<?xml version="1.0" encoding="UTF-8"?>
<urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9" xmlns:image="http://www.google.com/schemas/sitemap-image/1.1">
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-psychosine-receptor-gpr65-bhp10510484</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF810304HU-SDS.jpg?v=1778623135</image:loc>
      <image:title>Recombinant Human Psychosine receptor (GPR65)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-c-c-chemokine-receptor-type-8-ccr8-bhp10510496</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004847MOW-SDS.jpg?v=1778623136</image:loc>
      <image:title>Recombinant Macaca mulatta C-C chemokine receptor type 8 (CCR8)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-chemokine-receptor-like-2-ccrl2-bhp10510829</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004852HU-SDS.jpg?v=1778623139</image:loc>
      <image:title>Recombinant Human C-C chemokine receptor-like 2 (CCRL2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-herpesvirus-6a-g-protein-coupled-receptor-homolog-u12-u12-bhp10510466</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF345193HJZ-SDS.jpg?v=1778623133</image:loc>
      <image:title>Recombinant Human herpesvirus 6A G-protein coupled receptor homolog U12 (U12)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-p2y-purinoceptor-13-p2yr13-bhp10510487</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF872011MO-SDS.jpg?v=1778623136</image:loc>
      <image:title>Recombinant Mouse P2Y purinoceptor 13 (P2yr13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-urea-transporter-slc14a1-bhp10510824</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4165HU-SDS.jpg?v=1778623136</image:loc>
      <image:title>Recombinant Human Urea transporter (SLC14A1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-g-protein-coupled-receptor-15-gpr15-bhp10510477</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF009764HU-SDS.jpg?v=1778623134</image:loc>
      <image:title>Recombinant Human G-protein coupled receptor 15 (GPR15)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-5-hydroxytryptamine-receptor-1b-htr1b-bhp10510493</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF010882HUb0-SDS.jpg?v=1778623136</image:loc>
      <image:title>Recombinant Human 5-hydroxytryptamine receptor 1B (HTR1B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-rhce-rhce-bhp10510822</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4164HU-SDS.jpg?v=1778623137</image:loc>
      <image:title>Recombinant Human RHCE (RhCE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-mitochondrial-glutamate-carrier-2-slc25a18-bhp10510826</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF690366RA-SDS.jpg?v=1778623137</image:loc>
      <image:title>Recombinant Rat Mitochondrial glutamate carrier 2 (Slc25a18)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-solute-carrier-family-23-member-2-slc23a2-bhp10510833</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF866221HU_A4_-SDS.jpg?v=1778623137</image:loc>
      <image:title>Recombinant Human Solute carrier family 23 member 2 (SLC23A2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-protein-72-tmem72-bhp10510508</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023876HU-SDS.jpg?v=1778623136</image:loc>
      <image:title>Recombinant Human Transmembrane protein 72 (TMEM72)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chicken-atp-synthase-subunit-a-mt-atp6-bhp10510500</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF015070CH-SDS.jpg?v=1778623137</image:loc>
      <image:title>Recombinant Chicken ATP synthase subunit a (MT-ATP6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-g-protein-coupled-receptor-62-gpr62-bhp10510817</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF874856HU-SDS.jpg?v=1778623136</image:loc>
      <image:title>Recombinant Human G-protein coupled receptor 62 (GPR62)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-blood-group-rh-d-polypeptide-isoform-3-rhd-bhp10510821</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4163HU-SDS.jpg?v=1778623135</image:loc>
      <image:title>Recombinant Human Blood group Rh (D) polypeptide isoform 3 (RHD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-cannabinoid-receptor-1-cnr1-bhp10510839</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF005678RA-SDS.jpg?v=1778623136</image:loc>
      <image:title>Recombinant Rat Cannabinoid receptor 1 (CNR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytochrome-p450-3a4-cyp3a4-bhp10510820</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF006439HU-SDS.jpg?v=1778623136</image:loc>
      <image:title>Recombinant Human Cytochrome P450 3A4 (CYP3A4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-chemokine-like-receptor-1-cmklr1-bhp10510502</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF005614MO-SDS.jpg?v=1778623136</image:loc>
      <image:title>Recombinant Mouse Chemokine-like receptor 1 (Cmklr1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-chemerin-like-receptor-2-cmklr2-bhp10510842</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF009728RA-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Rat Chemerin-like receptor 2 (Cmklr2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-b-lymphocyte-antigen-cd20-ms4a1-bhp10510850</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF015007HU-SDS.jpg?v=1778623137</image:loc>
      <image:title>Recombinant Human B-lymphocyte antigen CD20 (MS4A1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atp-binding-cassette-sub-family-d-member-2-abcd2-bhp10510498</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF866202HU-SDS.jpg?v=1778623136</image:loc>
      <image:title>Recombinant Human ATP-binding cassette sub-family D member 2 (ABCD2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atp-synthase-subunit-f-mitochondrial-atp5j2-bhp10510841</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF002370HU_A4_-SDS.jpg?v=1778623137</image:loc>
      <image:title>Recombinant Human ATP synthase subunit f, mitochondrial (ATP5J2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-4-cldn4-vlps-active-bhp10510509</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005506HU-WB.jpg?v=1778623135</image:loc>
      <image:title>Recombinant Human Claudin-4 (CLDN4)-VLPs (Active)</image:title>
      <image:caption>CSB-MP661636HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-psoroptes-ovis-nadh-dehydrogenase-subunit-2-nad2-bhp10510830</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4220GRE-SDS.jpg?v=1778623137</image:loc>
      <image:title>Recombinant Psoroptes ovis NADH dehydrogenase subunit 2 (nad2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-atp-sensitive-inward-rectifier-potassium-channel-10-kcnj10-bhp10510473</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF012048RA-SDS.jpg?v=1778623136</image:loc>
      <image:title>Recombinant Rat ATP-sensitive inward rectifier potassium channel 10 (Kcnj10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-herpesvirus-2-envelope-glycoprotein-d-gd-bhp10510834</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF715099HJX-SDS.jpg?v=1778623137</image:loc>
      <image:title>Recombinant Human herpesvirus 2 Envelope glycoprotein D (gD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-b-lymphocyte-antigen-cd20-ms4a1-bhp10510855</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF661636DO-SDS.jpg?v=1778623139</image:loc>
      <image:title>Recombinant Dog B-lymphocyte antigen CD20 (MS4A1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-mitochondrial-glutamate-carrier-2-slc25a18-bhp10510827</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF861600MO-SDS.jpg?v=1778623137</image:loc>
      <image:title>Recombinant Mouse Mitochondrial glutamate carrier 2 (Slc25a18)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-1-acyl-sn-glycerol-3-phosphate-acyltransferase-delta-agpat4-bhp10510828</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF885714HU-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Human 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (AGPAT4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-capsular-polysaccharide-type-5-biosynthesis-protein-cap5a-cap5a-bhp10510835</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF310989FLG-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Staphylococcus aureus Capsular polysaccharide type 5 biosynthesis protein cap5A (cap5A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-influenza-a-virus-matrix-protein-2-m-bhp10509775</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF389902ILUb0-SDS.jpg?v=1778623134</image:loc>
      <image:title>Recombinant Influenza A virus Matrix protein 2 (M)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-herpesvirus-2-envelope-glycoprotein-c-gc-bhp10510843</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF804110HJX_A4_-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Human herpesvirus 2 Envelope glycoprotein C (gC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-solute-carrier-family-2-facilitated-glucose-transporter-member-9-slc2a9-bhp10510831</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF873638HU_A4_-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Human Solute carrier family 2, facilitated glucose transporter member 9 (SLC2A9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-small-conductance-calcium-activated-potassium-channel-protein-2-kcnn2-bhp10510825</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF012084RA-SDS.jpg?v=1778623139</image:loc>
      <image:title>Recombinant Rat Small conductance calcium-activated potassium channel protein 2 (Kcnn2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-aquaporin-4-aqp4-bhp10510491</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF001964MO-SDS.jpg?v=1778623135</image:loc>
      <image:title>Recombinant Mouse Aquaporin-4 (Aqp4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bacillus-subtilis-sensor-histidine-kinase-yccg-yccg-bhp10510506</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF302552BRJ-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Bacillus subtilis Sensor histidine kinase yccG (yccG)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-sphingosine-1-phosphate-receptor-2-s1pr2-bhp10510849</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF020651RA-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Rat Sphingosine 1-phosphate receptor 2 (S1pr2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-herpesvirus-2-envelope-glycoprotein-b-gb-bhp10510844</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF362479HJX_A4_-SDS.jpg?v=1778623137</image:loc>
      <image:title>Recombinant Human herpesvirus 2 Envelope glycoprotein B (gB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sodium-potassium-transporting-atpase-subunit-beta-1-atp1b1-bhp10510819</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF002326MO-SDS.jpg?v=1778623136</image:loc>
      <image:title>Recombinant Mouse Sodium/potassium-transporting ATPase subunit beta-1 (Atp1b1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gastric-inhibitory-polypeptide-receptor-gipr-bhp10510832</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF009438HU-SDS.jpg?v=1778623139</image:loc>
      <image:title>Recombinant Human Gastric inhibitory polypeptide receptor (GIPR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neuropeptide-y-receptor-type-2-npy2r-bhp10510846</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF016036HU-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Human Neuropeptide Y receptor type 2 (NPY2R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mumps-virus-hemagglutinin-neuraminidase-hn-bhp10510857</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF323149MJM-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Mumps virus Hemagglutinin-neuraminidase (HN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-rhodopsin-rho-bhp10510838</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF019681BO-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Bovine Rhodopsin (RHO)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-knowlesi-protein-sey1-homolog-sey1-bhp10510837</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF461166EWU_A4_-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Plasmodium knowlesi Protein SEY1 homolog (SEY1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-endogenous-retrovirus-group-k-member-7-env-polyprotein-ervk-7-bhp10510856</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF351062HU-SDS.jpg?v=1778623139</image:loc>
      <image:title>Recombinant Human Endogenous retrovirus group K member 7 Env polyprotein (ERVK-7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-capsular-polysaccharide-type-8-biosynthesis-protein-cap8a-cap8a-bhp10510840</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF301803FKZ-SDS.jpg?v=1778623139</image:loc>
      <image:title>Recombinant Staphylococcus aureus Capsular polysaccharide type 8 biosynthesis protein cap8A (cap8A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-transient-receptor-potential-cation-channel-subfamily-v-member-2-trpv2-bhp10510853</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF893416RA-SDS.jpg?v=1778623139</image:loc>
      <image:title>Recombinant Rat Transient receptor potential cation channel subfamily V member 2 (Trpv2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-porcine-reproductive-and-respiratory-syndrome-virus-envelope-small-membrane-protein-gp2b-bhp10510818</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF314480PQC-SDS.jpg?v=1778623136</image:loc>
      <image:title>Recombinant Porcine reproductive and respiratory syndrome virus Envelope small membrane protein (GP2b)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-gap-junction-delta-2-protein-gjd2-bhp10510836</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF769699BO-SDS.jpg?v=1778623137</image:loc>
      <image:title>Recombinant Bovine Gap junction delta-2 protein (GJD2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mumps-virus-hemagglutinin-neuraminidase-hn-bhp10510858</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF319233MJK-SDS.jpg?v=1778623141</image:loc>
      <image:title>Recombinant Mumps virus Hemagglutinin-neuraminidase (HN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-aquaporin-2-aqp2-bhp10510847</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF001962MO-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Mouse Aquaporin-2 (Aqp2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-chemokine-receptor-8-ccr8-bhp10510845</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF2709MOV-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Macaca fascicularis Chemokine receptor 8 (CCR8)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-somatostatin-receptor-type-2-sstr2-bhp10510859</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF022725HU-SDS.jpg?v=1778623140</image:loc>
      <image:title>Recombinant Human Somatostatin receptor type 2 (SSTR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mucolipin-1-mcoln1-bhp10510860</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF872417HU-SDS.jpg?v=1778623141</image:loc>
      <image:title>Recombinant Human Mucolipin-1 (MCOLN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-melanopsin-opn4-bhp10510854</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF851271RA-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Rat Melanopsin (Opn4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interferon-alpha-inducible-protein-27-like-protein-2a-ifi27l2a-bhp10510851</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF840289MO-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Mouse Interferon alpha-inducible protein 27-like protein 2A (Ifi27l2a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-synaptophysin-syp-bhp10511291</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023024RA-SDS.jpg?v=1778623145</image:loc>
      <image:title>Recombinant Rat Synaptophysin (Syp)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prominin-1-prom1-vlps-active-bhp10510921</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP018751HU_A4_-WB.jpg?v=1778623142</image:loc>
      <image:title>Recombinant Human Prominin-1 (PROM1)-VLPs (Active)</image:title>
      <image:caption>CSB-MP018751HU(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-apoptosis-regulator-bcl-2-bcl2-bhp10511289</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF002611RA-SDS.jpg?v=1778623142</image:loc>
      <image:title>Recombinant Rat Apoptosis regulator Bcl-2 (Bcl2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-synaptoporin-synpr-bhp10511290</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023023RA-SDS.jpg?v=1778623142</image:loc>
      <image:title>Recombinant Rat Synaptoporin (Synpr)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-synaptotagmin-1-syt1-bhp10511292</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023029RA-SDS.jpg?v=1778623145</image:loc>
      <image:title>Recombinant Rat Synaptotagmin-1 (Syt1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-newcastle-disease-virus-hemagglutinin-neuraminidase-hn-bhp10510852</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF336075NCW-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Newcastle disease virus Hemagglutinin-neuraminidase (HN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-metapneumovirus-fusion-glycoprotein-f0-f-bhp10510863</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF751041HDAMa2-SDS.jpg?v=1778623141</image:loc>
      <image:title>Recombinant Human metapneumovirus Fusion glycoprotein F0 (F)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-synaptotagmin-12-syt12-bhp10511293</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023032RA-SDS.jpg?v=1778623146</image:loc>
      <image:title>Recombinant Rat Synaptotagmin-12 (Syt12)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-aquaporin-2-aqp2-bhp10510848</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF001962RA-SDS.jpg?v=1778623138</image:loc>
      <image:title>Recombinant Rat Aquaporin-2 (Aqp2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-kita-kyushu-lung-cancer-antigen-1-ct83-vlps-bhp10510927</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP711093HU-WB.jpg?v=1778623142</image:loc>
      <image:title>Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83)-VLPs</image:title>
      <image:caption>CSB-MP711093HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tyrosinase-tyr-bhp10511296</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF025394MO-SDS.jpg?v=1778623143</image:loc>
      <image:title>Recombinant Mouse Tyrosinase (Tyr)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-protein-158-tmem158-bhp10511295</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023732HU-SDS.jpg?v=1778623145</image:loc>
      <image:title>Recombinant Human Transmembrane protein 158 (TMEM158)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hepatitis-b-virus-genotype-a2-subtype-adw2-large-envelope-protein-s-bhp10511297</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF323489HDO-SDS.jpg?v=1778623143</image:loc>
      <image:title>Recombinant Hepatitis B virus genotype A2 subtype adw2 Large envelope protein (S)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptomyces-coelicolor-ph-gated-potassium-channel-kcsa-kcsa-bhp10511298</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF358316FOB-SDS.jpg?v=1778623147</image:loc>
      <image:title>Recombinant Streptomyces coelicolor pH-gated potassium channel KcsA (kcsA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pendrin-slc26a4-h723r-bhp10510861</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF021527HU_A4_M_-SDS.jpg?v=1778623140</image:loc>
      <image:title>Recombinant Human Pendrin (SLC26A4) (H723R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-synaptotagmin-2-syt2-bhp10511294</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023038RA-SDS.jpg?v=1778623144</image:loc>
      <image:title>Recombinant Rat Synaptotagmin-2 (Syt2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-larimichthys-crocea-odorant-receptor-bhp10511300</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4478GSC-SDS.jpg?v=1778623143</image:loc>
      <image:title>Recombinant Larimichthys crocea Odorant receptor</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-coxiella-burnetii-hypothetical-membrane-spanning-protein-cbu-1863-bhp10511301</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4560DXP-SDS.jpg?v=1778623145</image:loc>
      <image:title>Recombinant Coxiella burnetii Hypothetical membrane spanning protein (CBU_1863)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mitochondrial-thiamine-pyrophosphate-carrier-slc25a19-bhp10511307</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF864025HU-SDS.jpg?v=1778623147</image:loc>
      <image:title>Recombinant Human Mitochondrial thiamine pyrophosphate carrier (SLC25A19)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-umor-necrosis-factor-receptor-superfamily-member-16-ngfr-biotinylated-vlps-bhp10511845</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sucrase-isomaltase-intestinal-si-partial-bhp10510862</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF021285HU_A5_-SDS.jpg?v=1778623141</image:loc>
      <image:title>Recombinant Human Sucrase-isomaltase, intestinal (SI), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pendrin-slc26a4-vlps-bhp10511848</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alpha-2a-adrenergic-receptor-adra2a-vlps-bhp10511839</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-synaptogyrin-1-syngr1-bhp10511304</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF730813RA-SDS.jpg?v=1778623146</image:loc>
      <image:title>Recombinant Rat Synaptogyrin-1 (Syngr1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-papillomavirus-type-16-probable-protein-e5-e5-bhp10511486</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF361986HMLg8-SDS.jpg?v=1778623145</image:loc>
      <image:title>Recombinant Human papillomavirus type 16 Probable protein E5 (E5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-glycine-max-oleosin-bhp10511890</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4775GGV-SDS.jpg?v=1778623145</image:loc>
      <image:title>Recombinant Glycine max Oleosin</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-3-cldn3-vlps-active-bhp10511490</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005505HU-WB.jpg?v=1778623144</image:loc>
      <image:title>Recombinant Human Claudin-3 (CLDN3)-VLPs (Active)</image:title>
      <image:caption>CSB-MP005505HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-6-cldn6-fluorescent-vlps-active-bhp10511818</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-histamine-h3-receptor-hrh3-vlps-bhp10511855</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hepatitis-b-virus-genotype-a2-subtype-adw2-large-envelope-protein-s-bhp10511299</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF365859HDP-SDS.jpg?v=1778623143</image:loc>
