280342</image:loc>
      <image:title>Recombinant Human Nephrin (NPHS1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glycylpeptide-n-tetradecanoyltransferase-2-nmt2-bhp10515866</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015901HU-SDS.jpg?v=1772280344</image:loc>
      <image:title>Recombinant Human Glycylpeptide N-tetradecanoyltransferase 2 (NMT2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-natriuretic-peptides-a-nppa-partial-biotinylated-bhp10515872</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP016020PI-B-SDS.jpg?v=1772280345</image:loc>
      <image:title>Recombinant Pig Natriuretic peptides A (NPPA), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-otoancorin-otoa-partial-bhp10515883</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017271HU-SDS.jpg?v=1772280346</image:loc>
      <image:title>Recombinant Human Otoancorin (OTOA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-paired-box-protein-pax-8-pax8-partial-bhp10515885</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-paired-box-protein-pax-8-pax8-bhp10515886</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017494HUc7-SDS.jpg?v=1772280348</image:loc>
      <image:title>Recombinant Human Paired box protein Pax-8 (PAX8)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-rna-binding-protein-nova-1-nova1-bhp10515870</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015957HUb1-SDS.jpg?v=1772280350</image:loc>
      <image:title>Recombinant Human RNA-binding protein Nova-1 (NOVA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gtpase-nras-nras-q61r-partial-biotinylated-bhp10515875</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP016070HU1_M_-B-SDS.jpg?v=1772280343</image:loc>
      <image:title>Recombinant Human GTPase NRas (NRAS) (Q61R), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ornithine-transcarbamylase-mitochondrial-otc-bhp10515880</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017270MOc7-SDS.jpg?v=1772280343</image:loc>
      <image:title>Recombinant Mouse Ornithine transcarbamylase, mitochondrial (Otc)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-udp-n-acetylglucosamine-peptide-n-acetylglucosaminyltransferase-110-kda-subunit-ogt-bhp10515878</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP016315HU_A4_-SDS.jpg?v=1772280346</image:loc>
      <image:title>Recombinant Human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (OGT)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-28s-rrna-cytosine-4447-c-5-methyltransferase-nop2-partial-bhp10515867</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP015938HU1-SDS.jpg?v=1772280345</image:loc>
      <image:title>Recombinant Human 28S rRNA (cytosine(4447)-C(5))-methyltransferase (NOP2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-ulcerans-ornithine-carbamoyltransferase-argf-biotinylated-bhp10515881</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017270MOP-B-SDS.jpg?v=1772280347</image:loc>
      <image:title>Recombinant Mycobacterium ulcerans Ornithine carbamoyltransferase (argF), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glucocorticoid-receptor-nr3c1-partial-bhp10515874</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP016059HU1c7-SDS.jpg?v=1772280345</image:loc>
      <image:title>Recombinant Human Glucocorticoid receptor (NR3C1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bifunctional-phosphoribosylaminoimidazole-carboxylase-phosphoribosylaminoimidazole-succinocarboxamide-synthetase-paics-bhp10515884</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017397HU1-SDS.jpg?v=1772280348</image:loc>
      <image:title>Recombinant Human Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-phosducin-pdc-bhp10515889</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017663RA-SDS.jpg?v=1772280347</image:loc>
      <image:title>Recombinant Rat Phosducin (Pdc)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-oncostatin-m-osm-bhp10515879</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017260MO-SDS.jpg?v=1772280345</image:loc>
      <image:title>Recombinant Mouse Oncostatin-M (Osm)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ornithine-aminotransferase-mitochondrial-oat-bhp10515877</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP016242HU-SDS.jpg?v=1772280346</image:loc>
      <image:title>Recombinant Human Ornithine aminotransferase, mitochondrial (OAT)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nad-p-h-dehydrogenase-quinone-1-nqo1-bhp10515873</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP016039HU-SDS.jpg?v=1772280342</image:loc>
      <image:title>Recombinant Human NAD (P)H dehydrogenase [quinone] 1 (NQO1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-choline-phosphate-cytidylyltransferase-a-pcyt1a-bhp10515888</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017654HU-SDS.jpg?v=1772280345</image:loc>
      <image:title>Recombinant Human Choline-phosphate cytidylyltransferase A (PCYT1A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-neurotrophin-3-ntf3-bhp10515876</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-dna-polymerase-beta-polb-bhp10515899</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018302RA-SDS.jpg?v=1772280353</image:loc>
      <image:title>Recombinant Rat DNA polymerase beta (Polb)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pyruvate-dehydrogenase-e1-component-subunit-alpha-somatic-form-mitochondrial-pdha1-partial-bhp10515893</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017715HUc7-SDS.jpg?v=1772280349</image:loc>
      <image:title>Recombinant Human Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (PDHA1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-notechis-scutatus-scutatus-basic-phospholipase-a2-notechis-ii-5-bhp10515897</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018091NHT-SDS.jpg?v=1772280348</image:loc>
      <image:title>Recombinant Notechis scutatus scutatus Basic phospholipase A2 notechis II-5</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-epidermidis-ornithine-carbamoyltransferase-argf-bhp10515882</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017270SLD-SDS.jpg?v=1772280346</image:loc>
      <image:title>Recombinant Staphylococcus epidermidis Ornithine carbamoyltransferase (argF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serum-paraoxonase-arylesterase-1-pon1-bhp10515900</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018369HUf0-SDS.jpg?v=1772280349</image:loc>
      <image:title>Recombinant Human Serum paraoxonase/arylesterase 1 (PON1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-camp-dependent-protein-kinase-type-i-alpha-regulatory-subunit-prkar1a-bhp10515905</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018694HU-SDS.jpg?v=1772280348</image:loc>
      <image:title>Recombinant Human cAMP-dependent protein kinase type I-alpha regulatory subunit (PRKAR1A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ras-related-c3-botulinum-toxin-substrate-1-rac1-bhp10515912</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP019242HU1-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Human Ras-related C3 botulinum toxin substrate 1 (RAC1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-enteropeptidase-tmprss15-partial-bhp10515908</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018824BO-SDS.jpg?v=1772280346</image:loc>
      <image:title>Recombinant Bovine Enteropeptidase (TMPRSS15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-threonine-protein-phosphatase-6-catalytic-subunit-ppp6c-bhp10515903</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018583HU-SDS.jpg?v=1772280346</image:loc>
      <image:title>Recombinant Human Serine/threonine-protein phosphatase 6 catalytic subunit (PPP6C)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-peroxiredoxin-6-prdx6-bhp10515904</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018659HU-SDS.jpg?v=1772280347</image:loc>
      <image:title>Recombinant Human Peroxiredoxin-6 (PRDX6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-platelet-derived-growth-factor-subunit-b-pdgfb-bhp10515891</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017709HUg5-SDS.jpg?v=1772280347</image:loc>
      <image:title>Recombinant Human Platelet-derived growth factor subunit B (PDGFB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-phosphatidylinositol-3-4-5-trisphosphate-3-phosphatase-and-dual-specificity-protein-phosphatase-pten-pten-bhp10515910</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018964MO-SDS.jpg?v=1772280347</image:loc>
      <image:title>Recombinant Mouse Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (Pten)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ras-related-c3-botulinum-toxin-substrate-2-rac2-bhp10515913</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP019248MO-SDS.jpg?v=1772280351</image:loc>
      <image:title>Recombinant Mouse Ras-related C3 botulinum toxin substrate 2 (Rac2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-platelet-factor-4-pf4-bhp10515894</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017809HU-SDS.jpg?v=1772280345</image:loc>
      <image:title>Recombinant Human Platelet factor 4 (PF4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-peptidoglycan-recognition-protein-3-pglyrp3-partial-bhp10515895</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-serine-threonine-protein-phosphatase-2b-catalytic-subunit-beta-isoform-ppp3cb-bhp10515902</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018573MO-SDS.jpg?v=1772280350</image:loc>
      <image:title>Recombinant Mouse Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform(Ppp3cb)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-platelet-derived-growth-factor-subunit-b-pdgfb-bhp10515890</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017709HUa0-SDS.jpg?v=1772280350</image:loc>
      <image:title>Recombinant Human Platelet-derived growth factor subunit B (PDGFB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-prolactin-prl-bhp10515906</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-n-acylglucosamine-2-epimerase-renbp-bhp10515914</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP019562HU-SDS.jpg?v=1772280351</image:loc>
      <image:title>Recombinant Human N-acylglucosamine 2-epimerase (RENBP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sterol-carrier-protein-2-scp2-bhp10515925</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020856HU_F1_-SDS.jpg?v=1772280353</image:loc>
      <image:title>Recombinant Human Sterol carrier protein 2 (SCP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nuclear-receptor-ror-gamma-rorc-bhp10515916</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020071HUc7-SDS.jpg?v=1772280349</image:loc>
      <image:title>Recombinant Human Nuclear receptor ROR-gamma(RORC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-succinate-dehydrogenase-ubiquinone-flavoprotein-subunit-mitochondrial-sdha-partial-bhp10515926</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020903HUc7-SDS.jpg?v=1772280348</image:loc>
      <image:title>Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (SDHA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-proprotein-convertase-subtilisin-kexin-type-7-pcsk7-partial-bhp10515887</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-prolactin-prl-bhp10515907</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-large-ribosomal-subunit-protein-el31-rpl31-bhp10515917</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020227HU-SDS.jpg?v=1772280352</image:loc>
      <image:title>Recombinant Human Large ribosomal subunit protein eL31 (RPL31)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-threonine-protein-phosphatase-pp1-gamma-catalytic-subunit-ppp1cc-bhp10515901</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018505HU_A4_-SDS.jpg?v=1772280348</image:loc>
      <image:title>Recombinant Human Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-channel-protein-type-1-subunit-alpha-scn1a-partial-bhp10515923</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020834HU1-SDS.jpg?v=1772280349</image:loc>
      <image:title>Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pyruvate-dehydrogenase-e1-component-subunit-alpha-somatic-form-mitochondrial-pdha1-partial-bhp10515892</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP017715HUa2-SDS.jpg?v=1772280349</image:loc>
      <image:title>Recombinant Human Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (PDHA1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-small-ribosomal-subunit-protein-es27-rps27-bhp10515919</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020419HUa2-SDS.jpg?v=1772280351</image:loc>
      <image:title>Recombinant Human Small ribosomal subunit protein eS27 (RPS27)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-sheep-p-selectin-selp-bhp10515927</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020978SH-SDS.jpg?v=1772280358</image:loc>
      <image:title>Recombinant Sheep P-selectin (SELP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-remodeling-and-spacing-factor-1-rsf1-partial-bhp10515920</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020540HU-SDS.jpg?v=1772280353</image:loc>
      <image:title>Recombinant Human Remodeling and spacing factor 1 (RSF1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sigma-non-opioid-intracellular-receptor-1-sigmar1-partial-bhp10515932</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021320HUa0-SDS.jpg?v=1772280351</image:loc>
      <image:title>Recombinant Human Sigma non-opioid intracellular receptor 1 (SIGMAR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-polymerase-beta-polb-bhp10515898</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018302HU-SDS.jpg?v=1772280352</image:loc>
      <image:title>Recombinant Human DNA polymerase beta (POLB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-superoxide-dismutase-mn-mitochondrial-sod2-bhp10515937</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022398HU_A4_-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Human Superoxide dismutase [Mn], mitochondrial (SOD2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-proteasome-subunit-beta-type-10-psmb10-bhp10515909</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018877MO-SDS.jpg?v=1772280349</image:loc>
      <image:title>Recombinant Mouse Proteasome subunit beta type-10 (Psmb10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-pituitary-homeobox-1-pitx1-bhp10515896</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018042MO-SDS.jpg?v=1772280347</image:loc>
      <image:title>Recombinant Mouse Pituitary homeobox 1 (Pitx1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serum-amyloid-a-2-protein-saa2-bhp10515921</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020657HU-SDS.jpg?v=1772280352</image:loc>
      <image:title>Recombinant Human Serum amyloid A-2 protein (SAA2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-arginine-rich-splicing-factor-1-srsf1-s199a-s227a-s234a-s238a-bhp10515930</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021142HU_M_-SDS.jpg?v=1772280350</image:loc>
      <image:title>Recombinant Human Serine/arginine-rich splicing factor 1 (SRSF1) (S199A,S227A,S234A,S238A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sigma-non-opioid-intracellular-receptor-1-sigmar1-partial-bhp10515931</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021320HU-SDS.jpg?v=1772280350</image:loc>
      <image:title>Recombinant Human Sigma non-opioid intracellular receptor 1 (SIGMAR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-sodium-channel-protein-type-11-subunit-alpha-scn11a-partial-bhp10515922</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020833RA-SDS.jpg?v=1772280349</image:loc>
      <image:title>Recombinant Rat Sodium channel protein type 11 subunit alpha (Scn11a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prostaglandin-g-h-synthase-1-ptgs1-bhp10515911</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP018985HUa0-SDS.jpg?v=1772280351</image:loc>
      <image:title>Recombinant Human Prostaglandin G/H synthase 1 (PTGS1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-small-ribosomal-subunit-protein-us17-rps11-bhp10515918</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP018744h-SDS.jpg?v=1772280349</image:loc>
      <image:title>Recombinant Human Small ribosomal subunit protein uS17 (RPS11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ribonuclease-h1-rnaseh1-d210n-bhp10515915</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP019801HU_M_-SDS.jpg?v=1772280348</image:loc>
      <image:title>Recombinant Human Ribonuclease H1 (RNASEH1) (D210N)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-small-nuclear-ribonucleoprotein-sm-d2-snrpd2-bhp10515935</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP026354h-SDS.jpg?v=1772280352</image:loc>
      <image:title>Recombinant Human Small nuclear ribonucleoprotein Sm D2 (SNRPD2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-dependent-phosphate-transport-protein-3-slc17a2-partial-bhp10515933</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021418HU-SDS.jpg?v=1772280351</image:loc>
      <image:title>Recombinant Human Sodium-dependent phosphate transport protein 3 (SLC17A2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sam-pointed-domain-containing-ets-transcription-factor-spdef-bhp10515940</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022518HU-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Human SAM pointed domain-containing Ets transcription factor (SPDEF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hyaluronidase-ph-20-spam1-bhp10515938</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022471HUc7-SDS.jpg?v=1772280353</image:loc>
      <image:title>Recombinant Human Hyaluronidase PH-20 (SPAM1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-splicing-factor-proline-and-glutamine-rich-sfpq-partial-bhp10515929</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021136HU1-SDS.jpg?v=1772280351</image:loc>
      <image:title>Recombinant Human Splicing factor, proline- and glutamine-rich (SFPQ), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-osteopontin-spp1-partial-bhp10515942</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022603MOc7-SDS.jpg?v=1772280353</image:loc>
      <image:title>Recombinant Mouse Osteopontin (Spp1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transaldolase-taldo1-bhp10515951</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sorcin-sri-bhp10515944</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022665HUf0-SDS.jpg?v=1772280368</image:loc>
      <image:title>Recombinant Human Sorcin (SRI)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-rho-gtpase-activating-protein-33-arhgap33-partial-bhp10515936</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022371HU1b0-SDS.jpg?v=1772280356</image:loc>
      <image:title>Recombinant Human Rho GTPase-activating protein 33 (ARHGAP33), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transforming-growth-factor-beta-regulator-1-tbrg1-bhp10515953</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023243HU-SDS.jpg?v=1772280352</image:loc>
      <image:title>Recombinant Human Transforming growth factor beta regulator 1 (TBRG1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-sparc-sparc-bhp10515939</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serpin-b10-serpinb10-bhp10515928</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021066HU-SDS.jpg?v=1772280355</image:loc>
      <image:title>Recombinant Human Serpin B10 (SERPINB10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-signal-recognition-particle-receptor-subunit-alpha-srpra-bhp10515946</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022686HU-SDS.jpg?v=1772280352</image:loc>
      <image:title>Recombinant Human Signal recognition particle receptor subunit alpha (SRPRA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-synaptic-vesicle-glycoprotein-2c-sv2c-partial-bhp10515950</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022980HU-SDS.jpg?v=1772280353</image:loc>
      <image:title>Recombinant Human Synaptic vesicle glycoprotein 2C (SV2C), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mitochondrial-import-inner-membrane-translocase-subunit-tim10-timm10-bhp10515962</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023548HU-SDS.jpg?v=1772280356</image:loc>
      <image:title>Recombinant Human Mitochondrial import inner membrane translocase subunit Tim10 (TIMM10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-tumor-necrosis-factor-tnf-partial-bhp10515967</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023955MOW-SDS.jpg?v=1772280361</image:loc>
      <image:title>Recombinant Macaca mulatta Tumor necrosis factor (TNF) , partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-signal-transducer-and-activator-of-transcription-1-alpha-beta-stat1-bhp10515948</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-sodium-channel-protein-type-9-subunit-alpha-scn9a-partial-bhp10515924</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP020846RA-SDS.jpg?v=1772280349</image:loc>
      <image:title>Recombinant Rat Sodium channel protein type 9 subunit alpha (Scn9a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transforming-growth-factor-beta-1-proprotein-tgfb1-partial-bhp10515957</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023446MOc7-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-small-proline-rich-protein-2a-sprr2a-bhp10515943</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-solute-carrier-organic-anion-transporter-family-member-1a2-slco1a2-partial-bhp10515934</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP021741HU-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Human Solute carrier organic anion transporter family member 1A2 (SLCO1A2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-protein-106a-tmem106a-partial-bhp10515964</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytotoxic-granule-associated-rna-binding-protein-tia1-tia1-bhp10515961</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023527HU-SDS.jpg?v=1772280360</image:loc>
      <image:title>Recombinant Human Cytotoxic granule associated RNA binding protein TIA1 (TIA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-trefoil-factor-3-tff3-bhp10515955</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023433CA-SDS.jpg?v=1772280357</image:loc>
      <image:title>Recombinant Cat Trefoil factor 3 (TFF3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-titin-ttn-partial-bhp10515974</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025267MO-SDS.jpg?v=1772280354</image:loc>
      <image:title>Recombinant Mouse Titin (Ttn), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-toll-like-receptor-9-tlr9-partial-bhp10515963</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023608HU1-SDS.jpg?v=1772280362</image:loc>
      <image:title>Recombinant Human Toll-like receptor 9 (TLR9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tubulin-specific-chaperone-a-tbca-bhp10515952</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023225HU-SDS.jpg?v=1772280356</image:loc>
      <image:title>Recombinant Human Tubulin-specific chaperone A (TBCA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protransforming-growth-factor-alpha-tgfa-partial-bhp10515956</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023445MO-SDS.jpg?v=1772280368</image:loc>
      <image:title>Recombinant Mouse Protransforming growth factor alpha (Tgfa), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sorcin-sri-bhp10515945</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022665MO-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Mouse Sorcin (Sri)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tetraspanin-1-tspan1-partial-bhp10515972</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025146HU1-SDS.jpg?v=1772280356</image:loc>
      <image:title>Recombinant Human Tetraspanin-1 (TSPAN1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-ligand-superfamily-member-10-tnfsf10-partial-active-bhp10515969</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023985HU1a0-SDS.jpg?v=1772280356</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor ligand superfamily member 10 (TNFSF10), partial (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transforming-growth-factor-beta-3-proprotein-tgfb3-partial-bhp10515958</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023449MO-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Mouse Transforming growth factor beta-3 proprotein (Tgfb3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-somatostatin-sst-partial-bhp10515947</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022723HU-SDS.jpg?v=1772280354</image:loc>
      <image:title>Recombinant Human Somatostatin (SST), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-glutamine-gamma-glutamyltransferase-2-tgm2-y443g-bhp10515960</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023462HU_A4_M2_-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Human Protein-glutamine gamma-glutamyltransferase 2 (TGM2) (Y443G)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcription-factor-pu-1-spi1-biotinylated-bhp10515941</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vascular-endothelial-zinc-finger-1-vezf1-bhp10515984</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025845HU-SDS.jpg?v=1772280358</image:loc>
      <image:title>Recombinant Human Vascular endothelial zinc finger 1 (VEZF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-transthyretin-ttr-bhp10515975</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025270BO-SDS.jpg?v=1772280356</image:loc>
      <image:title>Recombinant Bovine Transthyretin (TTR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-thyrotropin-subunit-beta-tshb-bhp10515971</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025130HUc7-SDS.jpg?v=1772280357</image:loc>
      <image:title>Recombinant Human Thyrotropin subunit beta (TSHB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-synaptic-vesicle-glycoprotein-2a-sv2a-partial-bhp10515949</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP022978HU-SDS.jpg?v=1772280355</image:loc>
      <image:title>Recombinant Human Synaptic vesicle glycoprotein 2A (SV2A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-netrin-receptor-unc5c-a150v-partial-bhp10515981</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025630HU_F_M_-SDS.jpg?v=1772280364</image:loc>
      <image:title>Recombinant Human Netrin receptor UNC5C (A150V), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tenascin-tnc-partial-bhp10515966</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP115094h_C_-SDS.jpg?v=1772280355</image:loc>
      <image:title>Recombinant Human Tenascin (TNC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-tyrosine-protein-kinase-receptor-tyro3-tyro3-partial-bhp10515978</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025396RA-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Rat Tyrosine-protein kinase receptor TYRO3 (Tyro3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-uricase-uox-bhp10515983</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025648PIc7-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Pig Uricase (UOX)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neurosecretory-protein-vgf-vgf-bhp10515986</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025847HUc7-SDS.jpg?v=1772280357</image:loc>
      <image:title>Recombinant Human Neurosecretory protein VGF (VGF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-glutamine-gamma-glutamyltransferase-k-tgm1-partial-bhp10515959</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023461HU1-SDS.jpg?v=1772280352</image:loc>
      <image:title>Recombinant Human Protein-glutamine gamma-glutamyltransferase K (TGM1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cyberlindnera-jadinii-uricase-bhp10515982</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025648EPX-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Cyberlindnera jadinii Uricase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-thymidylate-synthase-tyms-bhp10515977</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025393MO-SDS.jpg?v=1772280361</image:loc>
      <image:title>Recombinant Mouse Thymidylate synthase (Tyms)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-14-3-3-protein-zeta-delta-ywhaz-bhp10515996</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026293HU-SDS.jpg?v=1772280357</image:loc>
      <image:title>Recombinant Human 14-3-3 protein zeta/delta (YWHAZ)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-wnt-7b-wnt7b-bhp10515993</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026142MOc7-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Mouse Protein Wnt-7b (WNT7B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcription-factor-eb-tfeb-bhp10515954</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tryptophan-trna-ligase-cytoplasmic-wars1-bhp10515988</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025965MO-SDS.jpg?v=1772280360</image:loc>
      <image:title>Recombinant Mouse Tryptophan--tRNA ligase, cytoplasmic (Wars1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-non-receptor-tyrosine-protein-kinase-tyk2-tyk2-partial-bhp10515976</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025391HU6-SDS.jpg?v=1772280357</image:loc>
      <image:title>Recombinant Human Non-receptor tyrosine-protein kinase TYK2 (TYK2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-vip-peptides-vip-bhp10515987</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025858MO-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Mouse VIP peptides (Vip)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-ligand-superfamily-member-12-tnfsf12-partial-bhp10515970</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023987MO1-SDS.jpg?v=1772280364</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor ligand superfamily member 12 (Tnfsf12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-wnt-3a-wnt3a-partial-bhp10515991</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026136HU1d7-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Human Protein Wnt-3a (WNT3A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tumor-necrosis-factor-ligand-superfamily-member-10-tnfsf10-partial-bhp10515968</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023985HU1-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Human Tumor necrosis factor ligand superfamily member 10 (TNFSF10), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neurosecretory-protein-vgf-vgf-bhp10515985</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025847HU-SDS.jpg?v=1772280359</image:loc>
      <image:title>Recombinant Human Neurosecretory protein VGF (VGF)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-wnt-5b-wnt5b-bhp10515992</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026139MOa0-SDS.jpg?v=1772280357</image:loc>
      <image:title>Recombinant Mouse Protein Wnt-5b (Wnt5b)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-zinc-finger-protein-395-znf395-bhp10515997</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026718HU-SDS.jpg?v=1772280358</image:loc>
      <image:title>Recombinant Human Zinc finger protein 395 (ZNF395)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-synaptobrevin-homolog-ykt6-ykt6-bhp10515995</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026265HU-SDS.jpg?v=1772280360</image:loc>
      <image:title>Recombinant Human Synaptobrevin homolog YKT6 (YKT6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-titin-ttn-partial-bhp10515973</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025267HUc7-SDS.jpg?v=1772280370</image:loc>
      <image:title>Recombinant Human Titin (TTN), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-trna-guanine-n-7-methyltransferase-non-catalytic-subunit-wdr4-wdr4-bhp10515989</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026021HU-SDS.jpg?v=1772280356</image:loc>
      <image:title>Recombinant Human tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4 (WDR4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arachis-hypogaea-ara-h-8-allergen-bhp10516001</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP2005ANE-SDS.jpg?v=1772280360</image:loc>
      <image:title>Recombinant Arachis hypogaea Ara h 8 allergen</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-zinc-finger-protein-746-znf746-bhp10515998</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP027008HU-SDS.jpg?v=1772280364</image:loc>
      <image:title>Recombinant Human Zinc finger protein 746 (ZNF746)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcription-factor-p65-rela-partial-bhp10516000</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP0398HUc7-SDS.jpg?v=1772280361</image:loc>
      <image:title>Recombinant Human Transcription factor p65 (RELA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-netrin-receptor-unc5c-unc5c-partial-bhp10515980</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025630HU_F_-SDS.jpg?v=1772280356</image:loc>
      <image:title>Recombinant Human Netrin receptor UNC5C (UNC5C), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-udp-glucuronosyltransferase-1a5-ugt1a5-partial-bhp10515979</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP025578HU1-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Human UDP-glucuronosyltransferase 1A5 (UGT1A5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-flock-house-virus-protein-b2-b2-biotinylated-bhp10516013</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP304757FCA-B-SDS.jpg?v=1772280362</image:loc>
      <image:title>Recombinant Flock house virus Protein B2 (B2), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chicken-protein-wnt-11-wnt11-bhp10515990</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026131CH-SDS.jpg?v=1772280364</image:loc>
      <image:title>Recombinant Chicken Protein Wnt-11 (WNT11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-autoinducer-2-kinase-lsrk-bhp10516010</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP303534ENVb0-SDS.jpg?v=1772280360</image:loc>
      <image:title>Recombinant Escherichia coli Autoinducer-2 kinase (lsrK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chicken-ovalbumin-serpinb14-bhp10516003</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP2532CH-SDS.jpg?v=1772280358</image:loc>
      <image:title>Recombinant Chicken Ovalbumin (SERPINB14)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-heterogeneous-nuclear-ribonucleoproteins-a2-b1-hnrnpa2b1-partial-bhp10516004</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP2576HU1-SDS.jpg?v=1772280361</image:loc>
      <image:title>Recombinant Human Heterogeneous nuclear ribonucleoproteins A2/B1 (HNRNPA2B1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-protein-44-tmem44-partial-bhp10515965</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP023841HU-SDS.jpg?v=1772280353</image:loc>
      <image:title>Recombinant Human Transmembrane protein 44 (TMEM44), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-sortase-a-srta-p94r-d160n-d165a-k190e-k196t-partial-bhp10516016</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP3093FLF1_M_-SDS.jpg?v=1772280358</image:loc>
      <image:title>Recombinant Staphylococcus aureus Sortase A (srtA) (P94R,D160N,D165A,K190E,K196T), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-aeruginosa-b-type-flagellin-flic-bhp10516006</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP300968EZX-SDS.jpg?v=1772280360</image:loc>
      <image:title>Recombinant Pseudomonas aeruginosa B-type flagellin (fliC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-thermoplasma-acidophilum-tricorn-protease-tri-partial-bhp10516017</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP309466TND-SDS.jpg?v=1772280360</image:loc>
      <image:title>Recombinant Thermoplasma acidophilum Tricorn protease (tri), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-kallikrein-related-peptidase-2-klk2-bhp10516002</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP2117MOV-SDS.jpg?v=1772280377</image:loc>
      <image:title>Recombinant Macaca fascicularis Kallikrein-related peptidase 2 (KLK2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-nocardia-globerula-aryl-acylamidase-partial-bhp10516011</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP303600NDZ-SDS.jpg?v=1772280360</image:loc>
      <image:title>Recombinant Nocardia globerula Aryl acylamidase, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-epidermidis-glutamyl-endopeptidase-gsea-bhp10516019</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP314220SLD-SDS.jpg?v=1772280361</image:loc>
      <image:title>Recombinant Staphylococcus epidermidis Glutamyl endopeptidase (gseA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-xiap-xiap-bhp10515994</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP026193HUc7-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase XIAP (XIAP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chlamydia-trachomatis-serovar-d-histone-h1-like-protein-hc1-hcta-bhp10516020</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rhesus-cytomegalovirus-envelope-glycoprotein-b-gb-partial-bhp10516015</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP309330RKCc7-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Rhesus cytomegalovirus Envelope glycoprotein B (gB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-brassica-napus-defensin-like-protein-1-afp1-bhp10516008</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP303125BWD-SDS.jpg?v=1772280360</image:loc>
      <image:title>Recombinant Brassica napus Defensin-like protein 1(AFP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacillus-licheniformis-glutamyl-endopeptidase-blase-bhp10516007</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP302111BQU-SDS.jpg?v=1772280360</image:loc>
      <image:title>Recombinant Bacillus licheniformis Glutamyl endopeptidase (blaSE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunodeficiency-virus-type-1-group-m-subtype-b-protein-vpr-vpr-bhp10516026</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP318978HKY-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Vpr (vpr)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-bovis-cell-surface-glycolipoprotein-mpb83-mpb83-biotinylated-bhp10516023</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP316697MVH-B-SDS.jpg?v=1772280360</image:loc>
      <image:title>Recombinant Mycobacterium bovis Cell surface glycolipoprotein MPB83 (mpb83), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunodeficiency-virus-type-1-group-m-subtype-b-gag-polyprotein-gag-partial-bhp10516027</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP319413HKY1-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Human immunodeficiency virus type 1 group M subtype B Gag polyprotein (gag), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-f1-dna-binding-protein-g5p-v-bhp10516005</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP300218ECH-SDS.jpg?v=1772280357</image:loc>
      <image:title>Recombinant Enterobacteria phage f1 DNA-Binding protein G5P (V)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-zona-pellucida-sperm-binding-protein-3-zp3-bhp10515999</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP027121CA-SDS.jpg?v=1772280359</image:loc>
      <image:title>Recombinant Cat Zona pellucida sperm-binding protein 3 (ZP3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-bovis-cell-surface-glycolipoprotein-mpb83-mpb83-bhp10516022</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP316697MVH-SDS.jpg?v=1772280359</image:loc>
      <image:title>Recombinant Mycobacterium bovis Cell surface glycolipoprotein MPB83 (mpb83)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-polyubiquitin-b-ubb-partial-bhp10516021</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP316022HU-SDS.jpg?v=1772280360</image:loc>
      <image:title>Recombinant Human Polyubiquitin-B (UBB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-6-il6-active-bhp10516014</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP305249MOV-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin-6 (IL6) (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-pyogenes-serotype-m3-arginine-repressor-argr2-bhp10516024</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP316987SMV-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Streptococcus pyogenes serotype M3 Arginine repressor (argR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-autoinducer-2-kinase-lsrk-bhp10516009</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP303534ENV-SDS.jpg?v=1772280360</image:loc>
      <image:title>Recombinant Escherichia coli Autoinducer-2 kinase (lsrK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-vaccinia-virus-cell-surface-binding-protein-opg105-d8l-partial-bhp10516033</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP3211GKL1c7-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Vaccinia virus Cell surface-binding protein OPG105 (D8L), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-flock-house-virus-protein-b2-b2-bhp10516012</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP304757FCA-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Flock house virus Protein B2 (B2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-vibrio-cholerae-serotype-o1-sialidase-nanh-partial-bhp10516018</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP314042VEX-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Vibrio cholerae serotype O1 Sialidase (nanH), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rotavirus-a-outer-capsid-glycoprotein-vp7-bhp10516025</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP318897RGU-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Rotavirus A Outer capsid glycoprotein VP7</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-woodchuck-hepatitis-b-virus-protein-x-x-bhp10516042</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP323774WAWc7-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Woodchuck hepatitis B virus Protein X (X)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-t4-portal-protein-20-bhp10516028</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP320212EDZ_A4_-SDS.jpg?v=1772280362</image:loc>