      <image:title>Recombinant Hepatitis B virus genotype A2 subtype adw2 Large envelope protein (S)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-varicella-zoster-virus-envelope-glycoprotein-e-ge-bhp10511309</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF872802VAQ-SDS.jpg?v=1778623142</image:loc>
      <image:title>Recombinant Varicella-zoster virus Envelope glycoprotein E (gE)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-voltage-dependent-calcium-channel-gamma-1-subunit-cacng1-bhp10511487</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004415MO-SDS.jpg?v=1778623143</image:loc>
      <image:title>Recombinant Mouse Voltage-dependent calcium channel gamma-1 subunit (Cacng1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-18-2-cldn18-2-fluorescent-vlps-active-bhp10511840</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-vasopressin-v1b-receptor-avpr1b-bhp10511883</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF002469HU_A4_-SDS.jpg?v=1778623148</image:loc>
      <image:title>Recombinant Human Vasopressin V1b receptor (AVPR1B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-membrane-spanning-4-domains-a1-ms4a1-vlps-active-bhp10511492</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP4516MOV-WB.jpg?v=1778623149</image:loc>
      <image:title>Recombinant Macaca fascicularis Membrane spanning 4-domains A1 (MS4A1)-VLPs (Active)</image:title>
      <image:caption>CSB-MP4516MOV is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prostatic-acid-phosphatase-acp3-vlps-bhp10511811</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-acinetobacter-baumannii-efflux-pump-membrane-transporter-hmpref0010-00594-bhp10511892</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4780GTJ-SDS.jpg?v=1778623147</image:loc>
      <image:title>Recombinant Acinetobacter baumannii Efflux pump membrane transporter (HMPREF0010_00594)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-dihydroorotate-dehydrogenase-quinone-mitochondrial-dhodh-bhp10511488</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF714357RA-SDS.jpg?v=1778623144</image:loc>
      <image:title>Recombinant Rat Dihydroorotate dehydrogenase (quinone), mitochondrial(Dhodh)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-melanocyte-stimulating-hormone-receptor-mc1r-vlps-bhp10511844</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-er-lumen-protein-retaining-receptor-2-kdelr2-bhp10511893</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF875116MO-SDS.jpg?v=1778623145</image:loc>
      <image:title>Recombinant Mouse ER lumen protein retaining receptor 2 (Kdelr2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hepatitis-b-virus-genotype-d-subtype-ayw-large-envelope-protein-s-bhp10511894</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF365858HEM-SDS.jpg?v=1778623148</image:loc>
      <image:title>Recombinant Hepatitis B virus genotype D subtype ayw Large envelope protein (S)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-secretory-carrier-associated-membrane-protein-4-scamp4-bhp10511308</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF864359MO-SDS.jpg?v=1778623144</image:loc>
      <image:title>Recombinant Mouse Secretory carrier-associated membrane protein 4 (Scamp4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-microcin-h47-mchb-bhp10512079</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF351165ENL-SDS.jpg?v=1778623148</image:loc>
      <image:title>Recombinant Escherichia coli Microcin H47 (mchB)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lysocardiolipin-acyltransferase-1-lclat1-bhp10512078</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF012807HU-SDS.jpg?v=1778623149</image:loc>
      <image:title>Recombinant Human Lysocardiolipin acyltransferase 1 (LCLAT1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-taste-receptor-type-2-member-13-tas2r13-bhp10511891</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF889153HU-SDS.jpg?v=1778623145</image:loc>
      <image:title>Recombinant Human Taste receptor type 2 member 13 (TAS2R13)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-zea-mays-o-acyltransferase-dgat1-2-bhp10512085</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4808ZAX-SDS.jpg?v=1778623149</image:loc>
      <image:title>Recombinant Zea mays O-acyltransferase (DGAT1-2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-eva-1-homolog-b-eva1b-bhp10512173</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF882115HU-SDS.jpg?v=1778623150</image:loc>
      <image:title>Recombinant Human Protein eva-1 homolog B (EVA1B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mas-related-g-protein-coupled-receptor-member-x2-mrgprx2-bhp10511306</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF839361HUa0-SDS.jpg?v=1778623146</image:loc>
      <image:title>Recombinant Human Mas-related G-protein coupled receptor member X2 (MRGPRX2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transient-receptor-potential-cation-channel-subfamily-v-member-3-trpv3-bhp10511896</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF854113HU-SDS.jpg?v=1778623146</image:loc>
      <image:title>Recombinant Human Transient receptor potential cation channel subfamily V member 3 (TRPV3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-amfr-amfr-bhp10512086</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF892337HU-SDS.jpg?v=1778623148</image:loc>
      <image:title>Recombinant Human E3 ubiquitin-protein ligase AMFR (AMFR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-parainfluenza-1-virus-hemagglutinin-neuraminidase-hn-bhp10512172</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF323673HOY-SDS.jpg?v=1778623151</image:loc>
      <image:title>Recombinant Human parainfluenza 1 virus Hemagglutinin-neuraminidase (HN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tropaeolum-majus-o-acyltransferase-s197a-bhp10511889</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4730TIU_M_-SDS.jpg?v=1778623149</image:loc>
      <image:title>Recombinant Tropaeolum majus O-acyltransferase (S197A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-steap1-protein-steap1-bhp10512191</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF890691HUd7-SDS.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Human STEAP1 protein (STEAP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-delta-type-opioid-receptor-oprd1-bhp10511489</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF016358HU-SDS.jpg?v=1778623144</image:loc>
      <image:title>Recombinant Human Delta-type opioid receptor (OPRD1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-coxiella-burnetii-hypothetical-membrane-spanning-protein-cbu-1863-l589a-l590a-bhp10511885</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4560DXP_M_e0-SDS.jpg?v=1778623146</image:loc>
      <image:title>Recombinant Coxiella burnetii Hypothetical membrane spanning protein (CBU_1863) (L589A,L590A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dictyostelium-discoideum-putative-zdhhc-type-palmitoyltransferase-8-ddb-g0280329-bhp10512081</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF706883DKK-SDS.jpg?v=1778623149</image:loc>
      <image:title>Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 8 (DDB_G0280329)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-histamine-h3-receptor-hrh3-fluorescent-vlps-bhp10511856</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-sesamum-indicum-oleosin-l-bhp10512087</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4861SYP-SDS.jpg?v=1778623146</image:loc>
      <image:title>Recombinant Sesamum indicum Oleosin L</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-g-protein-activated-inward-rectifier-potassium-channel-1-kcnj3-f137s-bhp10512412</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF012056HU_M_-SDS.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Human G protein-activated inward rectifier potassium channel 1 (KCNJ3) (F137S)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-coxiella-burnetii-hypothetical-membrane-spanning-protein-cbu-1863-l589a-l590a-bhp10511884</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4560DXP_M_-SDS.jpg?v=1778623149</image:loc>
      <image:title>Recombinant Coxiella burnetii Hypothetical membrane spanning protein (CBU_1863) (L589A,L590A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-e3-ubiquitin-protein-ligase-march5-marchf5-bhp10512174</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF664660MO-SDS.jpg?v=1778623157</image:loc>
      <image:title>Recombinant Mouse E3 ubiquitin-protein ligase MARCH5 (Marchf5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-taste-receptor-type-1-member-2-tas1r2-bhp10512169</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF840577HU_A4_-SDS.jpg?v=1778623154</image:loc>
      <image:title>Recombinant Human Taste receptor type 1 member 2 (TAS1R2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-claudin-5-cldn5-bhp10512177</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF867513RA-SDS.jpg?v=1778623218</image:loc>
      <image:title>Recombinant Rat Claudin-5 (Cldn5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-gap-junction-alpha-1-protein-gja1-bhp10512170</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF009443BO-SDS.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Bovine Gap junction alpha-1 protein (GJA1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-frizzled-3-fzd3-bhp10511895</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF882067HU-SDS.jpg?v=1778623146</image:loc>
      <image:title>Recombinant Human Frizzled-3 (FZD3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-4-l6-family-member-1-tm4sf1-vlps-active-bhp10512397</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023615HU-WB.jpg?v=1778623150</image:loc>
      <image:title>Recombinant Human Transmembrane 4 L6 family member 1 (TM4SF1)-VLPs (Active)</image:title>
      <image:caption>CSB-MP023615HU is detected by Mouse anti-6*His monoclonal antibody.The two bands respectively correspond to monomer, Homodimer.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-g-protein-coupled-bile-acid-receptor-1-gpbar1-bhp10512408</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF819471HU-SDS.jpg?v=1778623149</image:loc>
      <image:title>Recombinant Human G-protein coupled bile acid receptor 1 (GPBAR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-l-gulonolactone-oxidase-gulo-bhp10512082</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF320800RA-SDS.jpg?v=1778623149</image:loc>
      <image:title>Recombinant Rat L-gulonolactone oxidase (Gulo)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-steap1-protein-steap1-bhp10512192</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF861476MO-SDS.jpg?v=1778623157</image:loc>
      <image:title>Recombinant Mouse STEAP1 protein (Steap1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-chemerin-like-receptor-1-cmklr1-bhp10512193</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF005614HUd7-SDS.jpg?v=1778623227</image:loc>
      <image:title>Recombinant Human Chemerin-like receptor 1 (CMKLR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glucagon-like-peptide-2-receptor-glp2r-bhp10512187</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF009515HU-SDS.jpg?v=1778623154</image:loc>
      <image:title>Recombinant Human Glucagon-like peptide 2 receptor (GLP2R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-chemokine-receptor-type-6-ccr6-vlps-active-bhp10512396</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004845HU-WB.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Human C-C chemokine receptor type 6 (CCR6)-VLPs (Active)</image:title>
      <image:caption>CSB-MP004845HU is detected by Mouse anti-6*His monoclonal antibody. The two bands respectively correspond to monomer, Homodimer.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-steap-family-member-1-steap1-bhp10512188</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4938RA-SDS.jpg?v=1778623153</image:loc>
      <image:title>Recombinant Rat STEAP family member 1 (Steap1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-olfactory-receptor-52d1-or52d1-bhp10512411</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF887970HU-SDS.jpg?v=1778623153</image:loc>
      <image:title>Recombinant Human Olfactory receptor 52D1 (OR52D1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-e3-ubiquitin-protein-ligase-march5-marchf5-bhp10512175</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF664660MOa0-SDS.jpg?v=1778623162</image:loc>
      <image:title>Recombinant Mouse E3 ubiquitin-protein ligase MARCH5 (Marchf5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-caax-prenyl-protease-2-rce1-bhp10512406</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF896686HU-SDS.jpg?v=1778623150</image:loc>
      <image:title>Recombinant Human CAAX prenyl protease 2 (RCE1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-transmembrane-4-l6-family-member-1-tm4sf1-vlps-active-bhp10512400</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5031MOV-WB.jpg?v=1778623151</image:loc>
      <image:title>Recombinant Macaca fascicularis Transmembrane 4 L6 family member 1 (TM4SF1)-VLPs (Active)</image:title>
      <image:caption>CSB-MP5031MOV is detected by Mouse anti-6*His monoclonal antibody.The two bands respectively correspond to monomer, Homodimer.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-vaccinia-virus-b5r-b5r-bhp10512176</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4914GKL-SDS.jpg?v=1778623227</image:loc>
      <image:title>Recombinant Vaccinia virus B5R (B5R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-11-cldn11-bhp10512083</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF005492HU-SDS.jpg?v=1778623149</image:loc>
      <image:title>Recombinant Human Claudin-11 (CLDN11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-tropaeolum-majus-o-acyltransferase-bhp10512084</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4730TIU-SDS.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Tropaeolum majus O-acyltransferase</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-type-2-angiotensin-ii-receptor-agtr2-vlps-bhp10512388</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001466HU_A4_-WB.jpg?v=1778623221</image:loc>
      <image:title>Recombinant Human Type-2 angiotensin II receptor (AGTR2)-VLPs</image:title>
      <image:caption>CSB-MP001466HU(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-formyl-peptide-receptor-2-fpr2-bhp10512405</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF008855MO-SDS.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Mouse Formyl peptide receptor 2 (Fpr2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-potassium-voltage-gated-channel-subfamily-kqt-member-1-kcnq1-bhp10512413</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF012087HU-SDS.jpg?v=1778623149</image:loc>
      <image:title>Recombinant Human Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-taste-receptor-type-1-member-2-tas1r2-partial-bhp10512168</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF840577HU1-SDS.jpg?v=1778623147</image:loc>
      <image:title>Recombinant Human Taste receptor type 1 member 2 (TAS1R2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-wolframin-wfs1-bhp10512404</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF026100HU_A4_-SDS.jpg?v=1778623154</image:loc>
      <image:title>Recombinant Human Wolframin (WFS1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-parainfluenza-3-virus-hemagglutinin-neuraminidase-hn-bhp10512171</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF362443HPI-SDS.jpg?v=1778623150</image:loc>
      <image:title>Recombinant Human parainfluenza 3 virus Hemagglutinin-neuraminidase (HN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-metalloreductase-steap2-steap2-bhp10512194</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF854119HUb0-SDS.jpg?v=1778623153</image:loc>
      <image:title>Recombinant Human Metalloreductase STEAP2 (STEAP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-desmocollin-3-dsc3-bhp10512088</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF007191MO-SDS.jpg?v=1778623149</image:loc>
      <image:title>Recombinant Mouse Desmocollin-3 (Dsc3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-outer-membrane-protein-tolc-tolc-bhp10512416</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF355904ENV-SDS.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Escherichia coli Outer membrane protein tolC (tolC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mitofusin-2-mfn2-bhp10512080</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF013756HU-SDS.jpg?v=1778623148</image:loc>
      <image:title>Recombinant Human Mitofusin-2 (MFN2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-synaptophysin-syp-bhp10512415</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023024HU-SDS.jpg?v=1778623150</image:loc>
      <image:title>Recombinant Human Synaptophysin (SYP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-measles-virus-hemagglutinin-glycoprotein-h-bhp10511898</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF334056MCR-SDS.jpg?v=1778623149</image:loc>
      <image:title>Recombinant Measles virus Hemagglutinin glycoprotein (H)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-1-cldn1-vlps-active-bhp10512445</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005490HU-WB.jpg?v=1778623153</image:loc>
      <image:title>Recombinant Human Claudin-1 (CLDN1)-VLPs (Active)</image:title>
      <image:caption>CSB-MP005490HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-vaccinia-virus-b5r-b5r-bhp10512189</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF4914GKLb0-SDS.jpg?v=1778623224</image:loc>
      <image:title>Recombinant Vaccinia virus B5R (B5R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cavia-porcellus-potassium-voltage-gated-channel-subfamily-kqt-member-1-kcnq1-bhp10512414</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF012087GU-SDS.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Cavia porcellus Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-protein-hapless-2-hap2-vlps-bhp10512426</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP518991DOA_A4_-WB.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Protein HAPLESS 2 (HAP2)-VLPs</image:title>
      <image:caption>CSB-MP518991DOA(A4)is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-1-cldn1-bhp10511899</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF005490HU-SDS.jpg?v=1778623149</image:loc>
      <image:title>Recombinant Human Claudin-1 (CLDN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-large-neutral-amino-acids-transporter-small-subunit-1-slc7a5-vlps-bhp10512440</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021717HU_A4_-WB.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Human Large neutral amino acids transporter small subunit 1 (SLC7A5)-VLPs</image:title>
      <image:caption>CSB-MP021717HU(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-atp-synthase-subunit-c-lysine-n-methyltransferase-atpsckmt-bhp10512417</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF863495MO-SDS.jpg?v=1778623151</image:loc>
      <image:title>Recombinant Mouse ATP synthase subunit C lysine N-methyltransferase (Atpsckmt)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-type-2-angiotensin-ii-receptor-agtr2-bhp10512418</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF001466HU_A4_-SDS.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Human Type-2 angiotensin II receptor (AGTR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-slp-adapter-and-csk-interacting-membrane-protein-scimp-bhp10512183</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF754405HU-SDS.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Human SLP adapter and CSK-interacting membrane protein (SCIMP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-arylacetamide-deacetylase-aadac-bhp10512588</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF001014HU_A4_-SDS.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Human Arylacetamide deacetylase (AADAC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-b-lymphocyte-antigen-cd20-ms4a1-vlps-bhp10512444</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015007MO-WB.jpg?v=1778623154</image:loc>
      <image:title>Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1)-VLPs</image:title>
      <image:caption>CSB-MP015007MO is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-membrane-spanning-4-domains-a1-ms4a1-vlps-bhp10512443</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5193RA-WB.jpg?v=1778623150</image:loc>
      <image:title>Recombinant Rat Membrane spanning 4-domains A1 (Ms4a1)-VLPs</image:title>
      <image:caption>CSB-MP5193RA is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-potassium-voltage-gated-channel-subfamily-kqt-member-1-kcnq1-bhp10512589</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF871323PI-SDS.jpg?v=1778623221</image:loc>
      <image:title>Recombinant Pig Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atp-synthase-subunit-c-lysine-n-methyltransferase-atpsckmt-bhp10512584</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF761288HU-SDS.jpg?v=1778623157</image:loc>
      <image:title>Recombinant Human ATP synthase subunit C lysine N-methyltransferase (ATPSCKMT)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hla-drb1-and-hla-dra-heterodimer-protein-vlps-bhp10512421</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5177HU-WB.jpg?v=1778623155</image:loc>
      <image:title>Recombinant Human HLA-DRB1&amp;HLA-DRA Heterodimer Protein-VLPs</image:title>
      <image:caption>CSB-MP5177HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transient-receptor-potential-cation-channel-subfamily-m-member-8-trpm8-partial-vlps-bhp10512620</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP768757HU1-WB.jpg?v=1778623157</image:loc>
      <image:title>Recombinant Human Transient receptor potential cation channel subfamily M member 8 (TRPM8), partial-VLPs</image:title>
      <image:caption>CSB-MP768757HU1 is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-chemokine-receptor-8-ccr8-vlps-bhp10512622</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP2709MOV-WB.jpg?v=1778623155</image:loc>
      <image:title>Recombinant Macaca fascicularis Chemokine receptor 8 (CCR8)-VLPs</image:title>
      <image:caption>CSB-MP2709MOV is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-crimean-congo-hemorrhagic-fever-virus-envelopment-polyprotein-gp-partial-vlps-bhp10512597</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP810349CSC-WB.jpg?v=1778623154</image:loc>
      <image:title>Recombinant Crimean-Congo hemorrhagic fever virus Envelopment polyprotein (GP), partial-VLPs</image:title>
      <image:caption>CSB-MP810349CSC is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-membrane-protein-mlc1-mlc1-vlps-bhp10512594</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP613581HU_A5_-WB.jpg?v=1778623165</image:loc>
      <image:title>Recombinant Human Membrane protein MLC1 (MLC1)-VLPs</image:title>