      <image:title>Recombinant Enterobacteria phage T4 Portal protein (20)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-baboon-endogenous-virus-envelope-glycoprotein-env-partial-bhp10516030</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP320630BAB-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Baboon endogenous virus Envelope glycoprotein (env), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-31-protein-e7-e7-bhp10516046</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP324626HND-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Human papillomavirus 31 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-sp-group-g-immunoglobulin-g-binding-protein-g-spg-partial-bhp10516040</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP322577SNDa0_F19_-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-vivax-circumsporozoite-protein-csp-partial-bhp10516029</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rhizomucor-miehei-lipase-d250g-bhp10516036</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP321696RDA-SDS_c67aecb4-7c77-4c20-b0b0-a84174cd32d8.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Rhizomucor miehei Lipase (D250G)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tomato-bushy-stunt-virus-rna-silencing-suppressor-p19-orf4-bhp10516031</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP320894TGA-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Tomato bushy stunt virus RNA silencing suppressor p19 (ORF4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-woodchuck-hepatitis-b-virus-protein-x-x-partial-bhp10516041</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP323774WAW1-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Woodchuck hepatitis B virus Protein X (X), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-gibbon-ape-leukemia-virus-envelope-glycoprotein-env-partial-bhp10516037</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP321953GCA-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Gibbon ape leukemia virus Envelope glycoprotein (env), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-francisella-tularensis-subsp-holarctica-17-kda-major-membrane-protein-ftl-0421-bhp10516038</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP322417FCO-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Francisella tularensis subsp. holarctica 17 kDa major membrane protein (FTL_0421)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-emericella-nidulans-class-i-hydrophobin-roda-roda-bhp10516056</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP326791EKF-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Emericella nidulans Class I hydrophobin rodA (rodA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytomegalovirus-viral-transcription-factor-ie2-ul122-partial-bhp10516039</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP322574HWV-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Human cytomegalovirus Viral transcription factor IE2 (UL122), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chlamydia-trachomatis-major-outer-membrane-porin-serovar-h-ompa-bhp10516032</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP321117DSA-SDS.jpg?v=1772280362</image:loc>
      <image:title>Recombinant Chlamydia trachomatis Major outer membrane porin, serovar H (ompA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-proteus-mirabilis-hemolysin-hpma-partial-bhp10516053</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP325826EYYc7-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Proteus mirabilis Hemolysin (hpmA),partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-wolinella-succinogenes-fumarate-reductase-flavoprotein-subunit-frda-bhp10516035</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP321527WBQ_A4_-SDS.jpg?v=1772280368</image:loc>
      <image:title>Recombinant Wolinella succinogenes Fumarate reductase flavoprotein subunit (frdA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-t4-capsid-assembly-protein-gp31-31-bhp10516052</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP325493EDZ-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Enterobacteria phage T4 Capsid assembly protein Gp31 (31)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-autographa-californica-nuclear-polyhedrosis-virus-major-envelope-glycoprotein-gp64-partial-bhp10516048</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP324635ARA1c7-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Autographa californica nuclear polyhedrosis virus Major envelope glycoprotein (GP64), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-atp-dependent-dna-helicase-recq-recq-partial-bhp10516034</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP179794Ba-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Escherichia coli ATP-dependent DNA helicase recQ (recQ), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-chorismate-mutase-chloroplastic-cm1-partial-bhp10516069</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP134794Pl-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Chorismate mutase, chloroplastic (CM1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-type-53-protein-e7-e7-bhp10516060</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP327601HNZ-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Human papillomavirus type 53  Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hydra-vulgaris-annexin-b12-anxb12-bhp10516064</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP329623HXN-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Hydra vulgaris Annexin-B12 (ANXB12)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-t4-large-terminase-protein-17-bhp10516045</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP324619EDZ_A4_-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Enterobacteria phage T4 Large terminase protein (17)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-kinesin-heavy-chain-khc-partial-biotinylated-bhp10516044</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-51-protein-e7-e7-bhp10516055</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP326304HNX-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Human papillomavirus 51 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bothrops-jararaca-zinc-metalloproteinase-disintegrin-like-botrocetin-bhp10516049</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP325199BUWa2-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Bothrops jararaca Zinc metalloproteinase-disintegrin-like botrocetin</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-feline-calicivirus-capsid-protein-vp1-partial-bhp10516065</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP329722FAE-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Feline calicivirus Capsid protein VP1, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-crimean-congo-hemorrhagic-fever-virus-nucleoprotein-n-bhp10516062</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP328701CSBc7-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Crimean-Congo hemorrhagic fever virus Nucleoprotein (N)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-saccharomyces-cerevisiae-serine-threonine-protein-phosphatase-pp1-2-glc7-bhp10516079</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP335747SVG-SDS.jpg?v=1772280368</image:loc>
      <image:title>Recombinant Saccharomyces cerevisiae Serine/threonine-protein phosphatase PP1-2 (GLC7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-t4-highly-immunogenic-outer-capsid-protein-hoc-bhp10516043</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP323826EDZ-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Enterobacteria phage T4 Highly immunogenic outer capsid protein (hoc)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hantaan-virus-envelopment-polyprotein-gp-partial-bhp10516051</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP325461HCE1-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Hantaan virus Envelopment polyprotein (GP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacillus-sp-protein-rep-repa-bhp10516059</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP327509BRE-SDS.jpg?v=1772280364</image:loc>
      <image:title>Recombinant Bacillus sp Protein rep (repA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-s-adenosylmethionine-synthase-sams-bhp10516081</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP336704DLU-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Drosophila melanogaster S-adenosylmethionine synthase (Sams)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-cfa-i-fimbrial-subunit-e-cfae-bhp10516061</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP328563ENLa0-SDS.jpg?v=1772280364</image:loc>
      <image:title>Recombinant Escherichia coli CFA/I fimbrial subunit E(cfaE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-35-protein-e7-e7-bhp10516073</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP333231HNH-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Human papillomavirus 35 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-leukemia-virus-gag-polyprotein-gag-partial-bhp10516063</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP329519BKF1-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Bovine leukemia virus Gag polyprotein (gag), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-brassica-napus-cruciferin-cru1-cru1-partial-bhp10516075</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP333802BWD-SDS.jpg?v=1772280368</image:loc>
      <image:title>Recombinant Brassica napus Cruciferin CRU1 (CRU1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-candida-albicans-secreted-aspartic-protease-5-sap5-bhp10516082</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP337319CZD-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Candida albicans Secreted aspartic protease 5 (SAP5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacillus-methanolicus-nad-dependent-methanol-dehydrogenase-mdh-bhp10516066</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP330043BAUc7-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Bacillus methanolicus NAD-dependent methanol dehydrogenase (mdh)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-major-allergen-i-polypeptide-chain-2-ch2-bhp10516057</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudoalteromonas-carrageenovora-kappa-carrageenase-cgka-bhp10516071</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP331841AIA-SDS.jpg?v=1772280364</image:loc>
      <image:title>Recombinant Pseudoalteromonas carrageenovora Kappa-carrageenase (cgkA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-tumor-necrosis-factor-tnf-partial-bhp10516050</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP325438RA-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Rat Tumor necrosis factor (Tnf), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-listeria-monocytogenes-serovar-1-2a-internalin-b-inlb-partial-bhp10516054</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP326188LPY-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Listeria monocytogenes serovar 1/2a Internalin B (inlB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycoplasma-genitalium-uncharacterized-protein-mg281-mg281-partial-bhp10516088</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-autographa-californica-nuclear-polyhedrosis-virus-major-envelope-glycoprotein-gp64-partial-bhp10516047</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP324635ARA1b1-SDS.jpg?v=1772280363</image:loc>
      <image:title>Recombinant Autographa californica nuclear polyhedrosis virus Major envelope glycoprotein (GP64),partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neuronal-vesicle-trafficking-associated-protein-1-nsg1-partial-bhp10516070</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP331662HU-SDS.jpg?v=1772280364</image:loc>
      <image:title>Recombinant Human Neuronal vesicle trafficking-associated protein 1 (NSG1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-30-protein-e7-e7-bhp10516077</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP334189HNC-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Human papillomavirus 30 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-guanine-nucleotide-binding-protein-g-q-subunit-alpha-gnaq-bhp10516090</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP342271HUc7-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Human Guanine nucleotide-binding protein G (q) subunit alpha (GNAQ)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-malus-domestica-1-aminocyclopropane-1-carboxylate-synthase-acs-1-bhp10516087</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP339876MPS-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Malus domestica 1-aminocyclopropane-1-carboxylate synthase (ACS-1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-triticum-aestivum-imidazoleglycerol-phosphate-dehydratase-1-chloroplastic-bhp10516080</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP335890TQN-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Triticum aestivum Imidazoleglycerol-phosphate dehydratase 1, chloroplastic</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-brassica-napus-napin-1a-partial-bhp10516084</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP338607BWD-SDS.jpg?v=1772280375</image:loc>
      <image:title>Recombinant Brassica napus Napin-1A, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-newcastle-disease-virus-hemagglutinin-neuraminidase-hn-partial-bhp10516076</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP334020NCU1-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Newcastle disease virus Hemagglutinin-neuraminidase (HN), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-glycine-max-1-aminocyclopropane-1-carboxylate-synthase-acs1-bhp10516074</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP333613GGV-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Glycine max 1-aminocyclopropane-1-carboxylate synthase (ACS1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tachypleus-tridentatus-clotting-factor-c-partial-bhp10516078</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP335355TAHa0-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Tachypleus tridentatus clotting factor C, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-probable-autotransporter-ypja-ypja-partial-bhp10516100</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP345175ENV-SDS.jpg?v=1772280371</image:loc>
      <image:title>Recombinant Escherichia coli Probable autotransporter YpjA (ypjA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-perilipin-2-plin2-bhp10516083</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP337564MO-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Mouse Perilipin-2 (Plin2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-simian-retrovirus-srv-2-gag-polyprotein-gag-partial-bhp10516096</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP343942SHN-SDS.jpg?v=1772280371</image:loc>
      <image:title>Recombinant Simian retrovirus SRV-2 Gag polyprotein (gag), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bradyrhizobium-sp-chitooligosaccharide-deacetylase-nodb-bhp10516094</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP343474BLKe0-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Bradyrhizobium sp. Chitooligosaccharide deacetylase (nodB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-simian-retrovirus-srv-2-envelope-glycoprotein-env-partial-bhp10516092</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP343164SHO-SDS.jpg?v=1772280368</image:loc>
      <image:title>Recombinant Simian retrovirus SRV-2 Envelope glycoprotein (env), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-candida-albicans-hyphally-regulated-protein-hyr1-partial-bhp10516098</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP344392CZF-SDS.jpg?v=1772280371</image:loc>
      <image:title>Recombinant Candida albicans Hyphally-regulated protein (HYR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycoplasma-genitalium-uncharacterized-protein-mg281-mg281-partial-bhp10516089</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-68-protein-e7-e7-bhp10516103</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP346576HOK-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Human papillomavirus 68 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-glycine-max-stress-induced-protein-sam22-pr-10-bhp10516072</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP333215GGV-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Glycine max Stress-induced protein SAM22 (PR-10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-type-26-protein-e7-e7-bhp10516086</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP339739HMW-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Human papillomavirus type 26 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tomato-bushy-stunt-virus-rna-silencing-suppressor-p19-bhp10516099</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP344659TFX-SDS.jpg?v=1772280368</image:loc>
      <image:title>Recombinant Tomato bushy stunt virus RNA silencing suppressor p19</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-70-protein-e7-e7-bhp10516091</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP342705HOQ-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Human papillomavirus 70 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bartonella-henselae-probable-periplasmic-serine-endoprotease-degp-like-htra-bhp10516102</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP345817BSG-SDS.jpg?v=1772280370</image:loc>
      <image:title>Recombinant Bartonella henselae Probable periplasmic serine endoprotease DegP-like (htrA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-endogenous-retrovirus-group-k-member-113-pro-protein-hervk-113-bhp10516106</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP351212HU-SDS.jpg?v=1772280370</image:loc>
      <image:title>Recombinant Human Endogenous retrovirus group K member 113 Pro protein (HERVK_113)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-metallothionein-1-mt1-bhp10516112</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP355875MO-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Mouse Metallothionein-1 (Mt1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pentadiplandra-brazzeana-defensin-like-protein-bhp10516104</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP347673PFG-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Pentadiplandra brazzeana Defensin-like protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-putative-endogenous-retrovirus-group-k-member-11-1-env-polyprotein-ervk11-1-bhp10516105</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP350358HU-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Human Putative endogenous retrovirus group K member 11-1 Env polyprotein (ERVK11-1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-puumala-virus-nucleoprotein-n-bhp10516068</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP331277PXH-SDS.jpg?v=1772280365</image:loc>
      <image:title>Recombinant Puumala virus Nucleoprotein (N)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-type-34-protein-e7-e7-bhp10516067</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP330647HNG-SDS.jpg?v=1772280366</image:loc>
      <image:title>Recombinant Human papillomavirus type 34 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hla-class-i-histocompatibility-antigen-c-alpha-chain-hla-c-partial-bhp10516058</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP326978HU-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Human HLA class I histocompatibility antigen, C alpha chain (HLA-C), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-salmonella-typhimurium-phase-2-flagellin-fljb-partial-bhp10516101</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP345218SXB-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Salmonella typhimurium Phase 2 flagellin (fljB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bradyrhizobium-sp-chitooligosaccharide-deacetylase-nodb-bhp10516093</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP343474BLK-SDS.jpg?v=1772280368</image:loc>
      <image:title>Recombinant Bradyrhizobium sp. Chitooligosaccharide deacetylase (nodB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-atp-dependent-clp-protease-proteolytic-subunit-clpp-bhp10516107</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP351918SKX-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Staphylococcus aureus ATP-dependent Clp protease proteolytic subunit (clpP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-falciparum-merozoite-surface-protein-2-msp2-partial-bhp10516095</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP343481EWPf0-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Plasmodium falciparum Merozoite surface protein 2 (MSP2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-brassica-napus-napin-1a-partial-bhp10516085</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP338607BWDc7-SDS.jpg?v=1772280367</image:loc>
      <image:title>Recombinant Brassica napus Napin-1A, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-tryptophan-trna-ligase-trps-bhp10516109</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP355581ENV-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Escherichia coli Tryptophan--tRNA ligase (trpS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-latent-membrane-protein-1-lmp1-partial-bhp10516113</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP355987EFA1-SDS.jpg?v=1772280370</image:loc>
      <image:title>Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-endogenous-retrovirus-group-k-member-25-env-polyprotein-ervk-25-partial-bhp10516108</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP352224HU1c7-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Human Endogenous retrovirus group K member 25 Env polyprotein (ERVK-25), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-simian-retrovirus-srv-2-gag-pro-polyprotein-pro-partial-bhp10516097</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP344347SHN-SDS.jpg?v=1772280370</image:loc>
      <image:title>Recombinant Simian retrovirus SRV-2 Gag-Pro polyprotein (pro), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-atrax-robustus-delta-hexatoxin-ar1a-bhp10516110</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP355657AVG-SDS.jpg?v=1772280369</image:loc>
      <image:title>Recombinant Atrax robustus Delta-hexatoxin-Ar1a</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-insulin-like-growth-factor-i-igf1-bhp10516117</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356436HUc7-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Human Insulin-like growth factor I (IGF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-transcription-termination-factor-rho-rho-bhp10516131</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP166274Ba-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Escherichia coli Transcription termination factor Rho (rho)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-atrax-robustus-delta-hexatoxin-ar1a-bhp10516111</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP355657AVGe0-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Atrax robustus Delta-hexatoxin-Ar1a</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-meromycolate-extension-acyl-carrier-protein-acpm-bhp10516125</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP358590MVZa0-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis Meromycolate extension acyl carrier protein (acpM)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-neisseria-gonorrhoeae-probable-peptidoglycan-d-d-transpeptidase-pena-pena-partial-bhp10516120</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP357310NFZ-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Neisseria gonorrhoeae Probable peptidoglycan D,D-transpeptidase PenA (penA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-nad-kinase-nadk-bhp10516126</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP358949ENV-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Escherichia coli NAD kinase (nadK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-virus-qbeta-capsid-protein-bhp10516114</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356100FQZe0-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Escherichia virus Qbeta Capsid protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-aminoglycoside-3-9-adenylyltransferase-aada-bhp10516130</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360352ENLc7-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Escherichia coli Aminoglycoside (3&apos;&apos;) (9) adenylyltransferase (aadA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-aminoglycoside-3-9-adenylyltransferase-aada-bhp10516129</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360352ENL-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Escherichia coli Aminoglycoside (3&apos;&apos;) (9) adenylyltransferase (aadA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-salmonella-typhimurium-cdp-abequose-synthase-rfbj-bhp10516124</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP358099SXB-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Salmonella typhimurium CDP-abequose synthase (rfbJ)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-small-ribosomal-subunit-protein-us3-rpsc-bhp10516127</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP359038ENVc0-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Escherichia coli Small ribosomal subunit protein uS3 (rpsC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunodeficiency-virus-type-1-group-m-subtype-b-protein-rev-rev-bhp10516115</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356309HKP-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Rev (rev)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-dna-mismatch-repair-protein-muth-muth-bhp10516119</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356924ENV-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Escherichia coli DNA mismatch repair protein mutH (mutH)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-pepsin-a-pga-bhp10516134</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360581PI-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Pig Pepsin A (PGA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mumps-virus-fusion-glycoprotein-f0-f-partial-biotinylated-bhp10516122</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP357683MJK1-B-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Mumps virus Fusion glycoprotein F0 (F), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-simian-retrovirus-srv-1-gag-polyprotein-gag-partial-bhp10516141</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361194SHM-SDS.jpg?v=1772280375</image:loc>
      <image:title>Recombinant Simian retrovirus SRV-1 Gag polyprotein (gag), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hantaan-virus-nucleoprotein-n-bhp10516146</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361470HCB-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Hantaan virus Nucleoprotein (N)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-phospholipase-c-hlb-bhp10516123</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP357824FKZ-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Staphylococcus aureus Phospholipase C (hlb)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-dna-helicase-ii-uvrd-bhp10516137</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-renin-2-ren2-partial-bhp10516136</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP170594m-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Mouse Renin-2 (Ren2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-foot-and-mouth-disease-virus-serotype-o-genome-polyprotein-partial-bhp10516139</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361015FCJ-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Foot-and-mouth disease virus serotype O Genome polyprotein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-capsid-scaffolding-protein-partial-bhp10516138</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360995EFA-SDS.jpg?v=1772280377</image:loc>
      <image:title>Recombinant Epstein-Barr virus Capsid scaffolding protein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-rna-polymerase-sigma-factor-rpod-rpod-bhp10516132</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360419ENV-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Escherichia coli RNA polymerase sigma factor rpoD (rpoD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-low-molecular-weight-protein-tyrosine-phosphatase-wzb-wzb-biotinylated-bhp10516154</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP364465ENV-B-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Escherichia coli Low molecular weight protein-tyrosine-phosphatase Wzb (wzb), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-bovis-immunogenic-protein-mpb70-mpb70-bhp10516151</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP363818MVH-SDS.jpg?v=1772280375</image:loc>
      <image:title>Recombinant Mycobacterium bovis Immunogenic protein MPB70 (mpb70)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-co-chaperonin-groes-groes-bhp10516161</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP404273MON-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bordetella-pertussis-pertussis-toxin-subunit-1-ptxa-biotinylated-bhp10516116</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356423BUA-B-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-schistosoma-japonicum-glutathione-s-transferase-class-mu-26-kda-isozyme-bhp10516121</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP357414SXP-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-lysine-trna-ligase-lyss-bhp10516153</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP364194ENV-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Escherichia coli Lysine--tRNA ligase (lysS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-colicin-ia-cia-626-i-i-asvkvsckasgytftnygmnwvkqapgqglkwmgwqqhyitpltfgagtkveik-bhp10516149</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361926ENLe1_M3_-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Escherichia coli Colicin-Ia (cia) (626:I→I-ASVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGWQQHYITPLTFGAGTKVEIK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-bovis-immunogenic-protein-mpb70-mpb70-biotinylated-bhp10516152</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP363818MVH-B-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Mycobacterium bovis Immunogenic protein MPB70 (mpb70), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterobacteria-phage-t4-major-capsid-protein-gp23-bhp10516142</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361291EDZ_A4_-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Enterobacteria phage T4 Major capsid protein (gp23)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bunyavirus-snowshoe-hare-envelopment-polyprotein-gp-partial-bhp10516143</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361398BNQ-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Bunyavirus snowshoe hare Envelopment polyprotein (GP), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-iron-regulated-surface-determinant-protein-b-isdb-partial-bhp10516162</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP411540FLG-SDS.jpg?v=1772280392</image:loc>
      <image:title>Recombinant Staphylococcus aureus Iron-regulated surface determinant protein B (isdB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-bacterioferritin-bfr-bhp10516155</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP364636ENV-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Escherichia coli Bacterioferritin (bfr)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o17-k52-h18-chorismate-synthase-aroc-bhp10516165</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP486248EOG-SDS.jpg?v=1772280376</image:loc>
      <image:title>Recombinant Escherichia coli O17:K52:H18 Chorismate synthase (aroC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-moloney-murine-leukemia-virus-envelope-glycoprotein-env-partial-bhp10516140</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361038MHK-SDS.jpg?v=1772280379</image:loc>
      <image:title>Recombinant Moloney murine leukemia virus Envelope glycoprotein (env), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-angiopoietin-related-protein-4-angptl4-bhp10516163</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP4186MOa0-SDS.jpg?v=1772280379</image:loc>
      <image:title>Recombinant Mouse Angiopoietin-related protein 4 (Angptl4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-falciparum-merozoite-surface-protein-1-msp1-partial-bhp10516144</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361416EWT1-SDS.jpg?v=1772280374</image:loc>
      <image:title>Recombinant Plasmodium falciparum Merozoite surface protein 1 (MSP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-porcine-reproductive-and-respiratory-syndrome-virus-glycoprotein-4-gp4-partial-bhp10516160</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP368832PYZ1-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 4 (GP4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycolicibacterium-smegmatis-3-oxosteroid-1-dehydrogenase-ksdd-bhp10516159</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP368051MVXc7-SDS.jpg?v=1772280377</image:loc>
      <image:title>Recombinant Mycolicibacterium smegmatis 3-oxosteroid 1-dehydrogenase (ksdD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-epstein-barr-nuclear-antigen-6-ebna6-partial-bhp10516157</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP365875EFA-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 6 (EBNA6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-syringae-pv-syringae-ice-nucleation-protein-inaz-partial-bhp10516118</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP356891PWD-SDS.jpg?v=1772280372</image:loc>
      <image:title>Recombinant Pseudomonas syringae pv. syringae Ice nucleation protein (inaZ), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-falciparum-merozoite-surface-protein-1-msp1-partial-bhp10516145</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361416EWT2a0-SDS.jpg?v=1772280400</image:loc>
      <image:title>Recombinant Plasmodium falciparum Merozoite surface protein 1 (MSP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-pepsin-a-pga-bhp10516135</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360581PIb1-SDS.jpg?v=1772280377</image:loc>
      <image:title>Recombinant Pig Pepsin A(PGA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-phage-ms2-capsid-protein-bhp10516158</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP365998ECZd7-SDS.jpg?v=1772280375</image:loc>
      <image:title>Recombinant Escherichia phage MS2 Capsid protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arachis-hypogaea-glycinin-arah3-partial-bhp10516166</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP4900ANE1-SDS.jpg?v=1772280377</image:loc>
      <image:title>Recombinant Arachis hypogaea Glycinin (Arah3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o157-h7-putative-nad-p-h-nitroreductase-ydja-ydja-bhp10516156</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP364881EOD-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Escherichia coli O157:H7 Putative NAD(P)H nitroreductase YdjA (ydjA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-strongyloides-stercoralis-l3nieag-01-l3nie-01-x208y-x221w-partial-bhp10516167</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-alanine-trna-ligase-alas-partial-bhp10516133</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP360465ENV-SDS.jpg?v=1772280373</image:loc>
      <image:title>Recombinant Escherichia coli Alanine--tRNA ligase (alaS), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-phage-phi6-major-outer-capsid-protein-p8-bhp10516150</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP362169PUV-SDS.jpg?v=1772280375</image:loc>
      <image:title>Recombinant Pseudomonas phage phi6 Major outer capsid protein (P8)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-polypeptide-related-sequence-b-micb-partial-bhp10516175</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5607HU1-SDS.jpg?v=1772280395</image:loc>
      <image:title>Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-polypeptide-related-sequence-b-micb-partial-bhp10516176</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-esat-6-like-protein-esxk-esxk-bhp10516172</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP517353MVZ-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis ESAT-6-like protein EsxK (esxK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-immunodeficiency-virus-type-1-group-m-subtype-c-protein-tat-tat-bhp10516169</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP515530HXB-SDS.jpg?v=1772280393</image:loc>
      <image:title>Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Tat (tat)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-platelet-derived-growth-factor-subunit-b-partial-bhp10516179</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5629PI1-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Pig Platelet-derived growth factor subunit B, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-schizosaccharomyces-pombe-alpha-n-terminal-protein-methyltransferase-1-tae1-bhp10516170</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP515579SXV-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Schizosaccharomyces pombe Alpha N-terminal protein methyltransferase 1 (tae1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-lipocalin-can-f-6-0101-bhp10516164</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-aerobic-respiration-control-protein-arca-arca-bhp10516128</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pectobacterium-cypripedii-gluconate-2-dehydrogenase-flavoprotein-partial-bhp10516171</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP516466ESR-SDS.jpg?v=1772280377</image:loc>
      <image:title>Recombinant Pectobacterium cypripedii Gluconate 2-dehydrogenase flavoprotein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mitochondrial-processing-peptidase-subunit-alpha-pmpca-bhp10516182</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP606021HU-SDS.jpg?v=1772280384</image:loc>
      <image:title>Recombinant Human Mitochondrial-processing peptidase subunit alpha (PMPCA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-polypeptide-related-sequence-b-micb-partial-bhp10516177</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5607HU2-SDS.jpg?v=1772280379</image:loc>
      <image:title>Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-aquifex-aeolicus-reverse-gyrase-2-rgy2-partial-bhp10516173</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP524126DNV1-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Aquifex aeolicus Reverse gyrase 2 (rgy2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cytosolic-carboxypeptidase-6-agbl4-bhp10516180</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP600702MO-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Mouse Cytosolic carboxypeptidase 6 (Agbl4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-arginine-rich-splicing-factor-9-srsf9-bhp10516196</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP618767HUc7-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Human Serine/arginine-rich splicing factor 9 (SRSF9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-striatin-3-strn3-bhp10516189</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP614388HUd7-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Human Striatin-3 (STRN3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mhc-class-i-polypeptide-related-sequence-b-micb-partial-bhp10516178</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP5607HU2a0-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-shikimate-kinase-2-arol-bhp10516168</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP513312ENU-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Escherichia coli Shikimate kinase 2 (aroL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-receptor-type-tyrosine-protein-phosphatase-like-n-ptprn-partial-bhp10516187</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP613703HUf3-SDS.jpg?v=1772280387</image:loc>
      <image:title>Recombinant Human Receptor-type tyrosine-protein phosphatase-like N (PTPRN), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hevea-brasiliensis-small-rubber-particle-protein-srpp-bhp10516174</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP530569HWI-SDS.jpg?v=1772280382</image:loc>
      <image:title>Recombinant Hevea brasiliensis Small rubber particle protein (SRPP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-s-phase-kinase-associated-protein-2-skp2-bhp10516184</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP613392HUc7-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Human S-phase kinase-associated protein 2 (SKP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-phosphoenolpyruvate-carboxykinase-gtp-mitochondrial-pck2-bhp10516198</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP619092HU-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Human Phosphoenolpyruvate carboxykinase [GTP], mitochondrial (PCK2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-thioredoxin-reductase-1-cytoplasmic-txnrd1-partial-bhp10516188</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP613705HU-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Human Thioredoxin reductase 1, cytoplasmic (TXNRD1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-forkhead-box-protein-c1-foxc1-bhp10516195</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP618640HUc7-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Human Forkhead box protein C1 (FOXC1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-pyrroline-5-carboxylate-reductase-2-pycr2-bhp10516199</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP619159BO-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Bovine Pyrroline-5-carboxylate reductase 2 (PYCR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-tissue-factor-pathway-inhibitor-tfpi-bhp10516209</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP636742MOW-SDS.jpg?v=1772280384</image:loc>
      <image:title>Recombinant Macaca mulatta Tissue factor pathway inhibitor (TFPI)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudoalteromonas-carrageenovora-lambda-carrageenase-cgla-bhp10516181</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP605219AIA_A4_-SDS.jpg?v=1772280378</image:loc>