      <image:caption>CSB-MP613581HU(A5) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-acyl-coa-6-desaturase-fads2-bhp10512939</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF007960HU_A4_-SDS.jpg?v=1778623153</image:loc>
      <image:title>Recombinant Human Acyl-CoA 6-desaturase (FADS2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-g-protein-coupled-receptor-87-gpr87-bhp10512182</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF871608HUm3-SDS.jpg?v=1778623150</image:loc>
      <image:title>Recombinant Human G-protein coupled receptor 87 (GPR87)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-apoptosis-regulator-bax-bax-bhp10512611</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF002573HU_A4_-SDS.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Human Apoptosis regulator BAX (BAX)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-uroplakin-1b-upk1b-bhp10512586</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF681944RA-SDS.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Rat Uroplakin-1b (Upk1b)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-c-c-chemokine-receptor-type-8-ccr8-vlps-bhp10512621</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004847MOW-WB.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Macaca mulatta C-C chemokine receptor type 8 (CCR8)-VLPs</image:title>
      <image:caption>CSB-MP004847MOW is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-parathyroid-hormone-parathyroid-hormone-related-peptide-receptor-pth1r-bhp10512612</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF630854BO-SDS.jpg?v=1778623158</image:loc>
      <image:title>Recombinant Bovine Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-parathyroid-hormone-parathyroid-hormone-related-peptide-receptor-pth1r-bhp10512935</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF018988RA-SDS.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Rat Parathyroid hormone/parathyroid hormone-related peptide receptor (Pth1r)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cannabinoid-receptor-2-cnr2-bhp10512614</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF005679MO-SDS.jpg?v=1778623170</image:loc>
      <image:title>Recombinant Mouse Cannabinoid receptor 2 (Cnr2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-aquaporin-7-aqp7-bhp10512585</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF001967HU-SDS.jpg?v=1778623157</image:loc>
      <image:title>Recombinant Human Aquaporin-7 (AQP7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-orientia-tsutsugamushi-56-kda-type-specific-antigen-bhp10512407</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF327749OCJb0-SDS.jpg?v=1778623150</image:loc>
      <image:title>Recombinant Orientia tsutsugamushi 56 kDa type-specific antigen</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rabbit-potassium-voltage-gated-channel-subfamily-kqt-member-1-kcnq1-x15w-bhp10512609</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF863068RB_M_-SDS.jpg?v=1778623154</image:loc>
      <image:title>Recombinant Rabbit Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1) (X15W)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gasdermin-d-gsdmd-bhp10512864</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009956HUc7-SDS.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Human Gasdermin-D (GSDMD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-myelin-oligodendrocyte-glycoprotein-mog-fluorescent-vlps-bhp10512854</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP619083HU_A4_-WB.jpg?v=1778623157</image:loc>
      <image:title>Recombinant Human Myelin-oligodendrocyte glycoprotein (MOG), Fluorescent-VLPs</image:title>
      <image:caption>CSB-MP619083HU(A4)is detected by Mouse anti-GFP monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-orientia-tsutsugamushi-56-kda-type-specific-antigen-bhp10512941</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF327749OCJc7-SDS.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Orientia tsutsugamushi 56 KDA type-specific antigen</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-parathyroid-hormone-parathyroid-hormone-related-peptide-receptor-pth1r-bhp10512936</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF018988MO-SDS.jpg?v=1778623155</image:loc>
      <image:title>Recombinant Mouse Parathyroid hormone/parathyroid hormone-related peptide receptor (Pth1r)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-4-cldn4-bhp10512409</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF005506HU-SDS.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Human Claudin-4 (CLDN4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-chemokine-receptor-type-9-ccr9-vlps-active-bhp10512167</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sarcoplasmic-endoplasmic-reticulum-calcium-atpase-1-atp2a1-partial-bhp10512934</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF002332HU1-SDS.jpg?v=1778623154</image:loc>
      <image:title>Recombinant Human Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-very-long-chain-enoyl-coa-reductase-tecr-bhp10512610</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF865186HU-SDS.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Human Very-long-chain enoyl-CoA reductase (TECR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-lens-fiber-major-intrinsic-protein-mip-bhp10512950</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF013834HU-SDS.jpg?v=1778623152</image:loc>
      <image:title>Recombinant Human Lens fiber major intrinsic protein (MIP)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-chemokine-receptor-type-5-ccr5-vlps-active-bhp10513019</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004844HU-WB.jpg?v=1778623161</image:loc>
      <image:title>Recombinant Human C-C chemokine receptor type 5 (CCR5)-VLPs (Active)</image:title>
      <image:caption>CSB-MP004844HU is detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hepatitis-b-virus-genotype-d-subtype-ayw-large-envelope-protein-s-bhp10512587</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF724165HEN-SDS.jpg?v=1778623154</image:loc>
      <image:title>Recombinant Hepatitis B virus genotype D subtype ayw Large envelope protein (S)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cynomolgus-monkey-potassium-voltage-gated-channel-subfamily-kqt-member-1-kcnq1-bhp10512590</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF5299MOV-SDS.jpg?v=1778623234</image:loc>
      <image:title>Recombinant Cynomolgus monkey Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-melanocyte-stimulating-hormone-receptor-mc1r-vlps-bhp10513026</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP086369HU-WB.jpg?v=1778623161</image:loc>
      <image:title>Recombinant Human Melanocyte-stimulating hormone receptor (MC1R)-VLPs</image:title>
      <image:caption>CSB-MP086369HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-aquaporin-2-aqp2-bhp10512949</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF001962HU-SDS.jpg?v=1778623153</image:loc>
      <image:title>Recombinant Human Aquaporin-2 (AQP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-g-protein-coupled-receptor-182-gpr182-bhp10513036</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF009791HU-SDS.jpg?v=1778623155</image:loc>
      <image:title>Recombinant Human G-protein coupled receptor 182 (GPR182)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-beta-3-adrenergic-receptor-adrb3-bhp10512937</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF001393HU-SDS.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Human Beta-3 adrenergic receptor (ADRB3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-monocarboxylate-transporter-6-slc16a5-vlps-bhp10513030</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021412HU_A4_-WB.jpg?v=1778623162</image:loc>
      <image:title>Recombinant Human Monocarboxylate transporter 6 (SLC16A5)-VLPs</image:title>
      <image:caption>CSB-MP021412HU(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-polypeptide-n-acetylgalactosaminyltransferase-3-galnt3-bhp10512951</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF009210MO-SDS.jpg?v=1778623155</image:loc>
      <image:title>Recombinant Mouse Polypeptide N-acetylgalactosaminyltransferase 3 (Galnt3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-9-superfamily-member-1-tm9sf1-vlps-bhp10513031</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP023626HU_A4_-WB.jpg?v=1778623157</image:loc>
      <image:title>Recombinant Human Transmembrane 9 superfamily member 1 (TM9SF1)-VLPs</image:title>
      <image:caption>CSB-MP023626HU(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-membrane-spanning-4-domains-subfamily-a-member-4a-ms4a4a-bhp10513038</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF822238HU-SDS.jpg?v=1778623162</image:loc>
      <image:title>Recombinant Human Membrane-spanning 4-domains subfamily A member 4A (MS4A4A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-beta-2-adrenergic-receptor-adrb2-g16r-e27q-vlps-bhp10513029</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001392HU_M_-WB.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Human Beta-2 adrenergic receptor (ADRB2) (G16R,E27Q)-VLPs</image:title>
      <image:caption>CSB-MP001392HU(M) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-beta-1-adrenergic-receptor-adrb1-vlps-bhp10513028</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001391HU_A4_-WB.jpg?v=1778623155</image:loc>
      <image:title>Recombinant Human Beta-1 adrenergic receptor (ADRB1)-VLPs</image:title>
      <image:caption>CSB-MP001391HU(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-succinate-receptor-1-sucnr1-bhp10512940</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF022921HU-SDS.jpg?v=1778623154</image:loc>
      <image:title>Recombinant Human Succinate receptor 1 (SUCNR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-follicle-stimulating-hormone-receptor-fshr-bhp10512952</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF009021RAm8-SDS.jpg?v=1778623156</image:loc>
      <image:title>Recombinant Rat Follicle-stimulating hormone receptor (Fshr)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-birmingham-incp-alpha-plasmid-upf32-8-protein-upf32-8-bhp10512938</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF5405GVK_A4_-SDS.jpg?v=1778623153</image:loc>
      <image:title>Recombinant Birmingham IncP-alpha plasmid Upf32.8 protein (upf32.8)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-parathyroid-hormone-parathyroid-hormone-related-peptide-receptor-pth1r-bhp10512613</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF018988PI-SDS.jpg?v=1778623153</image:loc>
      <image:title>Recombinant Pig Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-thyrotropin-receptor-tshr-bhp10513035</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF025131RA-SDS.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Rat Thyrotropin receptor (Tshr)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-b-lymphocyte-antigen-cd20-ms4a1-detergent-active-bhp10513346</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP015007HU-D-SDS.jpg?v=1778623231</image:loc>
      <image:title>Recombinant Human B-lymphocyte antigen CD20 (MS4A1)-Detergent (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-ferrichrome-iron-receptor-fhua-partial-bhp10513582</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP362005ENV-SDS_b39f125e-dd56-4a1a-88a7-9a08b330e16d.jpg?v=1778623160</image:loc>
      <image:title>Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interleukin-10-receptor-subunit-alpha-il10ra-3-6-pclv-gcvl-vlps-bhp10513441</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP621688HU_A5_M_-WB.jpg?v=1778623156</image:loc>
      <image:title>Recombinant Human Interleukin-10 receptor subunit alpha (IL10RA) (3-6: PCLV→GCVL)-VLPs</image:title>
      <image:caption>CSB-MP621688HU(A5)(M)  is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mannosyl-oligosaccharide-1-2-alpha-mannosidase-ib-man1a2-bhp10513605</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF013384HU-SDS.jpg?v=1778623158</image:loc>
      <image:title>Recombinant Human Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB (MAN1A2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-muscarinic-acetylcholine-receptor-m5-chrm5-bhp10513609</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF005385HU-SDS.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Human Muscarinic acetylcholine receptor M5 (CHRM5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-olfactory-receptor-51e2-or51e2-vlps-bhp10513018</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP861998HU-WB.jpg?v=1778623156</image:loc>
      <image:title>Recombinant Human Olfactory receptor 51E2 (OR51E2)-VLPs</image:title>
      <image:caption>CSB-MP861998HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ninjurin-1-ninj1-bhp10513601</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF856441HU-SDS.jpg?v=1778623157</image:loc>
      <image:title>Recombinant Human Ninjurin-1 (NINJ1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-protein-hapless-2-hap2-bhp10513037</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF518991DOA_A4_-SDS.jpg?v=1778623162</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Protein HAPLESS 2 (HAP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pyroglutamylated-rf-amide-peptide-receptor-qrfpr-bhp10513607</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF019139HU-SDS.jpg?v=1778623158</image:loc>
      <image:title>Recombinant Human Pyroglutamylated RF-amide peptide receptor (QRFPR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-pneumoniae-pneumolysin-ply-bhp10513502</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP800235SMP-SDS.jpg?v=1778623161</image:loc>
      <image:title>Recombinant Streptococcus pneumoniae Pneumolysin (ply)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-glucose-cotransporter-2-slc5a2-vlps-bhp10513439</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021679HU-WB.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2)-VLPs</image:title>
      <image:caption>CSB-MP021679HU is detected by Mouse anti-Flag-tagged monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-18-2-cldn18-2-detergent-active-bhp10513345</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005498HU_A5_-D-SDS.jpg?v=1778623158</image:loc>
      <image:title>Recombinant Human Claudin-18.2 (CLDN18.2)-Detergent (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-adp-atp-translocase-1-slc25a4-bhp10513603</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF021510HU-SDS.jpg?v=1778623157</image:loc>
      <image:title>Recombinant Human ADP/ATP translocase 1 (SLC25A4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-caveolin-1-cav1-bhp10513602</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004571HU_A4_-SDS.jpg?v=1778623163</image:loc>
      <image:title>Recombinant Human Caveolin-1 (CAV1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-ferrichrome-iron-receptor-fhua-partial-bhp10513583</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP362005ENVc2-SDS.jpg?v=1778623230</image:loc>
      <image:title>Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mas-related-g-protein-coupled-receptor-member-d-mrgprd-bhp10513618</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF844729HU-SDS.jpg?v=1778623163</image:loc>
      <image:title>Recombinant Human Mas-related G-protein coupled receptor member D (MRGPRD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-3-oxo-5-alpha-steroid-4-dehydrogenase-2-srd5a2-bhp10513614</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF022654HU-SDS.jpg?v=1778623238</image:loc>
      <image:title>Recombinant Human 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-frizzled-2-fzd2-bhp10513608</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF622766HU-SDS.jpg?v=1778623165</image:loc>
      <image:title>Recombinant Human Frizzled-2 (FZD2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-influenza-b-virus-matrix-protein-2-bm2-i105v-r109h-bhp10513606</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF5657GWB_M_-SDS.jpg?v=1778623157</image:loc>
      <image:title>Recombinant Influenza B virus Matrix protein 2 (BM2) (I105V,R109H)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-serine-o-palmitoleoyltransferase-porcupine-porcn-bhp10513620</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF887958HU_A4_-SDS.jpg?v=1778623160</image:loc>
      <image:title>Recombinant Human Protein-serine O-palmitoleoyltransferase porcupine (PORCN)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-plasmodium-falciparum-rhomboid-like-protease-pf3d7-0506900-bhp10513617</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF5410EWP-SDS.jpg?v=1778623158</image:loc>
      <image:title>Recombinant Plasmodium falciparum Rhomboid-like protease (PF3D7_0506900)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-er-lumen-protein-retaining-receptor-3-kdelr3-bhp10513604</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF848101MO-SDS.jpg?v=1778623157</image:loc>
      <image:title>Recombinant Mouse ER lumen protein-retaining receptor 3 (Kdelr3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-apoptosis-regulator-bax-bax-bhp10513621</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF002573HU_A4_e0-SDS.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Human Apoptosis regulator BAX (BAX)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-membrane-progestin-receptor-alpha-paqr7-bhp10513623</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF768224HU-SDS.jpg?v=1778623158</image:loc>
      <image:title>Recombinant Human Membrane progestin receptor alpha (PAQR7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-apoptosis-regulator-bax-bax-bhp10513622</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF002573HU_A4_c0-SDS.jpg?v=1778623157</image:loc>
      <image:title>Recombinant Human Apoptosis regulator BAX (BAX)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-parathyroid-hormone-parathyroid-hormone-related-peptide-receptor-pth1r-bhp10513625</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF018988MOV-SDS.jpg?v=1778623161</image:loc>
      <image:title>Recombinant Macaca fascicularis Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-activin-receptor-type-1b-acvr1b-bhp10513613</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF001258HU-SDS.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Human Activin receptor type-1B (ACVR1B)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-dependent-phosphate-transport-protein-2b-slc34a2-partial-bhp10513626</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF021581HU2-SDS.jpg?v=1778623160</image:loc>
      <image:title>Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-1-cldn1-bhp10513627</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF005490HUd7-SDS.jpg?v=1778623165</image:loc>
      <image:title>Recombinant Human Claudin-1 (CLDN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-monocarboxylate-transporter-4-slc16a3-bhp10513619</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF021410HU_A5_-SDS.jpg?v=1778623158</image:loc>
      <image:title>Recombinant Human Monocarboxylate transporter 4 (SLC16A3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-protein-bdlf2-bdlf2-bhp10513610</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF315180EEZ-SDS.jpg?v=1778623160</image:loc>
      <image:title>Recombinant Epstein-Barr virus Protein BDLF2 (BDLF2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-steap1-protein-steap1-vlps-bhp10513705</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP890691HU-WB.jpg?v=1778623163</image:loc>
      <image:title>Recombinant Human STEAP1 protein (STEAP1)-VLPs</image:title>
      <image:caption>CSB-MP890691HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tetraspanin-8-tspan8-vlps-active-bhp10513635</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP025166HU-WB.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Human Tetraspanin-8 (TSPAN8)-VLPs (Active)</image:title>
      <image:caption>CSB-MP025166HU is detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-xenopus-laevis-progestin-and-adipoq-receptor-family-member-viii-l-homeolog-paqr8-l-vlps-bhp10513403</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP4097XBE-WB.jpg?v=1778623160</image:loc>
      <image:title>Recombinant Xenopus laevis Progestin and adipoQ receptor family member VIII L homeolog (paqr8.L)-VLPs</image:title>
      <image:caption>CSB-MP4097XBE is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-gonadotropin-releasing-hormone-ii-receptor-gnrhr2-bhp10513612</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF856800MOW-SDS.jpg?v=1778623158</image:loc>
      <image:title>Recombinant Macaca mulatta Gonadotropin-releasing hormone II receptor (GNRHR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-chemokine-receptor-type-1-ccr1-bhp10513882</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004839HU-SDS.jpg?v=1778623162</image:loc>
      <image:title>Recombinant Human C-C chemokine receptor type 1 (CCR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-g-protein-coupled-receptor-20-gpr20-vlps-active-bhp10513629</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5431MOV-WB.jpg?v=1778623162</image:loc>
      <image:title>Recombinant Macaca fascicularis G-protein coupled receptor 20 (GPR20)-VLPs (Active)</image:title>
      <image:caption>CSB-MP5431MOV is detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-bcl2-adenovirus-e1b-19-kda-protein-interacting-protein-3-bnip3-bhp10513615</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF002766MOa0-SDS.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (Bnip3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-pro-neuregulin-3-membrane-bound-isoform-nrg3-bhp10513624</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF016079HU_A4_-SDS.jpg?v=1778623166</image:loc>
      <image:title>Recombinant Human Pro-neuregulin-3, membrane-bound isoform (NRG3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-voltage-dependent-calcium-channel-gamma-3-subunit-cacng3-bhp10513883</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004417HU-SDS.jpg?v=1778623161</image:loc>
      <image:title>Recombinant Human Voltage-dependent calcium channel gamma-3 subunit (CACNG3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transient-receptor-potential-cation-channel-subfamily-v-member-6-trpv6-bhp10513888</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF852782MO-SDS.jpg?v=1778623161</image:loc>
      <image:title>Recombinant Mouse Transient receptor potential cation channel subfamily V member 6 (Trpv6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-putative-palmitoyltransferase-zdhhc22-zdhhc22-bhp10513884</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF822734HU-SDS.jpg?v=1778623166</image:loc>
      <image:title>Recombinant Human Putative palmitoyltransferase ZDHHC22 (ZDHHC22)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-melanocortin-receptor-3-mc3r-bhp10513616</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF013560HU-SDS.jpg?v=1778623165</image:loc>