      <image:title>Recombinant Pseudoalteromonas carrageenovora Lambda-carrageenase (cglA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-caenorhabditis-elegans-transcription-factor-elt-2-elt-2-bhp10516183</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP607427CXY-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Caenorhabditis elegans Transcription factor elt-2 (elt-2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-prunus-persica-uncharacterized-protein-bhp10516208</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6299EZK-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Prunus persica Uncharacterized protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-caspase-8-casp8-partial-bhp10516204</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP621791HUc7-SDS.jpg?v=1772280385</image:loc>
      <image:title>Recombinant Human Caspase-8 (CASP8), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lanosterol-14-alpha-demethylase-cyp51a1-partial-bhp10516191</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP614993HU1-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Human Lanosterol 14-alpha demethylase (CYP51A1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lim-and-sh3-domain-protein-1-lasp1-partial-bhp10516186</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP613523HU1-SDS.jpg?v=1772280384</image:loc>
      <image:title>Recombinant Human LIM and SH3 domain protein 1 (LASP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sequestosome-1-sqstm1-bhp10516192</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP615696HU-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Human Sequestosome-1 (SQSTM1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-angio-associated-migratory-cell-protein-aamp-bhp10516193</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP615711HU-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Human Angio-associated migratory cell protein (AAMP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-secretory-phospholipase-a2-receptor-pla2r1-partial-bhp10516207</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-elav-like-protein-1-elavl1-bhp10516197</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP618993HUa0-SDS.jpg?v=1772280382</image:loc>
      <image:title>Recombinant Human ELAV-like protein 1 (ELAVL1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lymphocyte-antigen-6k-ly6k-bhp10516201</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP621061HUa0-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Human Lymphocyte antigen 6K (LY6K)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-clostridioides-difficile-cell-wall-binding-cysteine-protease-cwp84-lytc-12-c116a-partial-bhp10516211</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-threonine-protein-kinase-atr-atr-partial-biotinylated-bhp10516205</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP622666HU-B-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Human Serine/threonine-protein kinase ATR (ATR), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-risc-loading-complex-subunit-tarbp2-tarbp2-bhp10516206</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP623007HUa0-SDS.jpg?v=1772280457</image:loc>
      <image:title>Recombinant Human RISC-loading complex subunit TARBP2 (TARBP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-zinc-finger-hit-domain-containing-protein-3-znhit3-bhp10516194</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP618012HU-SDS.jpg?v=1772280379</image:loc>
      <image:title>Recombinant Human Zinc finger HIT domain-containing protein 3 (ZNHIT3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-krueppel-like-factor-5-klf5-bhp10516185</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nadh-dehydrogenase-ubiquinone-1-alpha-subcomplex-subunit-5-ndufa5-bhp10516190</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP614988HU-SDS.jpg?v=1772280384</image:loc>
      <image:title>Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 (NDUFA5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-francisella-tularensis-subsp-lps-assembly-protein-lptd-lptd-partial-bhp10516221</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP642814FCO-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Francisella tularensis subsp LPS-assembly protein lptD (lptD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-deoxyribonuclease-gamma-dnase1l3-bhp10516203</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP621686HUa0-SDS.jpg?v=1772280381</image:loc>
      <image:title>Recombinant Human Deoxyribonuclease gamma (DNASE1L3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dual-specificity-protein-phosphatase-4-dusp4-bhp10516200</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-clostridioides-difficile-cell-wall-binding-cysteine-protease-cwp84-lytc-12-c116a-partial-bhp10516210</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-ehrlichia-chaffeensis-co-chaperonin-groes-groes-bhp10516213</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP640331EJS-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-xenopus-laevis-bic-c-protein-bic-c-h140a-s141a-partial-bhp10516218</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6418XBE_M_-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Xenopus laevis Bic-C protein (Bic-C) (H140A,S141A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-receptor-superfamily-member-16-ngfr-partial-biotinylated-bhp10516212</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6393MO1-B-SDS.jpg?v=1772280385</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor receptor superfamily member 16 (Ngfr), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-binding-protein-ikaros-ikzf1-bhp10516202</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP621668HUc7-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Human DNA-binding protein Ikaros (IKZF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-malariae-merozoite-surface-protein-1-msp1-partial-bhp10516226</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6487PMO-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Plasmodium malariae Merozoite surface protein 1 (MSP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-listeria-phage-a511-endolysin-ply511-bhp10516231</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP654324LBAH-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Listeria phage A511 Endolysin (PLY511)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neutrophil-elastase-elane-bhp10516233</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP659740MO-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Mouse Neutrophil elastase (Elane)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-polyubiquitin-14-ubq14-bhp10516234</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP661648DOA-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Polyubiquitin 14 (UBQ14)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-sesamum-indicum-2s-albumin-loc105174067-bhp10516242</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-aspergillus-oryzae-probable-pectate-lyase-e-plye-bhp10516228</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP652707DPA-SDS.jpg?v=1772280385</image:loc>
      <image:title>Recombinant Aspergillus oryzae Probable pectate lyase E (plyE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-xenopus-laevis-bic-c-protein-bic-c-partial-bhp10516217</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6418XBE-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Xenopus laevis Bic-C protein (Bic-C), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-scavenger-receptor-cysteine-rich-type-1-protein-m130-cd163-partial-bhp10516227</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-udp-glucuronosyltransferase-3a2-ugt3a2-partial-bhp10516238</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP667485HU-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Human UDP-glucuronosyltransferase 3A2 (UGT3A2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-oryza-sativa-subsp-japonica-os05g0317700-protein-partial-bhp10516236</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6636OFG-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Oryza sativa subsp. japonica Os05g0317700 protein, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-transposase-for-transposon-tn5-tnpa-e54k-l372p-bhp10516240</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP669378ENL_M_h9-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Escherichia coli Transposase for transposon Tn5 (tnpA) (E54K,L372P)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-humulus-japonicus-humj1-bhp10516241</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-neisseria-gonorrhoeae-ribonuclease-hii-rnhb-bhp10516250</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP682770NGAa0-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Neisseria gonorrhoeae Ribonuclease HII (rnhB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-francisella-tularensis-subsp-holarctica-chaperone-protein-dnak-dnak-partial-bhp10516222</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP644976FCO-SDS.jpg?v=1772280382</image:loc>
      <image:title>Recombinant Francisella tularensis subsp. holarctica Chaperone protein DnaK (dnaK), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-tumor-associated-calcium-signal-transducer-2-tacstd2-partial-bhp10516232</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6581MOV-SDS.jpg?v=1772280387</image:loc>
      <image:title>Recombinant Macaca fascicularis tumor-associated calcium signal transducer 2 (TACSTD2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calcium-binding-protein-39-cab39-bhp10516216</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP640939HU-SDS.jpg?v=1772280396</image:loc>
      <image:title>Recombinant Human Calcium-binding protein 39(CAB39)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-neisseria-gonorrhoeae-glyceraldehyde-3-phosphate-dehydrogenase-gapa-bhp10516224</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6458NGA-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Neisseria gonorrhoeae Glyceraldehyde-3-phosphate dehydrogenase (gapA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycoplasma-hyorhinis-variant-surface-antigen-e-vlpe-bhp10516246</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP673204MLR1-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Mycoplasma hyorhinis Variant surface antigen E (vlpE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-neisseria-gonorrhoeae-ribonuclease-hii-rnhb-bhp10516249</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP682770NGA-SDS.jpg?v=1772280387</image:loc>
      <image:title>Recombinant Neisseria gonorrhoeae Ribonuclease HII (rnhB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-pseudoobscura-pseudoobscura-neutral-ceramidase-cdase-partial-bhp10516223</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP645868DME-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Drosophila pseudoobscura pseudoobscura Neutral ceramidase (CDase), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hexokinase-hkdc1-hkdc1-partial-bhp10516225</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP647983HU-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Human Hexokinase HKDC1 (HKDC1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-danio-rerio-aerolysin-like-protein-loc795232-bhp10516235</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6621DIL-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Danio rerio Aerolysin-like protein (LOC795232)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-interleukin-2-il2-bhp10516215</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP640916MOV-SDS.jpg?v=1772280385</image:loc>
      <image:title>Recombinant Macaca fascicularis Interleukin-2 (IL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-artemisia-vulgaris-art-v-2-allergen-art-v-2-bhp10516245</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-auxin-responsive-protein-iaa3-iaa3-bhp10516229</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP653623DOA-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Auxin-responsive protein IAA3 (IAA3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-2-5-oligoadenylate-synthase-1-oas1-partial-bhp10516214</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-phosphatidylinositol-4-5-bisphosphate-3-kinase-catalytic-subunit-alpha-isoform-pik3ca-k802a-partial-bhp10516244</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-aeruginosa-popb-popb-partial-bhp10516256</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6850EZW1-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Pseudomonas aeruginosa PopB (popB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacteroides-gingivalis-major-fimbrial-subunit-protein-type-2-fima-bhp10516252</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP684398PQP-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Bacteroides gingivalis Major fimbrial subunit protein type-2 (fimA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hereditary-hemochromatosis-protein-hfe-partial-bhp10516230</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-xenopus-laevis-bic-c-protein-bic-c-d166a-partial-bhp10516219</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6418XBE_M1_-SDS.jpg?v=1772280383</image:loc>
      <image:title>Recombinant Xenopus laevis Bic-C protein (Bic-C) (D166A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-mas-related-g-protein-coupled-receptor-member-b2-mrgprb2-partial-bhp10516237</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP665973MO1-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Mouse Mas-related G-protein coupled receptor member B2 (Mrgprb2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-adelphocoris-lineolatus-odorant-binding-protein-1-bhp10516264</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6892INR-SDS.jpg?v=1772280387</image:loc>
      <image:title>Recombinant Adelphocoris lineolatus Odorant-binding protein 1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-phosphatidylinositol-4-5-bisphosphate-3-kinase-catalytic-subunit-alpha-isoform-pik3ca-partial-bhp10516243</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516255</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP684467HU6-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-taxus-cuspidata-tubulin-beta-chain-bhp10516239</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6687FTB-SDS.jpg?v=1772280385</image:loc>
      <image:title>Recombinant Taxus cuspidata Tubulin beta chain</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-anopheles-gambiae-agap010489-pa-obp-4-bhp10516262</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6890BZL-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Anopheles gambiae AGAP010489-PA (OBP-4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516253</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP684467HU4-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-osmia-cornuta-odorant-binding-protein-1-bhp10516265</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6893INS-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Osmia cornuta Odorant-binding protein 1</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bordetella-pertussis-brka-autotransporter-brka-partial-bhp10516247</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP673803BUA-SDS.jpg?v=1772280385</image:loc>
      <image:title>Recombinant Bordetella pertussis BrkA autotransporter (brkA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-anopheles-gambiae-agap011647-pa-obp1-partial-bhp10516261</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6889BZL-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Anopheles gambiae AGAP011647-PA (Obp1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tetraodon-nigroviridis-n-acetyltaurine-hydrolase-pter-bhp10516251</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-anopheles-gambiae-agap008055-pa-csp3-bhp10516267</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6895BZL-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Anopheles gambiae AGAP008055-PA (CSP3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-akirin-2-akirin2-bhp10516269</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP690478HU-SDS.jpg?v=1772280409</image:loc>
      <image:title>Recombinant Human Akirin-2 (AKIRIN2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-candida-albicans-exocyst-subunit-sec10-bhp10516268</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6903CZD_A4_-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Candida albicans Exocyst subunit (SEC10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-fprl1-inhibitory-protein-flr-bhp10516220</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP641975SKZ-SDS.jpg?v=1772280380</image:loc>
      <image:title>Recombinant Staphylococcus aureus FPRL1 inhibitory protein (flr)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-sitophilus-zeamais-odorant-binding-protein-1-obp1-partial-bhp10516260</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6888INQ-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Sitophilus zeamais Odorant binding protein 1 (OBP1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-helicoverpa-armigera-obp7-bhp10516270</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6907HVA-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Helicoverpa armigera OBP7</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-usherin-ush2a-partial-bhp10516276</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7006MOV4-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Macaca fascicularis Usherin (USH2A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-protoporphyrinogen-oxidase-2-chloroplastic-mitochondrial-ppox2-bhp10516272</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6910D0A-SDS.jpg?v=1772280390</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Protoporphyrinogen oxidase 2,chloroplastic/mitochondrial (PPOX2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-seizure-protein-6-homolog-sez6-partial-bhp10516254</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP684467HU5-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Human Seizure protein 6 homolog (SEZ6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-uncharacterized-protein-c8orf34-c8orf34-bhp10516248</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP675467HU-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Human Uncharacterized protein C8orf34 (C8orf34)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ump-cmp-kinase-2-mitochondrial-cmpk2-bhp10516257</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP688686HU-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Human UMP-CMP kinase 2, mitochondrial (CMPK2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-norovirus-hu-gii-4-sydney-nsw0514-2012-au-vp1-partial-bhp10516274</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6933IOA-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Norovirus Hu/GII.4/Sydney/NSW0514/2012/AU VP1, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-aeruginosa-lipase-lipc-lipc-bhp10516273</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6920INX-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Pseudomonas aeruginosa Lipase LipC (lipC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-polyadenylate-binding-protein-1-like-pabpc1l-bhp10516281</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-aeruginosa-type-iii-secretion-system-protein-pcrv-bhp10516271</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6908EZW-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Pseudomonas aeruginosa Type III secretion system protein (pcrV)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cylas-formicarius-odorant-binding-protein-obp1-bhp10516258</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6886INP-SDS.jpg?v=1772280387</image:loc>
      <image:title>Recombinant Cylas formicarius Odorant binding protein (OBP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-stenotrophomonas-maltophilia-dicamba-o-demethylase-oxygenase-component-ddmc-bhp10516284</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7065SLU-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Stenotrophomonas maltophilia Dicamba O-demethylase, oxygenase component (ddmC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-immunodominant-staphylococcal-antigen-b-isab-bhp10516277</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ferm-domain-containing-5-frmd5-bhp10516278</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7056HU-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Human FERM domain containing 5 (FRMD5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-lactobacillus-acidophilus-l-lactate-dehydrogenase-1-ldh1-bhp10516259</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP688817LME-SDS.jpg?v=1772280390</image:loc>
      <image:title>Recombinant Lactobacillus acidophilus L-lactate dehydrogenase 1 (ldh1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ferm-domain-containing-5-frmd5-bhp10516279</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7056HUa0-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Human FERM domain containing 5 (FRMD5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-polyadenylate-binding-protein-1-like-pabpc1l-bhp10516282</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP706330HUc7-SDS.jpg?v=1772280392</image:loc>
      <image:title>Recombinant Human Polyadenylate-binding protein 1-like (PABPC1L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-s100a8-s100a9-heterodimer-protein-bhp10516285</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7076MO-SDS.jpg?v=1772280467</image:loc>
      <image:title>Recombinant Mouse S100a8/S100a9 Heterodimer protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kita-kyushu-lung-cancer-antigen-1-ct83-bhp10516288</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP711093HUc7-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-influenza-a-virus-neuraminidase-na-partial-bhp10516275</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6944IOC-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Influenza A virus Neuraminidase (NA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neurogenic-differentiation-factor-1-neurod1-bhp10516300</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720182MOc7-SDS.jpg?v=1772280467</image:loc>
      <image:title>Recombinant Mouse Neurogenic differentiation factor 1 (Neurod1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-diaphorina-citri-general-odorant-binding-protein-3-loc103507602-bhp10516266</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6894INT-SDS.jpg?v=1772280388</image:loc>
      <image:title>Recombinant Diaphorina citri General odorant-binding protein 3 (LOC103507602)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-replication-initiation-protein-repa-partial-bhp10516283</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP706568ENL-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Replication initiation protein (repA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-nad-dependent-protein-deacylase-sirtuin-5-mitochondrial-sirt5-bhp10516293</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP715034RA-SDS.jpg?v=1772280470</image:loc>
      <image:title>Recombinant Rat NAD-dependent protein deacylase sirtuin-5, mitochondrial (Sirt5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ferm-domain-containing-5-frmd5-bhp10516280</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7056HUb0-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Human FERM domain containing 5 (FRMD5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-heat-shock-protein-hsp-90-alpha-hsp90aa1-bhp10516286</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP709080MOV-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Macaca fascicularis Heat shock protein HSP 90-alpha (HSP90AA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-anopheles-gambiaea-gap001409-pa-obp-3-bhp10516263</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP6891BZL-SDS.jpg?v=1772280386</image:loc>
      <image:title>Recombinant Anopheles gambiaeA GAP001409-PA (OBP-3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-versican-core-protein-vcan-partial-bhp10516303</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720284MOc7-SDS.jpg?v=1772280465</image:loc>
      <image:title>Recombinant Mouse Versican core protein (Vcan), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-neisseria-gonorrhoeae-ribonuclease-h-rnha-bhp10516287</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP710864NGA-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Neisseria gonorrhoeae Ribonuclease H (rnhA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-yarrowia-lipolytica-atp-citrate-synthase-bhp10516304</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7206YAP-SDS.jpg?v=1772280392</image:loc>
      <image:title>Recombinant Yarrowia lipolytica ATP citrate synthase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c-type-natriuretic-peptide-nppc-bhp10516291</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP713991MO-SDS.jpg?v=1772280393</image:loc>
      <image:title>Recombinant Mouse C-type natriuretic peptide (Nppc)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-semaphorin-4b-sema4b-partial-bhp10516292</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP714012MOb1-SDS.jpg?v=1772280392</image:loc>
      <image:title>Recombinant Mouse Semaphorin-4B (Sema4b), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-d-3-phosphoglycerate-dehydrogenase-phgdh-bhp10516296</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-twinkle-homolog-protein-chloroplastic-mitochondrial-bhp10516308</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7209DOAb1-SDS.jpg?v=1772280408</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Twinkle homolog protein, chloroplastic/mitochondrial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pisum-sativum-gibberellin-3-beta-dioxygenase-1-le-bhp10516294</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7159HZY-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Pisum sativum Gibberellin 3-beta-dioxygenase 1 (LE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neurogenic-differentiation-factor-1-neurod1-m114a-h115a-bhp10516301</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720182MO_M4_c7-SDS.jpg?v=1772280410</image:loc>
      <image:title>Recombinant Mouse Neurogenic differentiation factor 1 (Neurod1)(M114A,H115A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-desert-hedgehog-protein-dhh-partial-bhp10516302</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720251MO-SDS.jpg?v=1772280393</image:loc>
      <image:title>Recombinant Mouse Desert hedgehog protein (Dhh), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-udp-glucuronosyltransferase-2b7-ugt2b7-partial-bhp10516311</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP723476RA1-SDS.jpg?v=1772280396</image:loc>
      <image:title>Recombinant Rat UDP-glucuronosyltransferase 2B7 (Ugt2b7), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alanine-trna-ligase-mitochondrial-aars2-partial-bhp10516290</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP711453HU3-SDS.jpg?v=1772280389</image:loc>
      <image:title>Recombinant Human Alanine--tRNA ligase, mitochondrial (AARS2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transcription-intermediary-factor-1-beta-trim28-partial-bhp10516297</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP717259MO-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Mouse Transcription intermediary factor 1-beta (Trim28), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-leukocyte-associated-immunoglobulin-like-receptor-1-lair1-partial-bhp10516298</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7188CA2-SDS.jpg?v=1772280392</image:loc>
      <image:title>Recombinant Cat Leukocyte associated immunoglobulin like receptor 1 (LAIR1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-e3-sumo-protein-ligase-siz1-siz1-bhp10516309</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP721197DOA_F3_-SDS.jpg?v=1772280393</image:loc>
      <image:title>Recombinant Arabidopsis thaliana E3 SUMO-protein ligase SIZ1 (SIZ1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sarcoplasmic-endoplasmic-reticulum-calcium-atpase-3-atp2a3-partial-bhp10516315</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-phosphatidylserine-decarboxylase-proenzyme-1-mitochondrial-psd1-bhp10516305</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7207DOA_A4_-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Phosphatidylserine decarboxylase proenzyme 1, mitochondrial (PSD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-proepiregulin-ereg-partial-bhp10516317</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP730741MO-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Mouse Proepiregulin (Ereg), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-sodium-channel-protein-type-10-subunit-alpha-scn10a-partial-bhp10516325</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP737100RA-SDS.jpg?v=1772280396</image:loc>
      <image:title>Recombinant Rat Sodium channel protein type 10 subunit alpha (Scn10a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-adenosine-receptor-a2a-adora2a-partial-bhp10516299</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP720158MO1-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Mouse Adenosine receptor A2a (Adora2a), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-danio-rerio-e3-ubiquitin-protein-ligase-trim33-trim33-partial-bhp10516313</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP724971DIL-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Danio rerio E3 ubiquitin-protein ligase TRIM33 (trim33), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-serum-paraoxonase-lactonase-3-pon3-bhp10516324</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP737067MOb1-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Mouse Serum paraoxonase/lactonase 3 (Pon3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-serum-paraoxonase-lactonase-3-pon3-bhp10516323</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP737067MO-SDS.jpg?v=1772280409</image:loc>
      <image:title>Recombinant Mouse Serum paraoxonase/lactonase 3 (Pon3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pongo-abelii-dyslexia-associated-protein-kiaa0319-like-protein-kiaa0319l-partial-bhp10516322</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-coxiella-burnetii-uncharacterized-protein-bhp10516319</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7319DXP-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Coxiella burnetii Uncharacterized protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-histone-lysine-n-methyltransferase-ezh2-ezh2-partial-bhp10516310</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP723402MO1-SDS.jpg?v=1772280393</image:loc>
      <image:title>Recombinant Mouse Histone-lysine N-methyltransferase EZH2 (Ezh2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-meteorin-like-protein-metrnl-bhp10516318</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP731035HUc7-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Human Meteorin-like protein (METRNL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-yarrowia-lipolytica-atp-citrate-synthase-bhp10516312</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7247YAP-SDS.jpg?v=1772280393</image:loc>
      <image:title>Recombinant Yarrowia lipolytica ATP citrate synthase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-lin-28-homolog-b-lin28b-bhp10516329</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP741049HU-SDS.jpg?v=1772280467</image:loc>
      <image:title>Recombinant Human Protein lin-28 homolog B (LIN28B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-polymerase-gamma-2-polgamma2-partial-bhp10516306</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7208DOA1-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Polymerase gamma 2 (POLGAMMA2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-cbfa2t1-runx1t1-bhp10516314</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP726765HUc7-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Human Protein CBFA2T1 (RUNX1T1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-fasciculation-and-elongation-protein-zeta-2-fez2-bhp10516330</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP744236MO-SDS.jpg?v=1772280395</image:loc>
      <image:title>Recombinant Mouse Fasciculation and elongation protein zeta-2 (Fez2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-myosin-regulatory-light-polypeptide-9-myl9-x69y-bhp10516326</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP737335RA-SDS.jpg?v=1772280398</image:loc>
      <image:title>Recombinant Rat Myosin regulatory light polypeptide 9 (Myl9) (X69Y)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alanine-trna-ligase-mitochondrial-aars2-partial-bhp10516289</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP711453HU2-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Human Alanine--tRNA ligase, mitochondrial (AARS2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-protease-inhibitor-kazal-type-6-spink6-bhp10516331</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glycerophosphocholine-cholinephosphodiesterase-enpp6-enpp6-partial-bhp10516328</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pisum-sativum-gibberellin-3-beta-dioxygenase-1-le-a229t-bhp10516295</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7159HZY_M_-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Pisum sativum Gibberellin 3-beta-dioxygenase 1 (LE) (A229T)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nadh-cytochrome-b5-reductase-2-cyb5r2-bhp10516327</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-containing-protein-9-lrrc9-partial-bhp10516333</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP744412HU1-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Human Leucine-rich repeat-containing protein 9 (LRRC9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-galectin-lgals3-bhp10516316</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7276BO-SDS.jpg?v=1772280391</image:loc>
      <image:title>Recombinant Bovine Galectin (LGALS3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cardiotrophin-1-ctf1-bhp10516321</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP733705MO-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Mouse Cardiotrophin-1 (Ctf1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-xanthomonas-albilineans-peptidoglycan-d-d-transpeptidase-ftsi-ftsi-partial-bhp10516338</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7461GYO-SDS.jpg?v=1772280398</image:loc>
      <image:title>Recombinant Xanthomonas albilineans Peptidoglycan D,D-transpeptidase FtsI (ftsI), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-oxaloacetate-tautomerase-fahd1-mitochondrial-fahd1-bhp10516343</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP750807HU-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Human Oxaloacetate tautomerase FAHD1, mitochondrial (FAHD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-ppe-family-immunogenic-protein-ppe68-ppe68-bhp10516341</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP748521MVZ-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis PPE family immunogenic protein PPE68 (PPE68)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-tissue-kallikrein-klk5-partial-bhp10516337</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7460PI-SDS.jpg?v=1772280395</image:loc>
      <image:title>Recombinant Pig tissue kallikrein (KLK5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-riemerella-anatipestifer-ra-ch-1-outer-membrane-receptor-for-ferrienterochelin-and-colicins-b739-1416-partial-bhp10516340</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7483-SDS.jpg?v=1772280465</image:loc>
      <image:title>Recombinant Riemerella anatipestifer RA-CH-1 Outer membrane receptor for ferrienterochelin and colicins (B739_1416), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-tissue-kallikrein-klk5-partial-bhp10516335</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7444DO-SDS.jpg?v=1772280395</image:loc>
      <image:title>Recombinant Dog tissue kallikrein (KLK5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-protease-serine-7-tmprss7-partial-bhp10516336</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP745764HU-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Human Transmembrane protease serine 7 (TMPRSS7), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-isoaspartyl-peptidase-l-asparaginase-asrgl1-partial-bhp10516349</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP755484HU-SDS.jpg?v=1772280396</image:loc>
      <image:title>Recombinant Human Isoaspartyl peptidase/L-asparaginase (ASRGL1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lysophospholipase-d-gdpd3-gdpd3-partial-bhp10516352</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP759171HU-SDS.jpg?v=1772280396</image:loc>
      <image:title>Recombinant Human Lysophospholipase D GDPD3 (GDPD3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-twinkle-homolog-protein-chloroplastic-mitochondrial-bhp10516307</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7209DOA-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Twinkle homolog protein, chloroplastic/mitochondrial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterocloster-bolteae-90a9-penicillin-binding-protein-2-partial-bhp10516345</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7508IPY-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Enterocloster bolteae 90A9 Penicillin-binding protein 2, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-enterocloster-bolteae-90a9-penicillin-binding-protein-1a-partial-bhp10516342</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7506IPY-SDS.jpg?v=1772280398</image:loc>
      <image:title>Recombinant Enterocloster bolteae 90A9 Penicillin-binding protein 1A, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-type-lectin-domain-family-4-member-g-clec4g-partial-bhp10516332</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP744269HU-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Human C-type lectin domain family 4 member G (CLEC4G), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-serine-threonine-protein-phosphatase-2a-65-kda-regulatory-subunit-a-alpha-isoform-ppp2r1a-bhp10516351</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP758842MO-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Mouse Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (Ppp2r1a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tubulin-alpha-1a-chain-tuba1a-bhp10516348</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-oxaloacetate-tautomerase-fahd1-mitochondrial-fahd1-bhp10516344</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP750807HUc7-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Human Oxaloacetate tautomerase FAHD1, mitochondrial (FAHD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-oxidative-demethylase-alkbh2-alkbh2-bhp10516353</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP761219HUf0-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Human DNA oxidative demethylase ALKBH2 (ALKBH2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-rho-guanine-nucleotide-exchange-factor-18-arhgef18-partial-bhp10516334</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP744417HU-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Human Rho guanine nucleotide exchange factor 18 (ARHGEF18), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-xanthomonas-albilineans-cyclic-guanylate-specific-phosphodiesterase-partial-bhp10516347</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7543GYO-SDS.jpg?v=1772280398</image:loc>
      <image:title>Recombinant Xanthomonas albilineans cyclic-guanylate-specific phosphodiesterase, partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bartonella-quintana-dihydrolipoyllysine-residue-succinyltransferase-component-of-2-oxoglutarate-dehydrogenase-complex-sucb-bhp10516346</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP753259BSH-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Bartonella quintana Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (sucB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-arylsulfatase-k-arsk-bhp10516354</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP764940HU-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Human Arylsulfatase K (ARSK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-induced-myeloid-leukemia-cell-differentiation-protein-mcl-1-mcl1-partial-bhp10516358</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cmrf35-like-molecule-5-cd300ld-partial-biotinylated-bhp10516350</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP757797HU1-B-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Human CMRF35-like molecule 5 (CD300LD), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-serine-threonine-protein-kinase-nek5-nek5-bhp10516357</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP766517MO-SDS.jpg?v=1772280396</image:loc>
      <image:title>Recombinant Mouse Serine/threonine-protein kinase Nek5 (Nek5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-coxiella-burnetii-lps-assembly-protein-lptd-lptd-partial-bhp10516360</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP769349DXP-SDS.jpg?v=1772280397</image:loc>
      <image:title>Recombinant Coxiella burnetii LPS-assembly protein lptD (lptD), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-rna-binding-protein-nova-1-nova1-bhp10516362</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP772155RA-SDS.jpg?v=1772280413</image:loc>
      <image:title>Recombinant Rat RNA-binding protein Nova-1 (Nova1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nucleoplasmin-2-npm2-bhp10516365</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP774790HU-SDS.jpg?v=1772280428</image:loc>
      <image:title>Recombinant Human Nucleoplasmin-2 (NPM2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-coxiella-burnetii-uncharacterized-protein-bhp10516320</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7320DXP-SDS.jpg?v=1772280394</image:loc>