      <image:title>Recombinant Human Melanocortin receptor 3 (MC3R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-transient-receptor-potential-cation-channel-subfamily-v-member-6-trpv6-bhp10513887</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF870815RA-SDS.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Rat Transient receptor potential cation channel subfamily V member 6 (Trpv6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-platelet-glycoprotein-4-cd36-fluorescent-vlps-bhp10513711</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004927HU-WB.jpg?v=1778623167</image:loc>
      <image:title>Recombinant Human Platelet glycoprotein 4 (CD36), Fluorescent-VLPs</image:title>
      <image:caption>CSB-MP004927HU is detected by Mouse anti-GFP monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-sendai-virus-fusion-glycoprotein-f0-f-partial-bhp10513894</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF361388SFB2-SDS.jpg?v=1778623161</image:loc>
      <image:title>Recombinant Sendai virus Fusion glycoprotein F0 (F), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-g-protein-coupled-receptor-20-gpr20-vlps-active-bhp10513628</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP860774HU-WB.jpg?v=1778623157</image:loc>
      <image:title>Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active)</image:title>
      <image:caption>CSB-MP860774HU is detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gastrin-releasing-peptide-receptor-grpr-bhp10513897</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF009943HU_A4_-SDS.jpg?v=1778623161</image:loc>
      <image:title>Recombinant Human Gastrin-releasing peptide receptor (GRPR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cd9-antigen-cd9-bhp10513915</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004969HU-SDS.jpg?v=1778623163</image:loc>
      <image:title>Recombinant Human CD9 antigen (CD9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-aquaporin-5-aqp5-nanodisc-bhp10513898</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF001965HU-N-SDS.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Human Aquaporin-5 (AQP5)-Nanodisc</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cd9-antigen-cd9-vlps-bhp10513706</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004969MO-WB.jpg?v=1778623161</image:loc>
      <image:title>Recombinant Mouse CD9 antigen (Cd9)-VLPs</image:title>
      <image:caption>CSB-MP004969MO is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-reticulophagy-regulator-1-retreg1-bhp10513896</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF691821RA-SDS.jpg?v=1778623161</image:loc>
      <image:title>Recombinant Rat Reticulophagy regulator 1 (Retreg1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-chemokine-receptor-type-3-ccr3-bhp10513881</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004842HUl3-SDS.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Human C-C chemokine receptor type 3 (CCR3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-solute-carrier-family-10-member-1-slc10a1-vlps-bhp10513892</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6049MOWd7-WB.jpg?v=1778623161</image:loc>
      <image:title>Recombinant Macaca mulatta Solute carrier family 10 member 1 (SLC10A1)-VLPs</image:title>
      <image:caption>CSB-MP6049MOWd7 is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-x-c-chemokine-receptor-type-3-cxcr3-bhp10513900</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF006253HUd7-SDS.jpg?v=1778623160</image:loc>
      <image:title>Recombinant Human C-X-C chemokine receptor type 3 (CXCR3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-9-superfamily-member-1-tm9sf1-bhp10513611</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023626HU_A4_-SDS.jpg?v=1778623170</image:loc>
      <image:title>Recombinant Human Transmembrane 9 superfamily member 1 (TM9SF1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-metal-cation-symporter-zip14-slc39a14-bhp10513918</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF748446MO-SDS.jpg?v=1778623162</image:loc>
      <image:title>Recombinant Mouse Metal cation symporter ZIP14 (Slc39a14)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-methanobacterium-formicicum-probable-formate-transporter-fdhc-bhp10513903</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF330494MET-SDS.jpg?v=1778623162</image:loc>
      <image:title>Recombinant Methanobacterium formicicum Probable formate transporter (fdhC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-melanocortin-receptor-4-mc4r-bhp10513893</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF013561HU-SDS.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Human Melanocortin receptor 4 (MC4R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-sphingosine-1-phosphate-receptor-2-s1pr2-bhp10513917</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF020651MO-SDS.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Mouse Sphingosine 1-phosphate receptor 2 (S1pr2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-5-hydroxytryptamine-receptor-2c-htr2c-bhp10513885</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF010889MO-SDS.jpg?v=1778623159</image:loc>
      <image:title>Recombinant Mouse 5-hydroxytryptamine receptor 2C (Htr2c)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-6-cldn6-detergent-active-bhp10513923</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005508HU_A5_-D-SDS.jpg?v=1778623167</image:loc>
      <image:title>Recombinant Human Claudin-6 (CLDN6)-Detergent (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-t-cell-surface-antigen-cd2-cd2-fluorescent-vlps-bhp10514298</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004894HU_A4_f4-WB.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Human T-cell surface antigen CD2 (CD2), Fluorescent-VLPs</image:title>
      <image:caption>CSB-MP004894HU(A4)f4 is detected by Mouse anti-GFP monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-uroplakin-2-upk2-bhp10513895</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF025656HUb0-SDS.jpg?v=1778623171</image:loc>
      <image:title>Recombinant Human Uroplakin-2 (UPK2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-fmet-leu-phe-receptor-fpr1-bhp10513904</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF008854HU-SDS.jpg?v=1778623162</image:loc>
      <image:title>Recombinant Human fMet-Leu-Phe receptor (FPR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-claudin-1-cldn1-bhp10513920</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF005490RA-SDS.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Rat Claudin-1 (Cldn1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-methanobacterium-formicicum-probable-formate-transporter-fdhc-vlps-bhp10514299</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP330494MET-WB.jpg?v=1778623165</image:loc>
      <image:title>Recombinant Methanobacterium formicicum Probable formate transporter (fdhC)-VLPs</image:title>
      <image:caption>CSB-MP330494MET is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-staphylococcus-aureus-cdp-diacylglycerol-glycerol-3-phosphate-3-phosphatidyltransferase-pgsa-bhp10513907</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF017878SUL-SDS.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Staphylococcus aureus CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-respiratory-syncytial-virus-major-surface-glycoprotein-g-g-bhp10513916</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF737465BDAK-SDS.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Bovine respiratory syncytial virus Major surface glycoprotein G (G)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-thyrotropin-receptor-tshr-vlps-active-bhp10514300</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP025131HU-WB.jpg?v=1778623165</image:loc>
      <image:title>Recombinant Human Thyrotropin receptor (TSHR)-VLPs (Active)</image:title>
      <image:caption>CSB-MP025131HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transient-receptor-potential-cation-channel-subfamily-v-member-1-trpv1-partial-bhp10513905</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF822774HU1-SDS.jpg?v=1778623162</image:loc>
      <image:title>Recombinant Human Transient receptor potential cation channel subfamily V member 1 (TRPV1), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-very-long-chain-fatty-acid-elongase-5-elovl5-bhp10513902</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF882144HU-SDS.jpg?v=1778623160</image:loc>
      <image:title>Recombinant Human Very long chain fatty acid elongase 5 (ELOVL5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-chemokine-receptor-type-7-ccr7-bhp10513921</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004846HUa0-SDS.jpg?v=1778623167</image:loc>
      <image:title>Recombinant Human C-C chemokine receptor type 7 (CCR7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transient-receptor-potential-cation-channel-subfamily-v-member-6-trpv6-vlps-bhp10514310</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP861992HU-WB.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Human Transient receptor potential cation channel subfamily V member 6 (TRPV6)-VLPs</image:title>
      <image:caption>CSB-MP861992HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-secretin-receptor-sctr-bhp10513919</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF020865HU-SDS.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Human Secretin receptor (SCTR)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-n-formyl-peptide-receptor-2-fpr2-vlps-bhp10514336</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP008855HU-WB.jpg?v=1778623165</image:loc>
      <image:title>Recombinant Human N-formyl peptide receptor 2 (FPR2)-VLPs</image:title>
      <image:caption>CSB-MP008855HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-transient-receptor-potential-cation-channel-subfamily-v-member-6-trpv6-vlps-bhp10514308</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5879DO_A4_-WB.jpg?v=1778623167</image:loc>
      <image:title>Recombinant Dog Transient receptor potential cation channel subfamily V member 6 (TRPV6)-VLPs</image:title>
      <image:caption>CSB-MP5879DO(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-oryza-glumipatula-citrate-transporter-like-domain-containing-protein-bhp10513914</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF6061GYI-SDS.jpg?v=1778623163</image:loc>
      <image:title>Recombinant Oryza glumipatula Citrate transporter-like domain-containing protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-somatostatin-receptor-type-5-sstr5-vlps-bhp10514350</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022728HU-WB.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Human Somatostatin receptor type 5 (SSTR5)-VLPs</image:title>
      <image:caption>CSB-MP022728HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-sphingosine-1-phosphate-receptor-2-s1pr2-vlps-bhp10514326</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP020651RA-WB.jpg?v=1778623167</image:loc>
      <image:title>Recombinant Rat Sphingosine 1-phosphate receptor 2 (S1pr2)-VLPs</image:title>
      <image:caption>CSB-MP020651RA is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-glutamate-receptor-ionotropic-nmda-1-grin1-partial-fluorescent-vlps-bhp10514332</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009911RA2f4-WB.jpg?v=1778623166</image:loc>
      <image:title>Recombinant Rat Glutamate receptor ionotropic, NMDA 1 (Grin1), partial, Fluorescent-VLPs</image:title>
      <image:caption>CSB-MP009911RA2f4 is detected by Mouse anti-GFP monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-melanocortin-receptor-5-mc5r-bhp10513899</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF013562HU-SDS.jpg?v=1778623162</image:loc>
      <image:title>Recombinant Human Melanocortin receptor 5 (MC5R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transient-receptor-potential-cation-channel-subfamily-v-member-6-trpv6-vlps-bhp10514307</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP852782MO-WB.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Mouse Transient receptor potential cation channel subfamily V member 6 (Trpv6)-VLPs</image:title>
      <image:caption>CSB-MP852782MO is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-xenopus-laevis-paqr8-l-and-abhd2-s-heterodimer-protein-vlps-bhp10514321</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP4672XBE-WB.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Xenopus laevis paqr8.L&amp;abhd2.S Heterodimer Protein-VLPs</image:title>
      <image:caption>CSB-MP4672XBE is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-follicle-stimulating-hormone-receptor-fshr-bhp10513906</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF009021RA-SDS.jpg?v=1778623163</image:loc>
      <image:title>Recombinant Rat Follicle-stimulating hormone receptor (Fshr)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-somatostatin-receptor-type-4-sstr4-vlps-bhp10514351</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022727HU-WB.jpg?v=1778623169</image:loc>
      <image:title>Recombinant Human Somatostatin receptor type 4 (SSTR4)-VLPs</image:title>
      <image:caption>CSB-MP022727HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-somatostatin-receptor-type-3-sstr3-vlps-bhp10514352</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022726HU-WB.jpg?v=1778623168</image:loc>
      <image:title>Recombinant Human Somatostatin receptor type 3 (SSTR3)-VLPs</image:title>
      <image:caption>CSB-MP022726HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-alpha-1a-adrenergic-receptor-adra1a-bhp10513908</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF001385HU-SDS.jpg?v=1778623162</image:loc>
      <image:title>Recombinant Human Alpha-1A adrenergic receptor (ADRA1A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gap-junction-alpha-1-protein-gja1-vlps-bhp10514666</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009443HU_A4_-WB.jpg?v=1778623166</image:loc>
      <image:title>Recombinant Human Gap junction alpha-1 protein (GJA1)-VLPs</image:title>
      <image:caption>CSB-MP009443HU(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-interferon-induced-transmembrane-protein-3-ifitm3-bhp10513886</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF875121MO_A4_-SDS.jpg?v=1778623161</image:loc>
      <image:title>Recombinant Mouse Interferon-induced transmembrane protein 3 (Ifitm3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hepatic-sodium-bile-acid-cotransporter-slc10a1-vlps-bhp10514699</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP623947HU_A4_-WB.jpg?v=1778623169</image:loc>
      <image:title>Recombinant Human Hepatic sodium/bile acid cotransporter (SLC10A1)-VLPs</image:title>
      <image:caption>CSB-MP623947HU(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-transient-receptor-potential-cation-channel-subfamily-v-member-6-trpv6-vlps-bhp10514311</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP870815RA-WB.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Rat Transient receptor potential cation channel subfamily V member 6 (Trpv6)-VLPs</image:title>
      <image:caption>CSB-MP870815RA is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-solute-carrier-family-23-member-2-slc23a2-vlps-bhp10514361</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP866221HU_A4_-WB.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Human Solute carrier family 23 member 2 (SLC23A2)-VLPs</image:title>
      <image:caption>CSB-MP866221HU(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gap-junction-alpha-5-protein-gja5-vlps-bhp10514878</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009448HU-WB.jpg?v=1778623171</image:loc>
      <image:title>Recombinant Human Gap junction alpha-5 protein (GJA5)-VLPs</image:title>
      <image:caption>CSB-MP009448HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c-c-chemokine-receptor-type-8-ccr8-vlps-bhp10514364</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004847MO-WB.jpg?v=1778623165</image:loc>
      <image:title>Recombinant Mouse C-C chemokine receptor type 8 (Ccr8)-VLPs</image:title>
      <image:caption>CSB-MP004847MO is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-chlorocebus-sabaeus-claudin-cldn6-vlps-active-bhp10514624</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6148GKN-WB.jpg?v=1778623166</image:loc>
      <image:title>Recombinant Chlorocebus sabaeus Claudin (CLDN6)-VLPs (Active)</image:title>
      <image:caption>CSB-MP6148GKN is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-somatostatin-receptor-type-1-sstr1-vlps-bhp10514353</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022724HU-WB.jpg?v=1778623169</image:loc>
      <image:title>Recombinant Human Somatostatin receptor type 1 (SSTR1)-VLPs</image:title>
      <image:caption>CSB-MP022724HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neurotensin-receptor-type-1-ntsr1-bhp10514674</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF016137HU-SDS.jpg?v=1778623170</image:loc>
      <image:title>Recombinant Human Neurotensin receptor type 1 (NTSR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-urea-transporter-1-slc14a1-vlps-bhp10514339</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP615678HU_A4_-C-WB.jpg?v=1778623165</image:loc>
      <image:title>Recombinant Human Urea transporter 1 (SLC14A1)-VLPs</image:title>
      <image:caption>CSB-MP615678HU(A4)-C is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-phospholipase-a1-plda-bhp10514661</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF359231ENV_A4_-SDS.jpg?v=1778623167</image:loc>
      <image:title>Recombinant Escherichia coli Phospholipase A1 (pldA)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-voltage-dependent-calcium-channel-gamma-1-subunit-cacng1-bhp10514692</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004415HU-SDS.jpg?v=1778623169</image:loc>
      <image:title>Recombinant Human Voltage-dependent calcium channel gamma-1 subunit (CACNG1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-glutamate-receptor-ionotropic-nmda-1-grin1-f484a-t518a-r523a-w731a-partial-fluorescent-vlps-bhp10514340</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009911RA2_M_-WB.jpg?v=1778623166</image:loc>
      <image:title>Recombinant Rat Glutamate receptor ionotropic, NMDA 1 (Grin1) (F484A,T518A,R523A,W731A), partial, Fluorescent-VLPs</image:title>
      <image:caption>CSB-MP009911RA2(M) is detected by Mouse anti-GFP monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-urea-transporter-slc14a1-vlps-bhp10514357</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP4165HU-WB.jpg?v=1778623167</image:loc>
      <image:title>Recombinant Human Urea transporter (SLC14A1)-VLPs</image:title>
      <image:caption>CSB-MP4165HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-gastric-inhibitory-polypeptide-receptor-gipr-bhp10514694</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF009438MO-SDS.jpg?v=1778623172</image:loc>
      <image:title>Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-protein-213-tmem213-bhp10514626</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023807HU-SDS.jpg?v=1778623166</image:loc>
      <image:title>Recombinant Human Transmembrane protein 213 (TMEM213)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-x-c-chemokine-receptor-type-6-cxcr6-vlps-bhp10514359</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006256HU-WB.jpg?v=1778623166</image:loc>
      <image:title>Recombinant Human C-X-C chemokine receptor type 6 (CXCR6)-VLPs</image:title>
      <image:caption>CSB-MP006256HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-gustatory-receptor-for-sugar-taste-43a-gr43a-bhp10514718</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF895567DLU-SDS.jpg?v=1778623169</image:loc>
      <image:title>Recombinant Drosophila melanogaster Gustatory receptor for sugar taste 43a (Gr43a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-corticotropin-releasing-factor-receptor-2-crhr2-bhp10514697</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF623797HU-SDS.jpg?v=1778623167</image:loc>
      <image:title>Recombinant Human Corticotropin-releasing factor receptor 2 (CRHR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-spinster-homolog-3-spns3-vlps-bhp10514334</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP765056HU_A4_-WB.jpg?v=1778623165</image:loc>
      <image:title>Recombinant Human Protein spinster homolog 3 (SPNS3)-VLPs</image:title>
      <image:caption>CSB-MP765056HU(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-latent-membrane-protein-1-lmp1-vlps-bhp10514895</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-solute-carrier-family-23-member-2-slc23a2-detergent-bhp10514880</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP866221HU_A4_-D-SDS.jpg?v=1778623175</image:loc>
      <image:title>Recombinant Human Solute carrier family 23 member 2 (SLC23A2)-Detergent</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-hepatic-sodium-bile-acid-cotransporter-slc10a1-bhp10514700</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF623947HU_A4_-SDS.jpg?v=1778623170</image:loc>
      <image:title>Recombinant Human Hepatic sodium/bile acid cotransporter (SLC10A1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-g-protein-coupled-bile-acid-receptor-1-gpbar1-vlps-bhp10514707</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP773890MO-WB.jpg?v=1778623168</image:loc>
      <image:title>Recombinant Mouse G-protein coupled bile acid receptor 1 (Gpbar1)-VLPs</image:title>
      <image:caption>CSB-MP773890MO is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-parathyroid-hormone-parathyroid-hormone-related-peptide-receptor-pth1r-bhp10514716</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-membrane-spanning-4-domains-subfamily-a-member-4a-ms4a4a-vlps-bhp10515083</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-nemestrina-transient-receptor-potential-cation-channel-subfamily-v-member-6-trpv6-vlps-bhp10514309</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5880MOX_A4_-WB.jpg?v=1778623165</image:loc>
      <image:title>Recombinant Macaca nemestrina Transient receptor potential cation channel subfamily V member 6 (TRPV6)-VLPs</image:title>
      <image:caption>CSB-MP5880MOX(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-glutamate-receptor-ionotropic-nmda-1-grin1-partial-vlps-bhp10514341</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009911RA2-WB.jpg?v=1778623164</image:loc>
      <image:title>Recombinant Rat Glutamate receptor ionotropic, NMDA 1 (Grin1), partial-VLPs</image:title>
      <image:caption>CSB-MP009911RA2 is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-probable-g-protein-coupled-receptor-75-gpr75-vlps-bhp10514917</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gastric-inhibitory-polypeptide-receptor-gipr-vlps-bhp10515081</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-probable-palmitoyltransferase-zdhhc24-zdhhc24-bhp10514705</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF740919HU-SDS.jpg?v=1778623170</image:loc>