      <image:title>Recombinant Coxiella burnetii Uncharacterized protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pseudomonas-putida-probable-hth-type-transcriptional-regulator-ttgr-ttgr-bhp10516366</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP801612FGB-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Pseudomonas putida Probable HTH-type transcriptional regulator ttgR (ttgR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-66-protein-e7-e7-bhp10516359</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP768853HDAS-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Human papillomavirus 66 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-adm2-adm2-partial-bhp10516368</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP801808HUc7-SDS.jpg?v=1772280415</image:loc>
      <image:title>Recombinant Human Protein ADM2 (ADM2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-nepenthes-gracilis-aspartic-proteinase-nepenthesin-2-nep2-bhp10516356</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP765721NBAV_A4_-SDS.jpg?v=1772280400</image:loc>
      <image:title>Recombinant Nepenthes gracilis Aspartic proteinase nepenthesin-2 (nep2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ran-binding-protein-3-like-ranbp3l-bhp10516369</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP803130HU-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Human Ran-binding protein 3-like (RANBP3L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-dihydropteridine-reductase-qdpr-bhp10516372</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP803943MO-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Mouse Dihydropteridine reductase (Qdpr)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fbxw7-and-skp1-heterodimer-protein-bhp10516339</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7463HUe1-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Human FBXW7&amp;SKP1 Heterodimer Protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-lama-glama-interleukin-2-il2-bhp10516361</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP769693LBSa0-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Lama glama Interleukin-2 (IL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-uroplakin-3b-upk3b-partial-bhp10516363</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-adm2-adm2-partial-bhp10516367</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP801808HU-SDS.jpg?v=1772280417</image:loc>
      <image:title>Recombinant Human Protein ADM2 (ADM2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lon-protease-homolog-2-peroxisomal-lonp2-partial-bhp10516370</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP803134HU1-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Human Lon protease homolog 2, peroxisomal (LONP2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-perilipin-5-plin5-bhp10516376</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP804867MO-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Mouse Perilipin-5 (Plin5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ly6-plaur-domain-containing-protein-1-lypd1-bhp10516374</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP804823MO-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Mouse Ly6/PLAUR domain-containing protein 1 (Lypd1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sh3-and-cysteine-rich-domain-containing-protein-3-stac3-bhp10516378</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP805368MO-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Mouse SH3 and cysteine-rich domain-containing protein 3 (Stac3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-stenotrophomonas-maltophilia-dtdp-glucose-4-6-dehydratase-rmlb-bhp10516355</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP7649SLU-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Stenotrophomonas maltophilia dTDP-glucose 4,6-dehydratase (rmlB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-artemisia-vulgaris-profilin-1-bhp10516381</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-alanine-trna-ligase-cytoplasmic-aars1-bhp10516373</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP804328MO_A4_-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Mouse Alanine--tRNA ligase, cytoplasmic (Aars1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-chondroitin-synthase-kfoc-bhp10516387</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP817141ENL-SDS.jpg?v=1772280403</image:loc>
      <image:title>Recombinant Escherichia coli Chondroitin synthase (kfoC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bbsome-complex-member-bbs1-bbs1-biotinylated-bhp10516399</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP836736HU-B-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Human BBSome complex member BBS1 (BBS1), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-transferrin-receptor-protein-1-tfrc-partial-bhp10516384</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP816838PIc7-SDS.jpg?v=1772280468</image:loc>
      <image:title>Recombinant Pig Transferrin receptor protein 1 (TFRC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-filamin-a-flna-partial-bhp10516375</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP804854MO-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Mouse Filamin-A (Flna), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-dedicator-of-cytokinesis-protein-2-dock2-partial-bhp10516379</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP806486MO-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Mouse Dedicator of cytokinesis protein 2 (Dock2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nacht-lrr-and-pyd-domains-containing-protein-3-nlrp3-partial-bhp10516391</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP822275HU1c7-SDS.jpg?v=1772280420</image:loc>
      <image:title>Recombinant Human NACHT, LRR and PYD domains-containing protein 3 (NLRP3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sodium-glucose-cotransporter-2-slc5a2-partial-bhp10516390</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP821656MO-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Mouse Sodium/glucose cotransporter 2 (Slc5a2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-solute-carrier-family-22-member-12-slc22a12-partial-bhp10516380</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP806534MO-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Mouse Solute carrier family 22 member 12 (Slc22a12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-naja-atra-acidic-phospholipase-a2-2-bhp10516400</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP838600NFG-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Naja atra Acidic phospholipase A2 2</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lysosomal-phospholipase-a-and-acyltransferase-pla2g15-bhp10516389</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP818760HU-SDS.jpg?v=1772280400</image:loc>
      <image:title>Recombinant Human Lysosomal phospholipase A and acyltransferase (PLA2G15)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-high-affinity-copper-uptake-protein-1-slc31a1-partial-bhp10516383</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP814304MO1-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Mouse High affinity copper uptake protein 1 (Slc31a1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-rnf130-rnf130-partial-bhp10516371</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP803148HU-SDS.jpg?v=1772280399</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase RNF130 (RNF130), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-platanus-acerifolia-putative-invertase-inhibitor-bhp10516388</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP818103PGAT-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Platanus acerifolia Putative invertase inhibitor</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-zea-mays-transcription-factor-teosinte-branched-1-tb1-bhp10516396</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP835951ZAX-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Zea mays Transcription factor TEOSINTE BRANCHED 1 (TB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-porcine-epidemic-diarrhea-virus-spike-glycoprotein-s-partial-bhp10516413</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP849611PPW-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Porcine epidemic diarrhea virus Spike glycoprotein (S), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-mutans-serotype-c-udp-n-acetylmuramoyl-l-alanyl-d-glutamate-l-lysine-ligase-mure-bhp10516382</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP813565FMR-SDS.jpg?v=1772280400</image:loc>
      <image:title>Recombinant Streptococcus mutans serotype c UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L-lysine ligase (murE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-glutathione-specific-gamma-glutamylcyclotransferase-1-chac1-bhp10516402</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP840285MO-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Mouse Glutathione-specific gamma-glutamylcyclotransferase 1 (Chac1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-salmonella-typhi-secreted-effector-protein-pipb2-pipb2-bhp10516405</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP841656SWW-SDS.jpg?v=1772280403</image:loc>
      <image:title>Recombinant Salmonella typhi Secreted effector protein pipB2 (pipB2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-histone-acetyltransferase-kat5-kat5-partial-bhp10516395</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP178494h-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Human Histone acetyltransferase KAT5 (KAT5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-comm-domain-containing-protein-9-commd9-bhp10516386</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP816989MOa0-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Mouse COMM domain-containing protein 9 (Commd9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alpha-protein-kinase-1-alpk1-partial-bhp10516398</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP836286HU-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Human Alpha-protein kinase 1 (ALPK1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-extracellular-serine-threonine-protein-kinase-fam20c-fam20c-bhp10516385</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP816901HU-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Human Extracellular serine/threonine protein kinase FAM20C (FAM20C)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-patatin-like-phospholipase-domain-containing-protein-2-pnpla2-bhp10516397</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP836180HUc7-SDS.jpg?v=1772280411</image:loc>
      <image:title>Recombinant Human Patatin-like phospholipase domain-containing protein 2 (PNPLA2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nacht-lrr-and-pyd-domains-containing-protein-3-nlrp3-c279a-partial-bhp10516392</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP822275HU7_M1_-SDS.jpg?v=1772280405</image:loc>
      <image:title>Recombinant Human NACHT, LRR and PYD domains-containing protein 3 (NLRP3) (C279A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kynurenine-alpha-aminoadipate-aminotransferase-mitochondrial-aadat-bhp10516408</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP843276HUd8-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (AADAT)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-placenta-expressed-transcript-1-protein-plet1-bhp10516417</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP851843MOa0-SDS.jpg?v=1772280421</image:loc>
      <image:title>Recombinant Mouse Placenta-expressed transcript 1 protein (Plet1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-abscisic-acid-receptor-pyl1-pyl1-partial-bhp10516393</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP141574pl-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Abscisic acid receptor PYL1 (PYL1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-co-chaperonin-groes-groes-bhp10516394</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP832069FSGf0-SDS.jpg?v=1772280474</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cerebellin-4-cbln4-bhp10516377</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP805305MO-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Mouse Cerebellin-4 (Cbln4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-latent-transforming-growth-factor-beta-binding-protein-4-ltbp4-partial-bhp10516416</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP850788HU-SDS.jpg?v=1772280405</image:loc>
      <image:title>Recombinant Human Latent-transforming growth factor beta-binding protein 4 (LTBP4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-caspase-10-casp10-partial-bhp10516401</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP838815HU-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Human Caspase-10 (CASP10), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-roundabout-homolog-3-robo3-partial-bhp10516411</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP846671HUb1-SDS.jpg?v=1772280469</image:loc>
      <image:title>Recombinant Human Roundabout homolog 3 (ROBO3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-and-transmembrane-domain-containing-protein-2-lrtm2-partial-bhp10516412</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-nuclear-receptor-binding-factor-2-nrbf2-bhp10516404</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP840834MO-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Mouse Nuclear receptor-binding factor 2 (Nrbf2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-f-box-like-wd-repeat-containing-protein-ebi-ebi-partial-bhp10516415</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interferon-inducible-protein-aim2-aim2-bhp10516409</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ubiquitin-fusion-degradation-protein-1-homolog-ufd1l-bhp10516406</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP842166HUf0-SDS.jpg?v=1772280402</image:loc>
      <image:title>Recombinant Human Ubiquitin fusion degradation protein 1 homolog (UFD1L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-wnt-9a-wnt9a-bhp10516403</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dna-repair-endonuclease-xpf-ercc4-partial-bhp10516414</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP849795HU-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Human DNA repair endonuclease XPF (ERCC4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-scavenger-receptor-class-f-member-2-scarf2-partial-bhp10516407</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-placenta-expressed-transcript-1-protein-plet1-bhp10516418</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP851843MOc7-SDS.jpg?v=1772280479</image:loc>
      <image:title>Recombinant Mouse Placenta-expressed transcript 1 protein (Plet1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-3-ketoacyl-coa-thiolase-a-peroxisomal-acaa1a-bhp10516422</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP852843MO-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Mouse 3-ketoacyl-CoA thiolase A, peroxisomal (Acaa1a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-f-box-only-protein-17-fbxo17-bhp10516423</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP853409HU-SDS.jpg?v=1772280475</image:loc>
      <image:title>Recombinant Human F-box only protein 17 (FBXO17)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-roundabout-homolog-3-robo3-partial-bhp10516410</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dep-domain-containing-protein-1b-depdc1b-bhp10516419</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP851968HU-SDS.jpg?v=1772280404</image:loc>
      <image:title>Recombinant Human DEP domain-containing protein 1B (DEPDC1B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kelch-like-protein-32-klhl32-bhp10516424</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP853471HU-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Human Kelch-like protein 32 (KLHL32)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-reston-ebolavirus-pre-small-secreted-glycoprotein-gp-partial-bhp10516421</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516431</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU6-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516429</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU4b0-SDS.jpg?v=1772280408</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o157-h7-fmn-dependent-nadh-quinone-oxidoreductase-azor-bhp10516420</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP852031EOD-SDS.jpg?v=1772280410</image:loc>
      <image:title>Recombinant Escherichia coli O157:H7 FMN-dependent NADH:quinone oxidoreductase (azoR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-motif-chemokine-17-ccl17-biotinylated-bhp10516427</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856406HU-B-SDS.jpg?v=1772280422</image:loc>
      <image:title>Recombinant Human C-C motif chemokine 17 (CCL17), Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sarcosine-dehydrogenase-mitochondrial-sardh-partial-bhp10516439</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP857487MO-SDS.jpg?v=1772280417</image:loc>
      <image:title>Recombinant Mouse Sarcosine dehydrogenase, mitochondrial (Sardh), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sarcosine-dehydrogenase-mitochondrial-sardh-partial-bhp10516440</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP857487MOb1-SDS.jpg?v=1772280407</image:loc>
      <image:title>Recombinant Mouse Sarcosine dehydrogenase, mitochondrial (Sardh), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prohibitin-2-phb2-partial-bhp10516446</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859937HU2c7-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Human Prohibitin-2 (PHB2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516433</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU7b0-SDS.jpg?v=1772280415</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-mucosal-pentraxin-mptx-bhp10516425</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP854496MO-SDS.jpg?v=1772280409</image:loc>
      <image:title>Recombinant Mouse Mucosal pentraxin (Mptx)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ef-hand-domain-containing-protein-d2-efhd2-bhp10516437</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856907HU-SDS.jpg?v=1772280478</image:loc>
      <image:title>Recombinant Human EF-hand domain-containing protein D2 (EFHD2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-proheparin-binding-egf-like-growth-factor-hbegf-partial-bhp10516438</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP857429MO-SDS.jpg?v=1772280407</image:loc>
      <image:title>Recombinant Mouse Proheparin-binding EGF-like growth factor (Hbegf), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516434</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU8-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-paramecium-bursaria-chlorella-virus-1-mrna-capping-enzyme-a103r-bhp10516364</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP774574ERU-SDS.jpg?v=1772280401</image:loc>
      <image:title>Recombinant Paramecium bursaria Chlorella virus 1 mRNA-capping enzyme (A103R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prohibitin-2-phb2-bhp10516447</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859937HUc7-SDS.jpg?v=1772280408</image:loc>
      <image:title>Recombinant Human Prohibitin-2 (PHB2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-pectinesterase-inhibitor-1-pmei1-bhp10516455</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP862828DOA-SDS.jpg?v=1772280411</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Pectinesterase inhibitor 1 (PMEI1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-mucolipin-1-mcoln1-partial-bhp10516444</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859533MO1-SDS.jpg?v=1772280408</image:loc>
      <image:title>Recombinant Mouse Mucolipin-1 (Mcoln1) , partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calcium-uptake-protein-1-mitochondrial-micu1-bhp10516449</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP860652HU_A4_F_-SDS.jpg?v=1772280408</image:loc>
      <image:title>Recombinant Human Calcium uptake protein 1, mitochondrial (MICU1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calcineurin-b-homologous-protein-1-chp1-bhp10516450</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP860773HU-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Human Calcineurin B homologous protein 1 (CHP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-selenide-water-dikinase-2-sephs2-u60s-bhp10516442</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859104HU-SDS.jpg?v=1772280413</image:loc>
      <image:title>Recombinant Human Selenide, water dikinase 2 (SEPHS2) (U60S)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516432</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU7-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prohibitin-2-phb2-partial-bhp10516445</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859937HU2-SDS.jpg?v=1772280409</image:loc>