      <image:title>Recombinant Human Probable palmitoyltransferase ZDHHC24 (ZDHHC24)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-mas-related-g-protein-coupled-receptor-member-x2-mrgprx2-vlps-bhp10514937</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-ileal-sodium-bile-acid-cotransporter-slc10a2-vlps-bhp10514696</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP622519HU_A4_-WB.jpg?v=1778623172</image:loc>
      <image:title>Recombinant Human Ileal sodium/bile acid cotransporter (SLC10A2)-VLPs</image:title>
      <image:caption>CSB-MP622519HU(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mas-related-g-protein-coupled-receptor-member-x2-mrgprx2-vlps-bhp10515082</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-transmembrane-4-l6-family-member-1-tm4sf1-vlps-bhp10514911</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cx3c-chemokine-receptor-1-cx3cr1-vlps-bhp10515222</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP897445MO-WB.jpg?v=1778623171</image:loc>
      <image:title>Recombinant Mouse CX3C chemokine receptor 1 (Cx3cr1)-VLPs</image:title>
      <image:caption>CSB-MP897445MO is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-membrane-spanning-4-domains-subfamily-a-member-4a-ms4a4a-vlps-bhp10515225</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5518MO-WB.jpg?v=1778623171</image:loc>
      <image:title>Recombinant Mouse Membrane-spanning 4-domains, subfamily A, member 4A (Ms4a4a)-VLPs</image:title>
      <image:caption>CSB-MP5518MO is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-protein-hapless-2-hap2-bhp10514998</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP518991DOA_A4_-SDS.jpg?v=1778623173</image:loc>
      <image:title>Recombinant Arabidopsis thaliana Protein HAPLESS 2 (HAP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-g-protein-coupled-receptor-20-gpr20-vlps-bhp10515220</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP806933MO-WB.jpg?v=1778623172</image:loc>
      <image:title>Recombinant Mouse G-protein coupled receptor 20 (Gpr20)-VLPs</image:title>
      <image:caption>CSB-MP806933MO is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-mas-related-g-protein-coupled-receptor-member-x2-mrgprx2-vlps-bhp10515223</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP668869MO-WB.jpg?v=1778623172</image:loc>
      <image:title>Recombinant Mouse Mas-related G-protein coupled receptor member X2 (Mrgprx2)-VLPs</image:title>
      <image:caption>CSB-MP668869MO is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-gap-junction-alpha-5-protein-gja5-fluorescent-vlps-bhp10514879</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009448HUf4-WB.jpg?v=1778623169</image:loc>
      <image:title>Recombinant Human Gap junction alpha-5 protein (GJA5), Fluorescent-VLPs</image:title>
      <image:caption>CSB-MP009448HUf4 is detected by Mouse anti-GFP monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-humanreceptor-type-tyrosine-protein-phosphatase-alpha-ptpra-detergent-bhp10515243</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP019047HU-D-SDS.jpg?v=1778623175</image:loc>
      <image:title>Recombinant HumanReceptor-type tyrosine-protein phosphatase alpha (PTPRA)-Detergent</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-5-hydroxytryptamine-receptor-3a-htr3a-biotinylated-detergent-bhp10515241</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP010890HU-B-D-SDS.jpg?v=1778623171</image:loc>
      <image:title>Recombinant Human 5-hydroxytryptamine receptor 3A (HTR3A), Biotinylated-Detergent</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-p2y-purinoceptor-8-p2ry8-vlps-bhp10515086</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP773043HU-WB.jpg?v=1778623172</image:loc>
      <image:title>Recombinant Human P2Y purinoceptor 8 (P2RY8)-VLPs</image:title>
      <image:caption>CSB-MP773043HU is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-cx3c-chemokine-receptor-1-cx3cr1-vlps-bhp10515250</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP5452MOV-WB.jpg?v=1778623172</image:loc>
      <image:title>Recombinant Macaca fascicularis CX3C chemokine receptor 1 (CX3CR1)-VLPs</image:title>
      <image:caption>CSB-MP5452MOV is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-dependent-phosphate-transport-protein-2b-slc34a2-vlps-bhp10515262</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021581HU_F2_-C-WB.jpg?v=1778623172</image:loc>
      <image:title>Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2)-VLPs</image:title>
      <image:caption>CSB-MP021581HU(F2)-C is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-1-acyl-sn-glycerol-3-phosphate-acyltransferase-beta-agpat2-detergent-bhp10514708</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP814318MO-D-SDS.jpg?v=1778623170</image:loc>
      <image:title>Recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (Agpat2)-Detergent</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glucagon-like-peptide-1-receptor-glp1r-vlps-bhp10515298</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cucumis-sativus-citrate-transporter-like-domain-containing-protein-s228a-s232a-s237a-s243a-s246a-s260a-s277a-s288a-s297a-s300a-s308a-s317a-s318a-s320a-s323a-vlps-bhp10515296</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6057CXP_M_-WB.jpg?v=1778623173</image:loc>
      <image:title>Recombinant Cucumis sativus Citrate transporter-like domain-containing protein (S228A,S232A,S237A,S243A,S246A,S260A,S277A,S288A,S297A,S300A,S308A,S317A,S318A,S320A,S323A)-VLPs</image:title>
      <image:caption>CSB-MP6057CXP(M) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cucumis-sativus-citrate-transporter-like-domain-containing-protein-vlps-bhp10515294</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6057CXP-WB.jpg?v=1778623174</image:loc>
      <image:title>Recombinant Cucumis sativus Citrate transporter-like domain-containing protein-VLPs</image:title>
      <image:caption>CSB-MP6057CXP1 is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-arabidopsis-thaliana-protein-hapless-2-hap2-vlps-bhp10514939</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-hepatitis-b-virus-genotype-c-subtype-adr-large-envelope-protein-s-vlps-bhp10515313</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP800387HEAA_F2_-WB.jpg?v=1778623174</image:loc>
      <image:title>Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S)-VLPs</image:title>
      <image:caption>CSB-MP800387HEAA(F2) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c5a-anaphylatoxin-chemotactic-receptor-1-c5ar1-vlps-bhp10515337</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP003996MO-WB.jpg?v=1778623171</image:loc>
      <image:title>Recombinant Mouse C5a anaphylatoxin chemotactic receptor 1 (C5ar1)-VLPs</image:title>
      <image:caption>CSB-MP003996MO is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c-c-chemokine-receptor-type-5-ccr5-vlps-bhp10515300</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004844MO_A4_-WB.jpg?v=1778623175</image:loc>
      <image:title>Recombinant Mouse C-C chemokine receptor type 5(Ccr5)-VLPs</image:title>
      <image:caption>CSB-MP004844MO(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-claudin-6-cldn6-vlps-active-bhp10515350</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP3347MO-WB.jpg?v=1778623175</image:loc>
      <image:title>Recombinant Mouse Claudin-6 (Cldn6)-VLPs (Active)</image:title>
      <image:caption>CSB-MP3347MO is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-oryza-glumipatula-citrate-transporter-like-domain-containing-protein-vlps-bhp10515295</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6061GYI-WB.jpg?v=1778623174</image:loc>
      <image:title>Recombinant Oryza glumipatula Citrate transporter-like domain-containing protein-VLPs</image:title>
      <image:caption>CSB-MP6061GYI is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-oryza-glumipatula-citrate-transporter-like-domain-containing-protein-detergent-bhp10515333</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6061GYIm12-D-SDS.jpg?v=1778623174</image:loc>
      <image:title>Recombinant Oryza glumipatula Citrate transporter-like domain-containing protein-Detergent</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-endothelin-1-receptor-ednra-vlps-active-bhp10515356</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP007403HU-WB.jpg?v=1778623174</image:loc>
      <image:title>Recombinant Human Endothelin-1 receptor (EDNRA)-VLPs (Active)</image:title>
      <image:caption>CSB-MP007403HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cat-cd40-ligand-cd40lg-bhp10515500</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004937CA-SDS.jpg?v=1778623178</image:loc>
      <image:title>Recombinant Cat CD40 ligand (CD40LG)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-probable-g-protein-coupled-receptor-75-gpr75-vlps-bhp10515301</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP009829HU_A4_m8-WB.jpg?v=1778623175</image:loc>
      <image:title>Recombinant Human Probable G-protein coupled receptor 75 (GPR75)-VLPs</image:title>
      <image:caption>CSB-MP009829HU(A4)m8 is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cucumis-sativus-citrate-transporter-like-domain-containing-protein-partial-vlps-bhp10515293</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6057CXP1-WB.jpg?v=1778623173</image:loc>
      <image:title>Recombinant Cucumis sativus Citrate transporter-like domain-containing protein, partial-VLPs</image:title>
      <image:caption>CSB-MP6057CXP is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cx3c-chemokine-receptor-1-cx3cr1-vlps-bhp10515221</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006236HU-WB.jpg?v=1778623172</image:loc>
      <image:title>Recombinant Human CX3C chemokine receptor 1 (CX3CR1)-VLPs</image:title>
      <image:caption>CSB-MP006236HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-epstein-barr-virus-latent-membrane-protein-2-lmp2-vlps-bhp10515228</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-probable-g-protein-coupled-receptor-75-gpr75-bhp10515507</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF009829HU_A4_-SDS.jpg?v=1778623176</image:loc>
      <image:title>Recombinant Human Probable G-protein coupled receptor 75 (GPR75)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tumor-necrosis-factor-receptor-superfamily-member-5-cd40-bhp10515499</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004936MO-SDS.jpg?v=1778623174</image:loc>
      <image:title>Recombinant Mouse Tumor necrosis factor receptor superfamily member 5 (Cd40)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-cholesterol-25-hydroxylase-ch25h-bhp10515502</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF005307MO-SDS.jpg?v=1778623176</image:loc>
      <image:title>Recombinant Mouse Cholesterol 25-hydroxylase (Ch25h)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-receptor-type-tyrosine-protein-phosphatase-alpha-ptpra-vlps-bhp10515252</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP019047HUd7-WB.jpg?v=1778623172</image:loc>
      <image:title>Recombinant Human Receptor-type tyrosine-protein phosphatase alpha (PTPRA)-VLPs</image:title>
      <image:caption>CSB-MP019047HUd7 is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c-c-chemokine-receptor-type-2-ccr2-bhp10515495</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004841MO-SDS.jpg?v=1778623175</image:loc>
      <image:title>Recombinant Mouse C-C chemokine receptor type 2 (Ccr2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c-c-chemokine-receptor-type-4-ccr4-bhp10515497</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004843MO-SDS.jpg?v=1778623173</image:loc>
      <image:title>Recombinant Mouse C-C chemokine receptor type 4 (Ccr4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-4-cldn4-detergent-bhp10515254</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005506HU-D-SDS.jpg?v=1778623172</image:loc>
      <image:title>Recombinant Human Claudin-4 (CLDN4)-Detergent</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-9-cldn9-partial-detergent-active-bhp10515364</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005511HU1-D-SDS_ebbdee38-7c5c-4c84-83e9-2a1ff0b1d698.jpg?v=1778623175</image:loc>
      <image:title>Recombinant Human Claudin-9 (CLDN9), partial-Detergent (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-prostaglandin-d2-receptor-2-ptgdr2-bhp10514720</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF896745HU-SDS.jpg?v=1778623169</image:loc>
      <image:title>Recombinant Human Prostaglandin D2 receptor 2 (PTGDR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cucumis-sativus-citrate-transporter-like-domain-containing-protein-s228d-s232d-s237d-s243d-s246d-s260d-s277d-s288d-s297d-s300d-s308d-s317d-s318d-s320d-s323d-vlps-bhp10515297</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP6057CXP_M1_-WB.jpg?v=1778623174</image:loc>
      <image:title>Recombinant Cucumis sativus Citrate transporter-like domain-containing protein (S228D,S232D,S237D,S243D,S246D,S260D,S277D,S288D,S297D,S300D,S308D,S317D,S318D,S320D,S323D)-VLPs</image:title>
      <image:caption>CSB-MP6057CXP(M1) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-c5a-anaphylatoxin-chemotactic-receptor-1-c5ar1-vlps-bhp10515351</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP003996MOW-WB.jpg?v=1778623174</image:loc>
      <image:title>Recombinant Macaca fascicularis C5a anaphylatoxin chemotactic receptor 1 (C5AR1)-VLPs</image:title>
      <image:caption>CSB-MP003996MOW is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-dog-cd40-ligand-cd40lg-bhp10515501</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004937DO-SDS.jpg?v=1778623174</image:loc>
      <image:title>Recombinant Dog CD40 ligand (CD40LG)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-transmembrane-4-l-six-family-member-1-tm4sf1-vlps-bhp10514916</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-asialoglycoprotein-receptor-1-asgr1-bhp10515493</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF002207HU_A4_-SDS.jpg?v=1778623176</image:loc>
      <image:title>Recombinant Human Asialoglycoprotein receptor 1 (ASGR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-asialoglycoprotein-receptor-2-asgr2-bhp10515494</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF002208HUm12-SDS.jpg?v=1778623175</image:loc>
      <image:title>Recombinant Human Asialoglycoprotein receptor 2 (ASGR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-proto-oncogene-mas-mas1-bhp10515517</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF013505HU-SDS.jpg?v=1778623176</image:loc>
      <image:title>Recombinant Human Proto-oncogene Mas (MAS1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c-c-chemokine-receptor-type-8-ccr8-bhp10515498</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004847MOm3-SDS.jpg?v=1778623175</image:loc>
      <image:title>Recombinant Mouse C-C chemokine receptor type 8 (Ccr8)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-interferon-induced-transmembrane-protein-1-ifitm1-bhp10515513</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF011024HU-SDS.jpg?v=1778623176</image:loc>
      <image:title>Recombinant Human Interferon-induced transmembrane protein 1 (IFITM1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-x-c-chemokine-receptor-type-1-cxcr1-bhp10515514</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF011672HUa0-SDS.jpg?v=1778623178</image:loc>
      <image:title>Recombinant Human C-X-C chemokine receptor type 1 (CXCR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-orexin-hypocretin-receptor-type-1-hcrtr1-bhp10515509</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF010231MO-SDS.jpg?v=1778623176</image:loc>
      <image:title>Recombinant Mouse Orexin/Hypocretin receptor type 1 (Hcrtr1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-5-hydroxytryptamine-receptor-1b-htr1b-bhp10515511</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF010882RA-SDS.jpg?v=1778623177</image:loc>
      <image:title>Recombinant Rat 5-hydroxytryptamine receptor 1B (Htr1b)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-chemokine-receptor-type-4-ccr4-bhp10515496</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF004843HUd7-SDS.jpg?v=1778623175</image:loc>
      <image:title>Recombinant Human C-C chemokine receptor type 4 (CCR4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-etoposide-induced-protein-2-4-homolog-ei24-bhp10515504</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF007498HU_A4_-SDS.jpg?v=1778623178</image:loc>
      <image:title>Recombinant Human Etoposide-induced protein 2.4 homolog (EI24)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-high-affinity-immunoglobulin-epsilon-receptor-subunit-beta-ms4a2-bhp10515519</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF015013HU-SDS.jpg?v=1778623176</image:loc>
      <image:title>Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (MS4A2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-5-hydroxytryptamine-receptor-2a-htr2a-bhp10515512</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF010887HU-SDS.jpg?v=1778623178</image:loc>
      <image:title>Recombinant Human 5-hydroxytryptamine receptor 2A (HTR2A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-orexin-receptor-type-2-hcrtr2-bhp10515510</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF010232HU_A4_-SDS.jpg?v=1778623177</image:loc>
      <image:title>Recombinant Human Orexin receptor type 2 (HCRTR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sphingosine-1-phosphate-receptor-2-s1pr2-bhp10515527</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF020651HU-SDS.jpg?v=1778623178</image:loc>
      <image:title>Recombinant Human Sphingosine 1-phosphate receptor 2 (S1PR2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-6-cldn6-partial-bhp10515434</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-BP005508HU_A5_-SDS.jpg?v=1778623175</image:loc>
      <image:title>Recombinant Human Claudin-6 (CLDN6), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-proto-oncogene-mas-mas1-bhp10515518</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF013505RA-SDS.jpg?v=1778623176</image:loc>
      <image:title>Recombinant Rat Proto-oncogene Mas (Mas1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-g-protein-activated-inward-rectifier-potassium-channel-4-kcnj5-bhp10515516</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF012058HU-SDS.jpg?v=1778623177</image:loc>
      <image:title>Recombinant Human G protein-activated inward rectifier potassium channel 4 (KCNJ5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-nadh-dehydrogenase-ubiquinone-1-beta-subcomplex-subunit-1-ndufb1-bhp10515521</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF015641HU_A4_-SDS.jpg?v=1778623177</image:loc>
      <image:title>Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 (NDUFB1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-orexin-hypocretin-receptor-type-1-hcrtr1-bhp10515508</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF010231HU-SDS.jpg?v=1778623174</image:loc>
      <image:title>Recombinant Human Orexin/Hypocretin receptor type 1 (HCRTR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-hepatic-sodium-bile-acid-cotransporter-slc10a1-bhp10515530</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF021373MO-SDS.jpg?v=1778623176</image:loc>
      <image:title>Recombinant Mouse Hepatic sodium/bile acid cotransporter (Slc10a1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-integrin-beta-1-itgb1-bhp10515515</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF011880MO_A4_-SDS.jpg?v=1778623176</image:loc>
      <image:title>Recombinant Mouse Integrin beta-1 (Itgb1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-atp-synthase-f-0-complex-subunit-a-mt-atp6-bhp10515520</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF015070HU-SDS.jpg?v=1778623177</image:loc>
      <image:title>Recombinant Human ATP synthase F(0) complex subunit a (MT-ATP6)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sodium-glucose-cotransporter-2-slc5a2-bhp10515531</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF021679HU-SDS.jpg?v=1778623179</image:loc>
      <image:title>Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-mu-type-opioid-receptor-oprm1-bhp10515523</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF016361MO-SDS.jpg?v=1778623176</image:loc>
      <image:title>Recombinant Mouse Mu-type opioid receptor (Oprm1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-proteinase-activated-receptor-1-f2r-bhp10515505</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF007924HU-SDS.jpg?v=1778623177</image:loc>
      <image:title>Recombinant Human Proteinase-activated receptor 1 (F2R)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-gustatory-receptor-for-sugar-taste-64a-gr64a-bhp10515542</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF306059DLU-SDS.jpg?v=1778623178</image:loc>
      <image:title>Recombinant Drosophila melanogaster Gustatory receptor for sugar taste 64a (Gr64a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-bovine-rhodopsin-rho-bhp10515526</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF019681BOd7-SDS.jpg?v=1778623179</image:loc>
      <image:title>Recombinant Bovine Rhodopsin (RHO)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sulfhydryl-oxidase-1-qsox1-bhp10515524</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF019144HU-SDS.jpg?v=1778623178</image:loc>
      <image:title>Recombinant Human Sulfhydryl oxidase 1 (QSOX1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-clarin-1-clrn1-bhp10515503</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF005583HU-SDS.jpg?v=1778623175</image:loc>
      <image:title>Recombinant Human Clarin-1 (CLRN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-somatostatin-receptor-type-4-sstr4-bhp10515532</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF022727HUm3-SDS.jpg?v=1778623182</image:loc>
      <image:title>Recombinant Human Somatostatin receptor type 4 (SSTR4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-coronavirus-229e-envelope-small-membrane-protein-e-bhp10515544</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF322559HIT-SDS.jpg?v=1778623179</image:loc>
      <image:title>Recombinant Human coronavirus 229E Envelope small membrane protein (E)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-receptor-activity-modifying-protein-3-ramp3-bhp10515525</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF019306HU-SDS.jpg?v=1778623176</image:loc>
      <image:title>Recombinant Human Receptor activity-modifying protein 3 (RAMP3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-dgat1-2-independent-enzyme-synthesizing-storage-lipids-tmem68-bhp10515536</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023872HU-SDS.jpg?v=1778623179</image:loc>
      <image:title>Recombinant Human DGAT1/2-independent enzyme synthesizing storage lipids (TMEM68)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-caenorhabditis-elegans-mitochondrial-import-receptor-subunit-tom7-homolog-tomm-7-bhp10515538</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF024054CXY_A4_-SDS.jpg?v=1778623181</image:loc>
      <image:title>Recombinant Caenorhabditis elegans Mitochondrial import receptor subunit TOM7 homolog (tomm-7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-myomaker-mymk-bhp10515549</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF407391HU-SDS.jpg?v=1778623178</image:loc>
      <image:title>Recombinant Human Protein myomaker (MYMK)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-stearoyl-coa-desaturase-scd-bhp10515528</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF020802HUa0-SDS.jpg?v=1778623178</image:loc>
      <image:title>Recombinant Human Stearoyl-CoA desaturase (SCD)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-vaccinia-virus-entry-fusion-complex-associated-protein-opg095-opg099-bhp10515546</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF362178VAI-SDS.jpg?v=1778623177</image:loc>
      <image:title>Recombinant Vaccinia virus Entry-fusion complex associated protein OPG095 (OPG099)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-gustatory-receptor-for-sugar-taste-64a-gr64a-bhp10515543</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF306059DLUd7-SDS.jpg?v=1778623177</image:loc>
      <image:title>Recombinant Drosophila melanogaster Gustatory receptor for sugar taste 64a (Gr64a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cytomegalovirus-unique-short-us11-glycoprotein-us11-bhp10515548</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF362773HWV_A4_-SDS.jpg?v=1778623179</image:loc>
      <image:title>Recombinant Human cytomegalovirus Unique short US11 glycoprotein (US11)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-tetraspanin-7-tspan7-bhp10515539</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF025165HU_A4_-SDS.jpg?v=1778623177</image:loc>
      <image:title>Recombinant Human Tetraspanin-7 (TSPAN7)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-e3-ubiquitin-protein-ligase-marchf9-marchf9-bhp10515559</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF667551MO-SDS.jpg?v=1778623181</image:loc>
      <image:title>Recombinant Mouse E3 ubiquitin-protein ligase MARCHF9 (Marchf9)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-5-hydroxytryptamine-receptor-4-htr4-bhp10515556</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF622677HU-SDS.jpg?v=1778623180</image:loc>
      <image:title>Recombinant Human 5-hydroxytryptamine receptor 4 (HTR4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mycobacterium-tuberculosis-probable-transport-accessory-protein-mmps3-mmps3-bhp10515545</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF353915MVZ-SDS.jpg?v=1778623180</image:loc>
      <image:title>Recombinant Mycobacterium tuberculosis Probable transport accessory protein MmpS3 (mmpS3)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-oryza-glumipatula-citrate-transporter-like-domain-containing-protein-bhp10515552</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF6061GYId7-SDS.jpg?v=1778623180</image:loc>
      <image:title>Recombinant Oryza glumipatula Citrate transporter-like domain-containing protein</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-zinc-transporter-zip5-slc39a5-bhp10515565</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF747773HU-SDS.jpg?v=1778623182</image:loc>
      <image:title>Recombinant Human Zinc transporter ZIP5 (SLC39A5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-fascicularis-tetraspanin-1-tspan1-bhp10515560</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF687030MOV-SDS.jpg?v=1778623180</image:loc>
      <image:title>Recombinant Macaca fascicularis Tetraspanin-1 (TSPAN1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-hide1-hide1-bhp10515567</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF765711MO_A4_-SDS.jpg?v=1778623183</image:loc>
      <image:title>Recombinant Mouse Protein HIDE1 (Hide1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-lassa-virus-pre-glycoprotein-polyprotein-gp-complex-gpc-bhp10515547</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF362480LNP-SDS.jpg?v=1778623181</image:loc>
      <image:title>Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-proton-activated-chloride-channel-pacc1-bhp10515535</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF023800MO_A4_-SDS.jpg?v=1778623181</image:loc>
      <image:title>Recombinant Mouse Proton-activated chloride channel (Pacc1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-palmitoyltransferase-zdhhc14-zdhhc14-bhp10515573</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF811637HUe0-SDS.jpg?v=1778623183</image:loc>
      <image:title>Recombinant Human Palmitoyltransferase ZDHHC14 (ZDHHC14)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-rat-tetraspanin-1-tspan1-bhp10515563</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF734910RA-SDS.jpg?v=1778623180</image:loc>
      <image:title>Recombinant Rat Tetraspanin-1 (Tspan1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-saccharomyces-cerevisiae-putative-cation-exchanger-ydl206w-bhp10515554</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF615504SVG_A4_-SDS.jpg?v=1778623183</image:loc>
      <image:title>Recombinant Saccharomyces cerevisiae Putative cation exchanger YDL206W</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-5-hydroxytryptamine-receptor-4-htr4-partial-bhp10515557</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF622677HU2-SDS.jpg?v=1778623181</image:loc>
      <image:title>Recombinant Human 5-hydroxytryptamine receptor 4 (HTR4), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-organic-solute-transporter-subunit-alpha-slc51a-bhp10515568</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF768212HU-SDS.jpg?v=1778623181</image:loc>
      <image:title>Recombinant Human Organic solute transporter subunit alpha (SLC51A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-protein-transport-protein-sec61-subunit-alpha-isoform-1-sec61a1-bhp10515529</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF020956HU_A4_-SDS.jpg?v=1778623178</image:loc>
      <image:title>Recombinant Human Protein transport protein Sec61 subunit alpha isoform 1 (SEC61A1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-calcium-release-activated-calcium-channel-protein-1-orai1-bhp10515578</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF846601HU-SDS.jpg?v=1778623181</image:loc>
      <image:title>Recombinant Human Calcium release-activated calcium channel protein 1 (ORAI1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-2-acylglycerol-o-acyltransferase-2-mogat2-bhp10515558</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF663570HU-SDS.jpg?v=1778623181</image:loc>
      <image:title>Recombinant Human 2-acylglycerol O-acyltransferase 2 (MOGAT2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-g-protein-coupled-receptor-171-gpr171-bhp10515571</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF806815MO-SDS.jpg?v=1778623182</image:loc>
      <image:title>Recombinant Mouse G-protein coupled receptor 171 (Gpr171)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bdnf-nt-3-growth-factors-receptor-ntrk2-bhp10515555</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF619082HU_A4_m12-SDS.jpg?v=1778623181</image:loc>
      <image:title>Recombinant Human BDNF/NT-3 growth factors receptor (NTRK2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-probable-phosphatidylethanolamine-transferase-mcr-1-mcr1-bhp10515564</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF745804ENLd7-SDS.jpg?v=1778623181</image:loc>
      <image:title>Recombinant Escherichia coli Probable phosphatidylethanolamine transferase Mcr-1 (mcr1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-2-acylglycerol-o-acyltransferase-2-mogat2-bhp10515569</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF768894MO-SDS.jpg?v=1778623182</image:loc>
      <image:title>Recombinant Mouse 2-acylglycerol O-acyltransferase 2 (Mogat2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-serine-threonine-protein-phosphatase-pgam5-mitochondrial-pgam5-g166a-v167a-k169a-bhp10515576</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF839338HU_A4_M_-SDS.jpg?v=1778623181</image:loc>
      <image:title>Recombinant Human Serine/threonine-protein phosphatase PGAM5,mitochondrial (PGAM5) (G166A,V167A,K169A)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-xanthomonas-albilineans-histidine-kinase-rpfc-bhp10515553</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF6137GYO-SDS.jpg?v=1778623180</image:loc>
      <image:title>Recombinant Xanthomonas albilineans histidine kinase (rpfC)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-mitochondrial-dicarboxylate-carrier-slc25a10-bhp10515589</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF883371HU-SDS.jpg?v=1778623183</image:loc>
      <image:title>Recombinant Human Mitochondrial dicarboxylate carrier (SLC25A10)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-sphingosine-1-phosphate-receptor-5-s1pr5-bhp10515587</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF867132HU-SDS.jpg?v=1778623184</image:loc>
      <image:title>Recombinant Human Sphingosine 1-phosphate receptor 5 (S1PR5)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-trace-amine-associated-receptor-1-taar1-bhp10515579</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF847217HU-SDS.jpg?v=1778623182</image:loc>
      <image:title>Recombinant Human Trace amine-associated receptor 1 (TAAR1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-streptococcus-pyogenes-serotype-m6-streptolysin-o-slo-bhp10515562</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF726343SMZ_A5_-SDS.jpg?v=1778623181</image:loc>
      <image:title>Recombinant Streptococcus pyogenes serotype M6 Streptolysin O (slo)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-e3-ubiquitin-protein-ligase-synoviolin-syvn1-bhp10515570</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-pig-leukocyte-surface-antigen-cd47-cd47-bhp10515588</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF872379PI-SDS.jpg?v=1778623183</image:loc>
      <image:title>Recombinant Pig Leukocyte surface antigen CD47 (CD47)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-chemokine-receptor-type-3-ccr3-vlps-bhp10516587</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004842HU-WB.jpg?v=1778623185</image:loc>
      <image:title>Recombinant Human C-C chemokine receptor type 3 (CCR3)-VLPs</image:title>
      <image:caption>CSB-MP004842HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-large-neutral-amino-acids-transporter-small-subunit-2-slc7a8-bhp10515590</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF887037HU_A4_-SDS.jpg?v=1778623183</image:loc>
      <image:title>Recombinant Human Large neutral amino acids transporter small subunit 2 (SLC7A8)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-solute-carrier-family-23-member-2-slc23a2-bhp10515585</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF866221HU_A4_c7-SDS.jpg?v=1778623185</image:loc>
      <image:title>Recombinant Human Solute carrier family 23 member 2 (SLC23A2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-drosophila-melanogaster-gustatory-receptor-for-sugar-taste-43a-gr43a-bhp10515594</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF895567DLUm3-SDS.jpg?v=1778623185</image:loc>
      <image:title>Recombinant Drosophila melanogaster Gustatory receptor for sugar taste 43a (Gr43a)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-long-chain-fatty-acid-coa-ligase-1-acsl1-detergent-bhp10516551</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001191HU-D-SDS.jpg?v=1778623186</image:loc>
      <image:title>Recombinant Human Long-chain-fatty-acid--CoA ligase 1 (ACSL1)-Detergent</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-phosphatidylcholine-ceramide-cholinephosphotransferase-1-sgms1-bhp10515580</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF848676MO-SDS.jpg?v=1778623182</image:loc>
      <image:title>Recombinant Mouse Phosphatidylcholine:ceramide cholinephosphotransferase 1 (Sgms1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-very-long-chain-fatty-acid-elongase-1-elovl1-bhp10515591</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF887138HU-SDS.jpg?v=1778623182</image:loc>
      <image:title>Recombinant Human Very long chain fatty acid elongase 1 (ELOVL1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-cocal-virus-glycoprotein-g-bhp10515551</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF526335DUU-SDS.jpg?v=1778623181</image:loc>
      <image:title>Recombinant Cocal virus Glycoprotein (G)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-neuronal-acetylcholine-receptor-subunit-alpha-4-chrna4-vlps-bhp10516620</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005390HU_A4_-WB.jpg?v=1778623187</image:loc>
      <image:title>Recombinant Human Neuronal acetylcholine receptor subunit alpha-4(CHRNA4)-VLPs</image:title>
      <image:caption>CSB-MP005390HU(A4) is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-long-chain-fatty-acid-coa-ligase-1-acsl1-detergent-bhp10516552</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001191HUq3-D-SDS.jpg?v=1778623185</image:loc>
      <image:title>Recombinant Human Long-chain-fatty-acid--CoA ligase 1 (ACSL1)-Detergent</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leukocyte-antigen-cd37-cd37-vlps-active-bhp10516595</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004928HU-WB.jpg?v=1778623188</image:loc>
      <image:title>Recombinant Human Leukocyte antigen CD37 (CD37)-VLPs (Active)</image:title>
      <image:caption>CSB-MP004928HU is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-colicin-ia-cia-626-i-i-gftfsnyamswvrqapgkglewvssqqynsypyt-bhp10516147</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361926ENLe1_M_-SDS.jpg?v=1778623187</image:loc>
      <image:title>Recombinant Escherichia coli Colicin-Ia (cia) (626:I→I-GFTFSNYAMSWVRQAPGKGLEWVSSQQYNSYPYT)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-steap1-protein-steap1-bhp10515592</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF890691HUm3-SDS.jpg?v=1778623184</image:loc>
      <image:title>Recombinant Human STEAP1 protein (STEAP1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-apelin-receptor-aplnr-vlps-bhp10516561</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001910MO-WB.jpg?v=1778623185</image:loc>
      <image:title>Recombinant Mouse Apelin receptor (Aplnr)-VLPs</image:title>
      <image:caption>CSB-MP001910MO is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tetraspanin-4-tspan4-bhp10515586</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF866756MO-SDS.jpg?v=1778623184</image:loc>
      <image:title>Recombinant Mouse Tetraspanin-4 (Tspan4)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-membrane-protein-mlc1-mlc1-bhp10515574</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF837739MO_A4_-SDS.jpg?v=1778623184</image:loc>
      <image:title>Recombinant Mouse Membrane protein MLC1 (Mlc1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-o6-h1-sensor-protein-phoq-phoq-bhp10515572</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF808222EGX-SDS.jpg?v=1778623182</image:loc>
      <image:title>Recombinant Escherichia coli O6:H1 Sensor protein PhoQ (phoQ)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-macaca-mulatta-apelin-receptor-aplnr-vlps-bhp10516562</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001910MOW-WB.jpg?v=1778623185</image:loc>
      <image:title>Recombinant Macaca mulatta Apelin receptor (APLNR)-VLPs</image:title>
      <image:caption>CSB-MP001910MOW is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-tetraspanin-1-tspan1-bhp10515583</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF857471MO-SDS.jpg?v=1778623183</image:loc>
      <image:title>Recombinant Mouse Tetraspanin-1 (Tspan1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-adiponectin-receptor-protein-1-adipor1-bhp10515577</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF842016MO-SDS.jpg?v=1778623181</image:loc>
      <image:title>Recombinant Mouse Adiponectin receptor protein 1 (Adipor1)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-c-x-c-chemokine-receptor-type-3-cxcr3-vlps-bhp10516640</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006253MO-WB.jpg?v=1778623187</image:loc>
      <image:title>Recombinant Mouse C-X-C chemokine receptor type 3 (Cxcr3)-VLPs</image:title>
      <image:caption>CSB-MP006253MO is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-1-cldn1-detergent-active-bhp10516621</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005490HU1-D-SDS.jpg?v=1778623187</image:loc>
      <image:title>Recombinant Human Claudin-1 (CLDN1)-Detergent (Active)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-metalloreductase-steap2-steap2-bhp10515581</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-CF854119HUm3-SDS.jpg?v=1778623183</image:loc>
      <image:title>Recombinant Human Metalloreductase STEAP2 (STEAP2)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-escherichia-coli-colicin-ia-cia-626-i-i-qgissrlawyqqkpekapksliyarspwgyylds-bhp10516148</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP361926ENLe1_M2_-SDS.jpg?v=1778623185</image:loc>
      <image:title>Recombinant Escherichia coli Colicin-Ia (cia) (626:I→I-QGISSRLAWYQQKPEKAPKSLIYARSPWGYYLDS)</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-6-cldn6-partial-vlps-bhp10516623</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-chemokine-receptor-type-2-ccr2-vlps-bhp10516586</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004841HU-WB.jpg?v=1778623184</image:loc>
      <image:title>Recombinant Human C-C chemokine receptor type 2 (CCR2)-VLPs</image:title>
      <image:caption>CSB-MP004841HU is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-6-cldn6-partial-vlps-bhp10516624</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-6-cldn6-fluorescent-vlps-bhp10516625</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005508HU_A4_r2-HPLC.jpg?v=1778623186</image:loc>
      <image:title>Recombinant Human Claudin-6 (CLDN6), Fluorescent-VLPs</image:title>
      <image:caption>The purity of VLPs was greater than 90% as determined by SEC-HPLC</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-x-c-chemokine-receptor-type-5-cxcr5-vlps-bhp10516641</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP006255HUd7-WB.jpg?v=1778623188</image:loc>
      <image:title>Recombinant Human C-X-C chemokine receptor type 5 (CXCR5)-VLPs</image:title>
      <image:caption>CSB-MP006255HUd7 is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-claudin-18-2-cldn18-2-detergent-bhp10516622</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP005498HU_A5_q3-D-SDS.jpg?v=1778623186</image:loc>
      <image:title>Recombinant Human Claudin-18.2 (CLDN18.2)-Detergent</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-x-c-chemokine-receptor-type-2-cxcr2-vlps-active-bhp10516748</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP011673HU_A4_-WB.jpg?v=1778623188</image:loc>
      <image:title>Recombinant Human C-X-C chemokine receptor type 2 (CXCR2)-VLPs (Active)</image:title>
      <image:caption>CSB-MP011673HU(A4) is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-stearoyl-coa-desaturase-scd-vlps-bhp10516814</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP020802HU-WB.jpg?v=1778623187</image:loc>
      <image:title>Recombinant Human Stearoyl-CoA desaturase (SCD)-VLPs</image:title>
      <image:caption>CSB-MP020802HU is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bdnf-nt-3-growth-factors-receptor-ntrk2-detergent-bhp10516940</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP619082HU_A4_-D-SDS.jpg?v=1778623188</image:loc>
      <image:title>Recombinant Human BDNF/NT-3 growth factors receptor (NTRK2)-Detergent</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-somatostatin-receptor-type-2-sstr2-vlps-bhp10516836</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-4-l6-family-member-1-tm4sf1-vlps-bhp10516849</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-apelin-receptor-aplnr-vlps-bhp10516560</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001910HU-WB.jpg?v=1778623186</image:loc>
      <image:title>Recombinant Human Apelin receptor (APLNR)-VLPs</image:title>
      <image:caption>CSB-MP001910HU is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-thyrotropin-receptor-tshr-vlps-bhp10516867</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-g-protein-coupled-receptor-183-gpr183-vlps-bhp10516960</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP661031MO-HPLC.jpg?v=1778623188</image:loc>
      <image:title>Recombinant Mouse G-protein coupled receptor 183 (Gpr183)-VLPs</image:title>
      <image:caption>The purity of VLPs was greater than 95% as determined by SEC-HPLC</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-adenosine-receptor-a2a-adora2a-vlps-bhp10516556</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP001376HU_A4_-HPLC.jpg?v=1778623184</image:loc>
      <image:title>Recombinant Human Adenosine receptor A2a (ADORA2A)-VLPs</image:title>
      <image:caption>The purity of VLPs was greater than 95% as determined by SEC-HPLC</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-somatostatin-receptor-type-2-sstr2-detergent-bhp10516835</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP022725HU-D-SDS.jpg?v=1778623187</image:loc>
      <image:title>Recombinant Human Somatostatin receptor type 2 (SSTR2)-Detergent</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-solute-carrier-family-2-facilitated-glucose-transporter-member-1-slc2a1-vlps-active-bhp10516820</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP021546HU_A4_d7-WB.jpg?v=1778623188</image:loc>
      <image:title>Recombinant Human Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1)-VLPs (Active)</image:title>
      <image:caption>CSB-MP021546HU(A4)d7 is detected by Mouse anti-10*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-transmembrane-protein-184b-tmem184b-vlps-bhp10516850</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cd276-antigen-cd276-vlps-bhp10517025</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cd63-antigen-cd63-vlps-bhp10516607</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-metalloreductase-steap2-steap2-vlps-bhp10517074</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP854119HU-WB.jpg?v=1778623188</image:loc>
      <image:title>Recombinant Human Metalloreductase STEAP2 (STEAP2)-VLPs</image:title>
      <image:caption>CSB-MP854119HU is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-protein-hide1-hide1-vlps-bhp10517037</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-bdnf-nt-3-growth-factors-receptor-ntrk2-vlps-bhp10516939</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP619082HU_A4_-WB.jpg?v=1778623187</image:loc>
      <image:title>Recombinant Human BDNF/NT-3 growth factors receptor (NTRK2)-VLPs</image:title>
      <image:caption>CSB-MP619082HU(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-c-c-chemokine-receptor-type-1-ccr1-vlps-active-bhp10516585</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004839HU-WB.jpg?v=1778623185</image:loc>