      <image:title>Recombinant Human Prohibitin-2 (PHB2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dehydrogenase-reductase-sdr-family-member-4-dhrs4-partial-bhp10516451</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861137HU1-SDS.jpg?v=1772280410</image:loc>
      <image:title>Recombinant Human Dehydrogenase/reductase SDR family member 4 (DHRS4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516428</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU4-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prohibitin-2-phb2-bhp10516448</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859937HUd7-SDS.jpg?v=1772280425</image:loc>
      <image:title>Recombinant Human Prohibitin-2 (PHB2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-arginine-n-methyltransferase-1-prmt1-partial-bhp10516443</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP859113HU1c7-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Human Protein arginine N-methyltransferase 1 (PRMT1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516430</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU5-SDS.jpg?v=1772280414</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-syntaxin-17-stx17-partial-bhp10516454</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861508MO1-SDS.jpg?v=1772280409</image:loc>
      <image:title>Recombinant Mouse Syntaxin-17 (Stx17), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516435</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU8b0-SDS.jpg?v=1772280422</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-69-protein-e7-e7-bhp10516459</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP864306HOL-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Human papillomavirus 69 Protein E7 (E7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-calcitonin-gene-related-peptide-2-calcb-bhp10516441</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP857503MO-SDS.jpg?v=1772280406</image:loc>
      <image:title>Recombinant Mouse Calcitonin gene-related peptide 2 (Calcb)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ly-6-neurotoxin-like-protein-1-lynx1-bhp10516452</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861187HU-SDS.jpg?v=1772280482</image:loc>
      <image:title>Recombinant Human Ly-6/neurotoxin-like protein 1 (LYNX1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tata-binding-protein-associated-factor-2n-taf15-partial-bhp10516436</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP856431HU9-SDS.jpg?v=1772280405</image:loc>
      <image:title>Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-tweety-homolog-1-ttyh1-partial-bhp10516465</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867139HU1-SDS.jpg?v=1772280435</image:loc>
      <image:title>Recombinant Human Protein tweety homolog 1 (TTYH1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-salmonella-typhi-outer-membrane-protein-a-ompa-partial-bhp10516426</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-RP164794Ba-SDS.jpg?v=1772280419</image:loc>
      <image:title>Recombinant Salmonella typhi Outer membrane protein A (ompA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sphingosine-1-phosphate-receptor-5-s1pr5-partial-bhp10516464</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867132HU1-SDS.jpg?v=1772280410</image:loc>
      <image:title>Recombinant Human Sphingosine 1-phosphate receptor 5 (S1PR5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tlr-adapter-interacting-with-slc15a4-on-the-lysosome-tasl-bhp10516466</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867184HU-SDS.jpg?v=1772280424</image:loc>
      <image:title>Recombinant Human TLR adapter interacting with SLC15A4 on the lysosome (TASL)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-taste-receptor-type-2-member-14-tas2r14-partial-bhp10516470</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP868362HU1-SDS.jpg?v=1772280413</image:loc>
      <image:title>Recombinant Human Taste receptor type 2 member 14 (TAS2R14), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-interleukin-13-il13-bhp10516469</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP868226DOc7-SDS.jpg?v=1772280411</image:loc>
      <image:title>Recombinant Dog Interleukin-13 (IL13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-angiopoietin-related-protein-2-angptl2-bhp10516461</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP865621MO-SDS.jpg?v=1772280431</image:loc>
      <image:title>Recombinant Mouse Angiopoietin-related protein 2 (Angptl2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-transferrin-receptor-protein-1-tfrc-partial-bhp10516462</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867082DO-SDS.jpg?v=1772280412</image:loc>
      <image:title>Recombinant Dog Transferrin receptor protein 1 (TFRC), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-zobellia-galactanivorans-iota-carrageenase-cgia-bhp10516456</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP863702ZAAQ-SDS.jpg?v=1772280410</image:loc>
      <image:title>Recombinant Zobellia galactanivorans Iota-carrageenase (cgiA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-egl-nine-homolog-1-egln1-bhp10516458</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP863932HU_A4_c7-SDS.jpg?v=1772280426</image:loc>
      <image:title>Recombinant Human Egl nine homolog 1 (EGLN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-repressor-of-rna-polymerase-iii-transcription-maf1-homolog-maf1-g236r-bhp10516472</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP872421HU-SDS.jpg?v=1772280424</image:loc>
      <image:title>Recombinant Human Repressor of RNA polymerase III transcription MAF1 homolog (MAF1) (G236R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-notechis-scutatus-scutatus-acidic-phospholipase-a2-hte-bhp10516474</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP874028NHT-SDS.jpg?v=1772280411</image:loc>
      <image:title>Recombinant Notechis scutatus scutatus Acidic phospholipase A2 HTe</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ferroptosis-suppressor-protein-1-aifm2-partial-bhp10516475</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP874794HU-SDS.jpg?v=1772280411</image:loc>
      <image:title>Recombinant Human Ferroptosis suppressor protein 1 (AIFM2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pseudouridylate-synthase-pus7l-pus7l-bhp10516463</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867121HU-SDS.jpg?v=1772280422</image:loc>
      <image:title>Recombinant Human Pseudouridylate synthase PUS7L (PUS7L)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rickettsia-conorii-outer-membrane-protein-b-ompb-partial-bhp10516468</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867765RMS-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-nodamura-virus-protein-b2-b2-bhp10516490</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP881266NED-SDS.jpg?v=1772280418</image:loc>
      <image:title>Recombinant Nodamura virus Protein B2 (B2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cytochrome-c1-heme-protein-mitochondrial-cyc1-partial-bhp10516480</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP875175MO1a0-SDS.jpg?v=1772280494</image:loc>
      <image:title>Recombinant Mouse Cytochrome c1, heme protein, mitochondrial (Cyc1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cytochrome-c1-heme-protein-mitochondrial-cyc1-partial-bhp10516479</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP875175MO1-SDS.jpg?v=1772280484</image:loc>
      <image:title>Recombinant Mouse Cytochrome c1, heme protein, mitochondrial (Cyc1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bartonella-henselae-type-iv-secretion-system-protein-virb4-virb4-partial-bhp10516471</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP870829BSG-SDS.jpg?v=1772280419</image:loc>
      <image:title>Recombinant Bartonella henselae Type IV secretion system protein virB4 (virB4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ly-6-neurotoxin-like-protein-1-lynx1-bhp10516453</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP861187HU_F_-SDS.jpg?v=1772280426</image:loc>
      <image:title>Recombinant Human Ly-6/neurotoxin-like protein 1 (LYNX1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-adhesion-g-protein-coupled-receptor-l3-adgrl3-partial-bhp10516467</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP867185HU-SDS.jpg?v=1772280477</image:loc>
      <image:title>Recombinant Human Adhesion G protein-coupled receptor L3 (ADGRL3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cyclin-dependent-kinase-12-cdk12-partial-bhp10516494</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882147HU-SDS.jpg?v=1772280422</image:loc>
      <image:title>Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-rna-guanine-n7-methyltransferase-activating-subunit-ramac-bhp10516476</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP874806HU-SDS.jpg?v=1772280431</image:loc>
      <image:title>Recombinant Human RNA guanine-N7 methyltransferase activating subunit (RAMAC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dedicator-of-cytokinesis-protein-5-dock5-partial-bhp10516481</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP875689HU-SDS.jpg?v=1772280426</image:loc>
      <image:title>Recombinant Human Dedicator of cytokinesis protein 5 (DOCK5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-complement-c1q-tumor-necrosis-factor-related-protein-6-c1qtnf6-partial-bhp10516477</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-resistin-like-alpha-retnla-bhp10516485</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP880616MO-SDS.jpg?v=1772280418</image:loc>
      <image:title>Recombinant Mouse Resistin-like alpha (Retnla)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcription-factor-coe3-ebf3-bhp10516487</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-egl-nine-homolog-1-egln1-bhp10516457</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP863932HU_A4_-SDS.jpg?v=1772280410</image:loc>
      <image:title>Recombinant Human Egl nine homolog 1 (EGLN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-yth-domain-containing-family-protein-1-ythdf1-bhp10516478</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP874843HUc7-SDS.jpg?v=1772280413</image:loc>
      <image:title>Recombinant Human YTH domain-containing family protein 1 (YTHDF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cysteine-rich-protein-2-binding-protein-kat14-bhp10516488</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-ras-gtpase-activating-like-protein-iqgap1-iqgap1-partial-bhp10516492</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP881333MO-SDS.jpg?v=1772280437</image:loc>
      <image:title>Recombinant Mouse Ras GTPase-activating-like protein IQGAP1 (Iqgap1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-protease-serine-4-tmprss4-partial-bhp10516460</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP865122HUc7-SDS.jpg?v=1772280428</image:loc>
      <image:title>Recombinant Human Transmembrane protease serine 4 (TMPRSS4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sh3-and-multiple-ankyrin-repeat-domains-protein-3-shank3-partial-bhp10516483</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP880134HU-SDS.jpg?v=1772280423</image:loc>
      <image:title>Recombinant Human SH3 and multiple ankyrin repeat domains protein 3 (SHANK3), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fibronectin-type-iii-domain-containing-protein-4-fndc4-partial-bhp10516473</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP872504HU-SDS.jpg?v=1772280429</image:loc>
      <image:title>Recombinant Human Fibronectin type III domain-containing protein 4 (FNDC4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-turtle-homolog-a-igsf9-partial-bhp10516497</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882181HUc7-SDS.jpg?v=1772280493</image:loc>
      <image:title>Recombinant Human Protein turtle homolog A (IGSF9), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transient-receptor-potential-cation-channel-subfamily-v-member-4-trpv4-partial-bhp10516489</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP881015HU-SDS.jpg?v=1772280413</image:loc>
      <image:title>Recombinant Human Transient receptor potential cation channel subfamily V member 4 (TRPV4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-golgi-associated-plant-pathogenesis-related-protein-1-glipr2-partial-bhp10516486</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP880974HU1-SDS.jpg?v=1772280491</image:loc>
      <image:title>Recombinant Human Golgi-associated plant pathogenesis-related protein 1 (GLIPR2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-neudesin-nenf-bhp10516484</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP880396MO-SDS.jpg?v=1772280495</image:loc>
      <image:title>Recombinant Mouse Neudesin (Nenf)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cyclin-dependent-kinase-12-cdk12-partial-bhp10516496</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882147HUc7-SDS.jpg?v=1772280418</image:loc>
      <image:title>Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-matrix-metalloproteinase-17-mmp17-bhp10516498</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882605MO-SDS.jpg?v=1772280421</image:loc>
      <image:title>Recombinant Mouse Matrix metalloproteinase-17 (Mmp17)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-coatomer-subunit-beta-copb1-bhp10516491</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP881306MO_A4_-SDS.jpg?v=1772280417</image:loc>
      <image:title>Recombinant Mouse Coatomer subunit beta (Copb1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lim-domain-containing-protein-1-limd1-bhp10516502</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP883381HUc7-SDS.jpg?v=1772280414</image:loc>
      <image:title>Recombinant Human LIM domain-containing protein 1 (LIMD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-three-prime-repair-exonuclease-2-trex2-bhp10516500</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882612MO-SDS.jpg?v=1772280416</image:loc>
      <image:title>Recombinant Mouse Three prime repair exonuclease 2 (Trex2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-wnt-10a-wnt10a-bhp10516508</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP884424HU-SDS.jpg?v=1772280437</image:loc>
      <image:title>Recombinant Human Protein Wnt-10a (WNT10A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-serpin-zx-bhp10516517</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP886615DOA-SDS.jpg?v=1772280428</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Serpin-ZX</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cyclin-dependent-kinase-12-cdk12-partial-bhp10516495</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882147HUb0-SDS.jpg?v=1772280429</image:loc>
      <image:title>Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lim-domain-containing-protein-1-limd1-bhp10516501</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP883381HU-SDS.jpg?v=1772280421</image:loc>
      <image:title>Recombinant Human LIM domain-containing protein 1 (LIMD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-matrix-remodeling-associated-protein-5-mxra5-partial-bhp10516512</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP885702HU-SDS.jpg?v=1772280415</image:loc>
      <image:title>Recombinant Human Matrix-remodeling-associated protein 5 (MXRA5), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sulfide-quinone-oxidoreductase-mitochondrial-sqor-bhp10516499</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882609MO_A4_-SDS.jpg?v=1772280419</image:loc>
      <image:title>Recombinant Mouse Sulfide:quinone oxidoreductase, mitochondrial (Sqor)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nadph-dependent-diflavin-oxidoreductase-1-ndor1-bhp10516503</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP883387HU-SDS.jpg?v=1772280416</image:loc>
      <image:title>Recombinant Human NADPH-dependent diflavin oxidoreductase 1 (NDOR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-membrane-spanning-4-domains-subfamily-a-member-12-ms4a12-partial-bhp10516513</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP885756HU1-SDS.jpg?v=1772280442</image:loc>
      <image:title>Recombinant Human Membrane-spanning 4-domains subfamily A member 12 (MS4A12), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-mis18-alpha-mis18a-bhp10516514</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP885766HU-SDS.jpg?v=1772280415</image:loc>
      <image:title>Recombinant Human Protein Mis18-alpha (MIS18A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-elongator-complex-protein-3-elp3-bhp10516510</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP884499HU-SDS.jpg?v=1772280479</image:loc>
      <image:title>Recombinant Human Elongator complex protein 3 (ELP3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mini-chromosome-maintenance-complex-binding-protein-mcmbp-bhp10516482</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP880100HU-SDS.jpg?v=1772280482</image:loc>
      <image:title>Recombinant Human Mini-chromosome maintenance complex-binding protein (MCMBP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-voltage-dependent-t-type-calcium-channel-subunit-alpha-1i-cacna1i-partial-bhp10516515</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP885788HU-SDS.jpg?v=1772280414</image:loc>
      <image:title>Recombinant Human Voltage-dependent T-type calcium channel subunit alpha-1I (CACNA1I), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-containing-g-protein-coupled-receptor-4-lgr4-partial-bhp10516504</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP883618HU-SDS.jpg?v=1772280415</image:loc>
      <image:title>Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 4 (LGR4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-gastrokine-1-gkn1-bhp10516507</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-acyl-coenzyme-a-thioesterase-2-mitochondrial-acot2-bhp10516516</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP886188MO-SDS.jpg?v=1772280416</image:loc>
      <image:title>Recombinant Mouse Acyl-coenzyme A thioesterase 2, mitochondrial (Acot2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tsc22-domain-family-protein-4-tsc22d4-bhp10516525</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neuronal-acetylcholine-receptor-subunit-alpha-9-chrna9-partial-biotinylated-bhp10516518</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887022HU-B-SDS.jpg?v=1772280421</image:loc>
      <image:title>Recombinant Human Neuronal acetylcholine receptor subunit alpha-9 (CHRNA9), partial, Biotinylated</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transcriptional-and-immune-response-regulator-tcim-bhp10516493</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP882079HUc7-SDS.jpg?v=1772280420</image:loc>
      <image:title>Recombinant Human Transcriptional and immune response regulator (TCIM)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-type-lectin-domain-family-7-member-a-clec7a-partial-bhp10516505</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP883623HU-SDS.jpg?v=1772280414</image:loc>
      <image:title>Recombinant Human C-type lectin domain family 7 member A (CLEC7A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-and-transmembrane-domain-containing-protein-1-lrtm1-partial-bhp10516511</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-testis-expressed-protein-101-tex101-bhp10516520</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887155HU-SDS.jpg?v=1772280415</image:loc>
      <image:title>Recombinant Human Testis-expressed protein 101(TEX101)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-complement-factor-h-related-protein-5-cfhr5-partial-bhp10516506</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-20-receptor-subunit-alpha-il20ra-partial-bhp10516519</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887035HU-SDS.jpg?v=1772280421</image:loc>
      <image:title>Recombinant Human Interleukin-20 receptor subunit alpha (IL20RA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-fam234a-fam234a-partial-bhp10516527</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887949HU-SDS.jpg?v=1772280429</image:loc>
      <image:title>Recombinant Human Protein FAM234A (FAM234A), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-lim-domain-and-actin-binding-protein-1-lima1-bhp10516526</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-nadh-cytochrome-b5-reductase-3-cyb5r3-bhp10516524</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887597MO-SDS.jpg?v=1772280420</image:loc>
      <image:title>Recombinant Mouse NADH-cytochrome b5 reductase 3 (Cyb5r3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-histamine-h4-receptor-hrh4-partial-bhp10516528</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887972HU1a0-SDS.jpg?v=1772280484</image:loc>
      <image:title>Recombinant Human Histamine H4 receptor (HRH4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-charged-multivesicular-body-protein-4b-chmp4b-bhp10516529</loc>
    <lastmod>2026-05-21T01:25:17-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP887976HUc7-SDS.jpg?v=1772280417</image:loc>
      <image:title>Recombinant Human Charged multivesicular body protein 4b (CHMP4B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
</urlset>