      <image:title>Recombinant Human C-C chemokine receptor type 1 (CCR1)-VLPs (Active)</image:title>
      <image:caption>CSB-MP004839HU is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-steap4-and-steap1-heterodimer-protein-vlps-bhp10517027</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP7352HU-WB.jpg?v=1778623189</image:loc>
      <image:title>Recombinant Human STEAP4&amp;STEAP1 Heterodimer Protein-VLPs</image:title>
      <image:caption>CSB-MP7352HU is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-cd44-antigen-cd44-detergent-bhp10516602</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP004938HU_A4_F1_-D-SDS.jpg?v=1778623186</image:loc>
      <image:title>Recombinant Human CD44 antigen (CD44)-Detergent</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-glucagon-receptor-gcgr-vlps-bhp10516685</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-steap-family-member-1b-steap1b-vlps-bhp10517034</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP754160HU-WB.jpg?v=1778623187</image:loc>
      <image:title>Recombinant Human STEAP family member 1B (STEAP1B)-VLPs</image:title>
      <image:caption>CSB-MP754160HU is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-leucine-rich-repeat-containing-g-protein-coupled-receptor-5-lgr5-vlps-active-bhp10516768</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP012906HU_A4_-WB.jpg?v=1778623186</image:loc>
      <image:title>Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5)-VLPs (Active)</image:title>
      <image:caption>CSB-MP012906HU(A4) is detected by Mouse anti-6*His monoclonal antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-frizzled-2-fzd2-vlps-bhp10516945</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP622766HU-WB.jpg?v=1778623188</image:loc>
      <image:title>Recombinant Human Frizzled-2 (FZD2)-VLPs</image:title>
      <image:caption>CSB-MP622766HU is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-membrane-protein-mlc1-mlc1-vlps-bhp10517060</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP837739MO_A4_-WB.jpg?v=1778623187</image:loc>
      <image:title>Recombinant Mouse Membrane protein MLC1 (Mlc1)-VLPs</image:title>
      <image:caption>CSB-MP837739MO(A4) is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-mouse-g-protein-coupled-receptor-183-gpr183-vlps-bhp10516961</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP661031MOd7-WB.jpg?v=1778623188</image:loc>
      <image:title>Recombinant Mouse G-protein coupled receptor 183 (Gpr183)-VLPs</image:title>
      <image:caption>CSB-MP661031MOd7 detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-platelet-glycoprotein-ib-alpha-chain-gp1ba-partial-bhp10515746</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-EP009685HU_A4_a0-SDS.jpg?v=1778623187</image:loc>
      <image:title>Recombinant Human Platelet glycoprotein Ib alpha chain (GP1BA), partial</image:title>
      <image:caption>(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/recombinant-human-thyrotropin-receptor-tshr-partial-vlps-bhp10516866</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/CSB-MP025131HU_M1_-WB.jpg?v=1778623188</image:loc>
      <image:title>Recombinant Human Thyrotropin receptor (TSHR), partial-VLPs</image:title>
      <image:caption>CSB-MP025131HU(M1)is detected by Mouse anti-6*His monoclonal antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abcg8-antibody-bha17106085</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e3a8df9d-43a6-41ca-8186-75efc0d038cf.jpg?v=1775785807</image:loc>
      <image:title>ABCG8 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human HepG2 cells with ABCG8 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abcd3-antibody-bha17107737</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_174a931f-d9a6-4a6b-86f2-fb6fc8753e38.jpg?v=1775786005</image:loc>
      <image:title>ABCD3 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with ABCD3 antibody at 0.2ug/ml. Predicted molecular weight: ~75kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/5ht2b-receptor-antibody-bha17105436</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b2d93724-342e-4d35-9b2a-f59c6ac07b1d.jpg?v=1775785687</image:loc>
      <image:title>5HT2B Receptor Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) human U87 lysate with 5HT2B Receptor antibody. Predicted/observed molecular weight ~54 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aadat-antibody-bha17106684</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1aaffa11-e198-4361-bcbd-4bd328017190.jpg?v=1775785891</image:loc>
      <image:title>AADAT Antibody</image:title>
      <image:caption>IHC testing of FFPE human kidney with AADAT antibody at 2ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abcc5-antibody-bha17107273</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4ebd04a9-d87d-4219-ba8a-803eeaddf445.jpg?v=1775785954</image:loc>
      <image:title>ABCC5 Antibody</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with ABCC5 antibody at 0.5ug/ml. Predicted molecular weight: isoforms mayb be observed at ~23 kDa and 155-160 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/14-3-3-sigma-antibody-bha17106611</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3e603507-6377-4a2b-8166-107b38a6b152.jpg?v=1775785882</image:loc>
      <image:title>14-3-3 sigma Antibody</image:title>
      <image:caption>Western blot testing of human skin lysate with 14-3-3 sigma antibody at 0.03ug/ml. Predicted molecular weight: ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abca4-antibody-bha17106051</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_19a5ce80-0715-4e13-9804-153784aee6f9.jpg?v=1775785800</image:loc>
      <image:title>ABCA4 Antibody</image:title>
      <image:caption>Western blot testing of 1) human HepG2, 2) rat eye and 3) mouse eye lysate with ABCA4 antibody at 0.5ug/ml. Predicted molecular weight ~256 kDa but may be observed at higher molecular weights due to glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abcc4-antibody-mrp4-bha17106433</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f0ee053f-4881-4570-8c50-189e3b780773.jpg?v=1775785859</image:loc>
      <image:title>ABCC4 Antibody / MRP4</image:title>
      <image:caption>IHC testing of FFPE human prostate with ABCC4 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abcc8-antibody-sur1-bha17106792</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8c8292cb-7de3-4e21-b8d5-bd48a4a4326e.jpg?v=1775785902</image:loc>
      <image:title>ABCC8 Antibody / SUR1</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with ABCC8 antibody at 0.5ug/ml. The expected ~170 kDa band and the additional ~23 kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abeta-antibody-bha17106496</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_160ff64b-c11e-4198-9eb0-0e5943a76e5d.jpg?v=1775785866</image:loc>
      <image:title>Abeta Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with Abeta antibody at 0.03ug/ml. Predicted molecular weight 79~120kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abcg5-antibody-bha17105649</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4bb6dc24-2d26-43e0-8609-45d76734b4a8.jpg?v=1775785727</image:loc>
      <image:title>ABCG5 Antibody</image:title>
      <image:caption>Western blot testing of human 1) MCF7, 2) A549 and 3) PANC lysate with ABCG5 antibody. Expected/observed molecular weight ~73 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abcb9-antibody-bha17107051</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_40eb9a7a-d28e-42d6-8d72-aa97f90bed9b.jpg?v=1775785930</image:loc>
      <image:title>ABCB9 Antibody</image:title>
      <image:caption>IHC testing of FFPE human testis with ABCB9 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/14-3-3-sigma-antibody-biotin-conjugate-bha17106612</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bb541d5b-c17d-4d8c-abc8-447c87d49cf9.jpg?v=1775785882</image:loc>
      <image:title>14-3-3 sigma Antibody (Biotin Conjugate)</image:title>
      <image:caption>Western blot testing of mouse skin lysate with biotinylated 14-3-3 sigma antibody at 0.1ug/ml. Predicted molecular weight: ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/58k-golgi-protein-antibody-golgi-marker-bha17106424</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_967a66a1-71ae-49fb-a726-00d0e837d051.jpg?v=1775785858</image:loc>
      <image:title>58K Golgi protein Antibody / Golgi Marker</image:title>
      <image:caption>Western blot testing of human liver lysate with 58K Golgi protein at 0.1ug/ml. Predicted molecular weight: ~58 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abcd2-antibody-bha17107806</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d3c8ab06-fafb-4808-8f56-36a652200bfb.jpg?v=1775786014</image:loc>
      <image:title>ABCD2 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with ABCD2 antibody at 1ug/ml. Predicted molecular weight: ~83 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abcc1-antibody-mrp1-bha17107179</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f7f2e2fa-fa18-4b19-bf77-3f9bc25eb5eb.jpg?v=1775785946</image:loc>
      <image:title>ABCC1 Antibody / MRP1</image:title>
      <image:caption>Western blot testing of A549 lysate with ABCC1 antibody at 0.05ug/ml. Predicted molecular weight: 152-172 kDa (multiple isoforms), can be observed at ~190 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abat-antibody-4-aminobutyrate-aminotransferase-bha17105805</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_52b9e15f-77a4-4647-afe4-54a6f99d077a.jpg?v=1775785755</image:loc>
      <image:title>ABAT Antibody / 4-Aminobutyrate aminotransferase</image:title>
      <image:caption>Immunofluorescent staining of FFPE human MCF7 cells with ABAT antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/12-lipoxygenase-antibody-alox12-bha17106002</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_145bae34-fa20-4879-87ab-7721bd211c44.jpg?v=1775785791</image:loc>
      <image:title>12 Lipoxygenase Antibody / ALOX12</image:title>
      <image:caption>Western blot testing of 1) rat spleen and 2) mouse spleen lysate with 12 Lipoxygenase antibody at 0.5ug/ml. Predicted molecular weight ~76 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abhd14b-antibody-bha17107166</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_389cdb02-00e7-48a3-9f60-0208a0708c38.jpg?v=1775785945</image:loc>
      <image:title>ABHD14B Antibody</image:title>
      <image:caption>Western blot testing of human [A], mouse [B], rat [C] liver lysate with ABHD14B antibody at 0.3ug/ml. Predicted molecular weight: ~22kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aak1-antibody-bha17107082</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bcee432b-6159-443d-8a98-ce39eed465cd.jpg?v=1775785933</image:loc>
      <image:title>AAK1 Antibody</image:title>
      <image:caption>Western blot testing of human amygdala lysate with AAK1 antibody at 1ug/ml. Predicted molecular weight: ~104kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abcb10-antibody-bha17105775</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d1a84f68-3f19-4a8a-b718-7f8eafe7d348.jpg?v=1775785747</image:loc>
      <image:title>ABCB10 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat muscle, 2) human COLO320, 3) human 22RV1 and 4) human PANC lysate with ABCB10 antibody at 0.5ug/ml. Expected molecular weight: ~79 kDa (full), ~65 kDa (cleaved mitochondrial targeting sequence (amino acids 1-105)).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aadat-antibody-bha17107418</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6270e53e-5725-40d5-989e-0d730ea51d1f.jpg?v=1775785972</image:loc>
      <image:title>AADAT Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with AADAT antibody at 1ug/ml. Predicted molecular weight: ~47kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aat-antibody-alpha-1-antitrypsin-serpina1-bha17105883</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_85637d3e-8fdc-43c9-9d9e-2542d67187b0.jpg?v=1775785769</image:loc>
      <image:title>AAT Antibody / Alpha 1 Antitrypsin / SERPINA1</image:title>
      <image:caption>Western blot analysis of 1) human T-47D, 2) monkey COS7 and 3) mouse kidney lysate with AAT antibody at 0.5ug/ml. Alpha 1 Antitrypsin is a glycoprotein with an expected molecular weight of 47-52 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abce1-antibody-bha17107387</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8535b7d8-28ee-4b25-944d-861a97ed2b38.jpg?v=1775785967</image:loc>
      <image:title>ABCE1 Antibody</image:title>
      <image:caption>Western blot testing of A431 lysate with ABCE1 antibody at 0.3ug/ml. Predicted molecular weight: ~68kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aarsd1-antibody-bha17107239</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_11869c19-c2c3-4ff2-90d8-e2626aa24d36.jpg?v=1775785951</image:loc>
      <image:title>AARSD1 Antibody</image:title>
      <image:caption>Western blot testing of A549 lysate with AARSD1 antibody at 1ug/ml. Predicted molecular weight: ~45/59/66kDa (isoforms 1/2/3).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/14-3-3-theta-antibody-bha17106517</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c766dc31-b431-46dc-a7cd-300b2ea99212.jpg?v=1775785870</image:loc>
      <image:title>14-3-3 theta Antibody</image:title>
      <image:caption>Western blot testing of human hippocampus lysate with 14-3-3 theta antibody at 0.03ug/ml. Predicted molecular weight: ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abcc1-antibody-mrp1-bha17106017</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_205e58ac-97eb-4e46-9122-ce21afe477af.jpg?v=1775785793</image:loc>
      <image:title>ABCC1 Antibody / MRP1</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) A549 cell lysate with ABCC1 antibody at 0.5ug/ml. Predicted molecular weight: 152-172 kDa (multiple isoforms), can be observed at ~190 kDa, observed here at ~220 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/5ht2ar-antibody-bha17105388</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3e7a143d-9961-4f7b-ba92-324450190c90.jpg?v=1775785677</image:loc>
      <image:title>5HT2AR Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat testis and 3) human U-87 MG lysate with 5HT2AR antibody. Predicted/observed molecular weight ~53 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abce1-antibody-bha17105806</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e76e178f-9a1d-46b1-96e3-ca5f60054723.jpg?v=1775785755</image:loc>
      <image:title>ABCE1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human HeLa cells with ABCE1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abhd5-antibody-cgi-58-bha17105807</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c0e66472-4ce9-47f8-a623-a51d9fc6bb55.jpg?v=1775785757</image:loc>
      <image:title>ABHD5 Antibody / CGI-58</image:title>
      <image:caption>Western blot testing of 1) rat kidney and 2) human A431 lysate with ABHD5 antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abhd5-antibody-bha17107021</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bfe5cc1e-0c22-4a4b-8333-1eb839967b26.jpg?v=1775785929</image:loc>
      <image:title>ABHD5 Antibody</image:title>
      <image:caption>Western blot testing of NIH3T3 lysate with ABHD5 antibody at 0.2ug/ml. Predicted molecular weight: ~39 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/15-pgdh-antibody-hpgd-bha17106730</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_65391b4f-c590-4c05-93cb-33c43bc938c7.jpg?v=1775785897</image:loc>
      <image:title>15-PGDH Antibody / HPGD</image:title>
      <image:caption>Western blot testing of human duodenum lysate with 15-PGDH antibody at 0.1ug/ml. Predicted molecular weight: ~29 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abcd1-antibody-bha17106771</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_27298e97-d039-4c53-b0d8-4b434964ad0e.jpg?v=1775785899</image:loc>
      <image:title>ABCD1 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing human ABCD1 and probed with ABCD1 antibody at 1ug/ml (mock transfection in lane 1). The predicted molecular weight is ~83kDa which is observed in transfected lysate but human brain lysate shows a 50kDa band.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abr-antibody-active-bcr-related-bha17105776</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fadfed77-34a9-4984-9b87-209164492e7c.jpg?v=1775785750</image:loc>
      <image:title>ABR Antibody / Active BCR related</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse brain lysate with ABR antibody at 0.5ug/ml. Predicted molecular weight ~98 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acaa2-antibody-bha17105808</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_234b77a6-f75e-48ea-adcf-55b95fd9c417.jpg?v=1775785756</image:loc>
      <image:title>ACAA2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat lung, 2) mouse brain and 3) human HeLa lysate with ACAA2 antibody at 0.5ug/ml. Predicted molecular weight ~42 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acap1-antibody-bha17106845</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4079b96c-2fc2-4dd5-9f1b-48698e439808.jpg?v=1775785907</image:loc>
      <image:title>ACAP1 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with ACAP1 antibody at 0.5ug/ml. Predicted molecular weight: ~81kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abp1-antibody-aoc1-amiloride-binding-protein-1-bha17105826</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_909bccfa-d1b9-4cdf-9f2a-51dd4718b970.jpg?v=1775785761</image:loc>
      <image:title>ABP1 Antibody / AOC1 / Amiloride binding protein 1</image:title>
      <image:caption>IHC staining of FFPE human colonic adenoma tissue with ABP1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acat1-antibody-bha17107476</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e7794111-530e-4004-a0bb-5f5c6cce47a7.jpg?v=1775785978</image:loc>
      <image:title>ACAT1 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with ACAT1 antibody at 0.01ug/ml. Predicted molecular weight: ~45kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ache-antibody-bha17105363</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3a23db3d-eaff-4a67-b3ca-d4740c3cfbf2.jpg?v=1775785673</image:loc>
      <image:title>ACHE Antibody</image:title>
      <image:caption>Western blot testing of 1) rat kidney, 2) mouse liver, 3) human HeLa, 4) PANC and 5) COLO320 lysate with ACHE antibody. Expected/observed molecular weight ~67 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/abl2-antibody-bha17105745</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fb10294d-3713-43c2-99e7-25babf892d2e.jpg?v=1775785742</image:loc>
      <image:title>ABL2 Antibody</image:title>
      <image:caption>IHC testing of FFPE human gallbladder carcinoma tissue with ABL2 antibody. HEIR: Boil the paraffin sections in pH8 EDTA buffer for 20 minutes and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acap2-antibody-bha17106842</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c7aad561-179c-4d90-b890-4adff6ff6cf6.jpg?v=1775785909</image:loc>
      <image:title>ACAP2 Antibody</image:title>
      <image:caption>Western blot testing of human MOLT4 lysate with ACAP2 antibody at 1ug/ml. Predicted molecular weight: ~88kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aconitase-2-antibody-aco2-bha17105777</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bd868734-0237-4b50-a9b7-68e344a332f6.jpg?v=1775785749</image:loc>
      <image:title>Aconitase 2 Antibody / ACO2</image:title>
      <image:caption>Western blot testing of 1) human HeLa, 2) human U-87 MG, 3) human Jurkat, 4) human HepG2, 5) rat brain, 6) rat skeletal muscle, 7) mouse brain and 8) mouse skeletal muscle tissue lysate with Aconitase 2 antibody. Predicted molecular weight: ~85 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acat1-antibody-bha17106525</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_56d1dc2a-1a18-4baa-97b3-44e46cb31cb3.jpg?v=1775785870</image:loc>
      <image:title>ACAT1 Antibody</image:title>
      <image:caption>Western blot testing of mouse [A] and rat [B] liver lysate with ACAT1 antibody at 0.1ug/ml. Predicted molecular weight: ~45kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/accn1-antibody-asic2-bha17105832</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f8b14106-2d26-442b-b297-2d620aff0fb0.jpg?v=1775785760</image:loc>
      <image:title>ACCN1 Antibody / ASIC2</image:title>
      <image:caption>Western blot testing of 1) rat testis and 2) human MCF7 lysate with ACCN1 antibody at 0.5ug/ml. Predicted molecular weight ~58 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acsl5-antibody-bha17106098</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_476b550e-80f5-46bf-b5c1-9f630a49b74b.jpg?v=1775785808</image:loc>
      <image:title>ACSL5 Antibody</image:title>
      <image:caption>Flow cytometry testing of fixed and permeabilized human HL60 cells with ACSL5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ACSL5 antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acsl1-antibody-bha17105811</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fdc0406d-49b0-4a41-b51d-d57d2f4f741e.jpg?v=1775785758</image:loc>
      <image:title>ACSL1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse HEPA and 3) A549 lysate with ACSL1 antibody at 0.5ug/ml. Predicted molecular weight ~78 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acadvl-antibody-vlcad-bha17105809</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9b71ffda-cd12-424e-9be8-c76ab8e3d29d.jpg?v=1775785758</image:loc>
      <image:title>ACADVL Antibody / VLCAD</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with ACADVL antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acsl4-antibody-bha17107236</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ee7dc19a-5a80-4e40-a601-49e47d17d448.jpg?v=1775785951</image:loc>
      <image:title>ACSL4 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 lysate with ACSL4 antibody at 0.1ug/ml. Predicted molecular weight: ~80 kDa (long form), ~74 kDa (short form).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/actl7b-antibody-bha17106529</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9ade61e2-20d1-497d-b667-724de75151d7.jpg?v=1775785873</image:loc>
      <image:title>Actl7b Antibody</image:title>
      <image:caption>Western blot testing of rat testis lysate with Actl7b antibody at 0.5ug/ml. The expected ~45kDa band and the additional ~30kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/actn3-antibody-bha17105812</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2dd64244-dcf2-40fc-8a28-50299e3486af.jpg?v=1775785758</image:loc>
      <image:title>ACTN3 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE mouse skeletal muscle tissue with ACTN3 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/actn4-antibody-alpha-actinin-4-bha17105778</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b829e1df-1af7-4635-90b1-8dd66149017c.jpg?v=1775785750</image:loc>
      <image:title>ACTN4 Antibody / Alpha Actinin 4</image:title>
      <image:caption>Western blot testing of 1) rat skeletal muscle, 2) rat liver, 3) rat lung, 4) rat RH35, 5) mouse skeletal muscle, 6) mouse liver, 7) mouse lung and 8) mouse NIH 3T3 cell lysate with ACTN4 antibody at 0.5ug/ml. Predicted molecular weight ~105 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acpp-antibody-pap-prostatic-acid-phosphatase-bha17107618</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_52f5a1e6-033d-436f-940c-57a644506e1b.jpg?v=1775785993</image:loc>
      <image:title>ACPP Antibody / PAP / Prostatic acid phosphatase</image:title>
      <image:caption>Western blot testing of human prostate lysate with ACPP antibody at 0.01ug/ml. Expected molecular weight: 45-50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acox2-antibody-bha17107180</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_29886bc9-6d5b-4356-8860-9247770cfa41.jpg?v=1775785945</image:loc>
      <image:title>ACOX2 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with ACOX2 antibody at 0.1ug/ml. Molecular weight: the expected ~75kDa band and the additional ~150kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/act1-antibody-bha17107743</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f3ec9045-a7e7-453c-9d01-b432438d660d.jpg?v=1775786004</image:loc>
      <image:title>ACT1 Antibody</image:title>
      <image:caption>Western blot testing of MCF7 lysate with ACT1 antibody at 2ug/ml. Predicted molecular weight: ~64kDa. (1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acvr2a-antibody-bha17105813</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7cb89e2e-7751-47e2-b96e-45f61a50cb01.jpg?v=1775785758</image:loc>
      <image:title>ACVR2A Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE rat NRK cells with ACVR2A antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acylphosphatase-1-antibody-bha17107796</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_86b6b0c7-d430-4d0d-b9cd-a181cef8d6f5.jpg?v=1775786012</image:loc>
      <image:title>Acylphosphatase 1 Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with Acylphosphatase 1 antibody at 0.01ug/ml. Predicted molecular weight: ~11 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acylglycerol-kinase-antibody-bha17106378</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_017ed5fe-9f2a-486d-855b-24645c10ec2b.jpg?v=1775785852</image:loc>
      <image:title>Acylglycerol kinase Antibody</image:title>
      <image:caption>Western blot testing of human brain (substantia nigra) lysate with Acylglycerol kinase antibody at 1ug/ml. The expected ~50kDa band and the additional ~22kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acsl3-antibody-bha17105940</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d848e915-c926-401a-8edd-8873ac58a7e7.jpg?v=1775785781</image:loc>
      <image:title>ACSL3 Antibody</image:title>
      <image:caption>Western blot testing of human HepG2 cell lysate with ACSL3 antibody at 0.5ug/ml. Predicted molecular weight ~80 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adam33-antibody-bha17106452</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0911771b-b11b-486e-b4df-02c853d26236.jpg?v=1775785861</image:loc>
      <image:title>ADAM33 Antibody</image:title>
      <image:caption>Western blot testing of human prostate lysate with ADAM33 antibody at 0.3ug/ml with [B] and without [A] immunizing peptide. Predicted molecular weight: ~88kDa but bands from 22-38kDa may also be visualized.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/actin-antibody-acta1-bha17105504</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e59eb94d-b818-4b71-a374-2603fdcc1454.jpg?v=1775785700</image:loc>
      <image:title>Actin Antibody / ACTA1</image:title>
      <image:caption>IHC staining of FFPE mouse heart tissue with Actin antibody. HIER: Boil the paraffin sections in pH8 EDTA buffer for 20 minutes and allow to cool prior to staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adam2-antibody-bha17106081</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_04195b42-6ace-44c6-bd41-9e30f78c321d.jpg?v=1775785805</image:loc>
      <image:title>ADAM2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) mouse testis and 3) MCF7 lysate with ADAM2 antibody at 0.5ug/ml. Predicted molecular weight ~82 kDa, but can be observed at ~100 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adam17-antibody-tace-bha17106139</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cf07f5e0-3939-417b-961d-22ebed0583a4.jpg?v=1775785818</image:loc>
      <image:title>ADAM17 Antibody / TACE</image:title>
      <image:caption>Western blot testing of 1) mouse thymus, 2) human HeLa and 3) human placenta lysate with ADAM17 antibody at 0.5ug/ml. Expected molecular weight: 80-130 kDa depending on level of glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adamts4-antibody-bha17105963</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_17b9b0ae-e8c5-4205-b577-cd4c52e000f9.jpg?v=1775785784</image:loc>
      <image:title>ADAMTS4 Antibody</image:title>
      <image:caption>Western blot testing of human recombinant ADAMTS4 partial protein (0.5ng/lane) with ADAMTS4 antibody at 0.5ug/ml. Predicted molecular weight of the full-length protein ~90 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adenosine-deaminase-antibody-ada1-bha17105733</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0b03b673-1d07-41ce-a80a-89754254c6dc.jpg?v=1775785742</image:loc>
      <image:title>Adenosine deaminase Antibody / ADA1</image:title>
      <image:caption>IHC staining of FFPE human intestinal cancer tissue with Adenosine deaminase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/acvr2b-antibody-actriib-bha17105779</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_63a276ff-a24e-409b-97df-36742be54d5d.jpg?v=1775785748</image:loc>
      <image:title>ACVR2B Antibody / ActRIIB</image:title>
      <image:caption>Western blot testing of 1) rat skeletal muscle and 2) human MCF7 lysate with ACVR2B antibody at 0.5ug/ml. Expected molecular weight ~57 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adam17-antibody-bha17107560</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0c266d7f-cb11-495e-84aa-46be049d3b70.jpg?v=1775785986</image:loc>
      <image:title>ADAM17 Antibody</image:title>
      <image:caption>Western blot testing of Daudi (A), Jurkat (B) and HeLa (C) lysates with ADAM17 antibody at 0.3ug/ml. Expected molecular weight: 80-130 kDa depending on level of glycosylation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adar1-antibody-bha17105780</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ed92f8c8-cdc2-486d-9412-71630dc354aa.jpg?v=1775785748</image:loc>
      <image:title>ADAR1 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) A549, 3) MCF7 and 4) HepG2 cell lysate with ADAR1 antibody at 0.5ug/ml. Expected molecular weight: 110-150 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adamts13-antibody-bha17105814</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e725eb4a-e069-4b37-9de4-789602fa443a.jpg?v=1775785758</image:loc>
      <image:title>ADAMTS13 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse liver and 3) human HepG2 lysate with ADAMTS13 antibody at 0.5ug/ml. Predicted/observed molecular weight ~154 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adam12-antibody-bha17106296</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c03b66f2-07d1-4dd8-bec4-feb2dd1c86a5.jpg?v=1775785840</image:loc>
      <image:title>ADAM12 Antibody</image:title>
      <image:caption>IHC staining of FFPE human prostate with ADAM12 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adh4-antibody-alcohol-dehydrogenase-4-bha17105816</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f2b57308-e570-47ab-895f-b5ad4b72ec37.jpg?v=1775785756</image:loc>
      <image:title>ADH4 Antibody / Alcohol dehydrogenase 4</image:title>
      <image:caption>Western blot testing of 1) human HepG2, 2) human HeLa, 3) rat liver, 4) rat RH35 and 5) mouse liver tissue lysate with ADH4 antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adh5-antibody-bha17105803</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ec6df83a-019a-4a9a-a279-54d89380d3ea.jpg?v=1775785757</image:loc>
      <image:title>ADH5 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with ADH5 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adh5-antibody-bha17107365</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fa4dd550-01e8-4a9f-bdf7-1147fe3af825.jpg?v=1775785965</image:loc>
      <image:title>ADH5 Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with ADH5 antibody at 0.5ug/ml. Predicted molecular weight: ~40kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adenosine-a2a-receptor-antibody-bha17107115</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c79592d7-00ee-4ce1-a9ac-06dbf50f403c.jpg?v=1775785936</image:loc>
      <image:title>Adenosine A2a Receptor Antibody</image:title>
      <image:caption>Adenosine A2a Receptor Antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adrb3-antibody-bha17107771</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_42aca6c9-99c5-4559-baef-27da145b8ad4.jpg?v=1775786008</image:loc>
      <image:title>ADRB3 Antibody</image:title>
      <image:caption>Western blot testing of human cerebral cortex lysate with ADRB3 antibody at 0.03ug/ml. Predicted molecular weight: ~44kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adra1a-antibody-bha17105419</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cbfc1e1c-d25a-407c-b8e3-82ef5fee3a99.jpg?v=1775785679</image:loc>
      <image:title>ADRA1A Antibody</image:title>
      <image:caption>Western blot testing of 1) rat heart, 2) rat brain, 3) rat liver, 4) mouse liver, 5) mouse lung, 6) human 22RV1, and 7) human SMMC lysate with ADRA1A antibody. Expected/observed molecular weight ~52 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aebp2-antibody-bha17105781</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d6d78832-1b37-450b-82e9-646f8ac07767.jpg?v=1775785752</image:loc>
      <image:title>AEBP2 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with AEBP2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adipose-triglyceride-lipase-antibody-bha17107728</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b6ab45e2-8811-42ed-bd7e-c57f36902dfe.jpg?v=1775786005</image:loc>
      <image:title>Adipose triglyceride lipase Antibody</image:title>
      <image:caption>IF/ICC staining of fixed and permeabilized human HEK293 cells with Adipose triglyceride lipase antibody (green) at 10ug/ml and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adam28-antibody-bha17106093</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c59fd528-cae6-444a-b630-741a9d065b22.jpg?v=1775785806</image:loc>
      <image:title>ADAM28 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) K562 cell lysate with ADAM28 antibody at 0.5ug/ml. Predicted molecular weight: ~87 kDa (form LM) and ~61 kDa (form LS).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adk-antibody-adenosine-kinase-bha17105817</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cb1e548a-d17c-4919-855f-e4a24ce5111b.jpg?v=1775785759</image:loc>
      <image:title>ADK Antibody / Adenosine kinase</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat kidney, 3) rat stomach, 4) rat PC-12, 5) mouse kidney, 6) mouse stomach and 7) mouse NIH 3T3 cell lysate with ADK antibody. Expected molecular weight: 40-45 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adora2b-antibody-bha17106446</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_25cd88bb-31dc-4833-9e91-750d5b230a61.jpg?v=1775785861</image:loc>
      <image:title>ADORA2B Antibody</image:title>
      <image:caption>IHC testing of FFPE human kidney with ADORA2B antibody at 2ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adam19-antibody-bha17107353</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e2a44dae-7425-4b16-8c9b-26e9538850a8.jpg?v=1775785964</image:loc>
      <image:title>ADAM19 Antibody</image:title>
      <image:caption>Western blot testing of spleen lysate with ADAM19 antibody at 0.1ug/ml. Predicted molecular weight: 105-125 kDa depending on level of glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/afm-antibody-bha17107632</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b5fde9bd-5f67-4a38-b277-d4974a990ebf.jpg?v=1775785992</image:loc>
      <image:title>AFM Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with AFM antibody at 0.3ug/ml. Predicted molecular weight: ~69/87kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adipophilin-antibody-adrp-perilipin-2-bha17105869</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_61a6b5cc-a649-4bc5-b172-9c3d2d9757f8.jpg?v=1775785769</image:loc>
      <image:title>Adipophilin Antibody / ADRP / Perilipin 2</image:title>
      <image:caption>Western blot testing of human MCF7 lysate with ADRP antibody at 0.5ug/ml. Predicted/observed molecular weight ~48 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/agr2-antibody-anterior-gradient-protein-2-bha17105966</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ed3ac1e6-0ddb-4697-9fce-f4d9b84ca0a6.jpg?v=1775785787</image:loc>
      <image:title>AGR2 Antibody / Anterior gradient protein 2</image:title>
      <image:caption>IHC staining of FFPE human bladder infiltrating urothelial carcinoma with squamous differentiation tissue with AGR2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/agr2-antibody-bha17107025</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b49dd26f-50a3-45dc-91be-25a9be6915d8.jpg?v=1775785928</image:loc>
      <image:title>AGR2 Antibody</image:title>
      <image:caption>Western blot testing of human duodenum lysate with AGR2 antibody at 0.01ug/ml. Expected molecular weight: 17-20 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/agbl5-antibody-isoform-3-bha17106386</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9fa7eaab-a948-47fd-9188-1e96fe52a324.jpg?v=1775785852</image:loc>
      <image:title>Agbl5 Antibody [isoform 3]</image:title>
      <image:caption>Western blot testing of mouse skin lysate with Agbl5 antibody at 1ug/ml. Predicted molecular weight: ~93kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adipor1-antibody-bha17105629</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9bc849ab-1b1c-49af-b2b0-565b93cc88fc.jpg?v=1775785725</image:loc>
      <image:title>ADIPOR1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with ADIPOR1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/agrp-antibody-bha17106459</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2b0bcfa6-1337-4803-b355-8741df3a2915.jpg?v=1775785863</image:loc>
      <image:title>AGRP Antibody</image:title>
      <image:caption>IHC testing of PFA-perfused cryosection of human hypothalamus and AGRP antibody at 0.05ug/ml. HIER: pH6 citrate buffer at 80C for 30min, HRP-staining with Ni-DAB after biotin-SP-anti-goat amplification.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/adrb1-antibody-bha17106959</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1d01c63f-8948-4e62-ba98-efecdf87c78c.jpg?v=1775785920</image:loc>
      <image:title>ADRB1 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with ADRB1 antibody at 0.5ug/ml. Predicted molecular weight: ~51 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ado-antibody-aminoethanethiol-dioxygenase-bha17105818</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5c7e1189-f6b5-4373-9859-9edd26e9fe81.jpg?v=1775785758</image:loc>
      <image:title>ADO Antibody / Aminoethanethiol dioxygenase</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A549 cells with ADO antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/agap3-antibody-bha17107669</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d7e296f6-fca5-4df4-87c7-4ac3feaf5b4e.jpg?v=1775785998</image:loc>
      <image:title>AGAP3 Antibody</image:title>
      <image:caption>IHC testing of FFPE human kidney with AGAP3 antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/afg3l2-antibody-bha17105738</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4c3da263-f591-4a93-980f-65172875dcc6.jpg?v=1775785743</image:loc>
      <image:title>AFG3L2 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with AFG3L2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ahr-antibody-bha17105404</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fdddc1f5-faed-44b1-a79f-2a3ef0d9567d.jpg?v=1775785675</image:loc>
      <image:title>AHR Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse liver lysate with AHR antibody. Expected/observed molecular weight ~95 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ago2-antibody-argonaute-2-bha17105782</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_84cf12fb-9a48-4d5a-96a9-26ba74ed7e27.jpg?v=1775785749</image:loc>
      <image:title>AGO2 Antibody / Argonaute 2</image:title>
      <image:caption>Western blot testing of 1) human Jurkat, 2) human 293T, 3) human K562, 4) human MCF7, 5) rat lung, 6) rat pancreas and 7) mouse pancreas tissue lysate with AGO2 antibody at 0.5ug/ml. Expected molecular weight ~97 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/agtr1-antibody-bha17106822</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_51c22087-2d65-4be5-b2cc-f2e8842abf40.jpg?v=1775785904</image:loc>
      <image:title>AGTR1 Antibody</image:title>
      <image:caption>Western blot testing of mouse liver lysate with AGTR1 antibody at 0.3ug/ml. Observed molecular weight: 41-50 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/afp-antibody-bha17107269</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cca4662d-3875-45dd-80ef-3c5da233df32.jpg?v=1775785956</image:loc>
      <image:title>AFP Antibody</image:title>
      <image:caption>Western blot testing of HepG2 lysate with AFP antibody at 0.3ug/ml. Predicted molecular weight: ~70kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ago4-antibody-argonaute-4-bha17105783</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e7bf9981-1b37-47e7-8a06-f0dc6830cc73.jpg?v=1775785749</image:loc>
      <image:title>AGO4 Antibody / Argonaute 4</image:title>
      <image:caption>Western blot testing of 1) rat thymus and 2) human 22RV1 lysate with AGO4 antibody at 0.5ug/ml. Predicted molecular weight ~97 kDa, observed here at ~115 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ak1-antibody-adenylate-kinase-1-bha17105819</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_31ce63cf-07fe-4308-b03f-2def5c3f4419.jpg?v=1775785760</image:loc>
      <image:title>AK1 Antibody / Adenylate Kinase 1</image:title>
      <image:caption>IHC staining of FFPE human lung adenocarcinoma tissue with AK1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aff4-antibody-af4-fmr2-family-member-4-bha17105934</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ce8c6833-0128-4e0b-996e-0cf9024c8d2b.jpg?v=1775785782</image:loc>
      <image:title>AFF4 Antibody / AF4/FMR2 family member 4</image:title>
      <image:caption>IHC staining of FFPE human placental tissue with AFF4 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/akap2-antibody-a-kinase-anchor-protein-2-bha17106100</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d680374f-e1dc-4765-9e55-c7347190a01f.jpg?v=1775785809</image:loc>
      <image:title>AKAP2 Antibody / A-kinase anchor protein 2</image:title>
      <image:caption>Western blot testing of 1) human PC-3 and 2) mouse lung tissue lysate with AKAP2 antibody at 0.5ug/ml. Predicted molecular weight ~95 kDa (multiple isoforms).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aimp1-antibody-biotin-conjugate-bha17107447</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c8792b59-4b3f-4f54-bec7-cb3b832fbd4b.jpg?v=1775785973</image:loc>
      <image:title>AIMP1 Antibody (Biotin Conjugate)</image:title>
      <image:caption>Western blot testing of human lymph node lysate with biotinylated AIMP1 antibody at 0.1ug/ml. Predicted molecular weight: ~34/37kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aire-antibody-bha17107284</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_452c75ca-98d0-4667-aa2c-7c6628fe9141.jpg?v=1775785956</image:loc>
      <image:title>AIRE Antibody</image:title>
      <image:caption>Western blot testing of untransfected (lane 3) and transfected (lane 4) HEK293 cell lysates with AIRE antibody at 0.05ug/ml. Predicted molecular weight: ~58kDa (isoform 1).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/agfg1-antibody-bha17105473</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_009f5e62-8880-4322-b516-e68f76492031.jpg?v=1775785693</image:loc>
      <image:title>AGFG1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with AGFG1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aim2-antibody-bha17106595</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8ac3e8d6-0008-4a31-a4ef-01f94a6f3d19.jpg?v=1775785881</image:loc>
      <image:title>AIM2 Antibody</image:title>
      <image:caption>Western blot testing of Daudi lysate with AIM2 antibody at 0.3ug/ml. Predicted molecular weight ~39kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ago1-antibody-bha17107401</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_43bf06e2-4d50-47d6-9de8-d3c4e4580590.jpg?v=1775785969</image:loc>
      <image:title>AGO1 Antibody</image:title>
      <image:caption>Western blot of HEK293 lysate overexpressing human EIF2C1/AGO1 and probed with AGO1 antibody (non-transfected HEK293 lysate in lane B). Predicted molecular weight: ~95kDa, observed here at ~110kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aimp1-antibody-bha17107446</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cbae9bd1-f9d2-4b60-b8ef-abc94212c2ad.jpg?v=1775785974</image:loc>
      <image:title>AIMP1 Antibody</image:title>
      <image:caption>Western blot testing of human lymph node lysate with AIMP1 antibody at 0.1ug/ml. Predicted molecular weight: ~34/37kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ak2-antibody-adenylate-kinase-2-bha17105820</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d14fdad1-bbf2-45af-91fe-d72f8ca24211.jpg?v=1775785760</image:loc>
      <image:title>AK2 Antibody / Adenylate kinase 2</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with AK2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/akr1c3-antibody-bha17106384</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b001fcb8-3e5a-4249-8f77-ef2c3423e27a.jpg?v=1775785852</image:loc>
      <image:title>AKR1C3 Antibody</image:title>
      <image:caption>Western blot testing of human breast lysate with AKR1C3 antibody at 0.03ug/ml. Predicted molecular weight: ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aifm1-antibody-aif-bha17106515</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_367a38c2-3021-487c-bb98-0afecfcc4d1a.jpg?v=1775785870</image:loc>
      <image:title>AIFM1 Antibody / AIF</image:title>
      <image:caption>Western blot testing of Jurkat lysate with AIFM1 antibody at 0.1ug/ml. Predicted molecular weight: ~67kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/akap10-antibody-bha17106336</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7548beab-e22e-4c72-89ee-dc579d2297dd.jpg?v=1775785846</image:loc>
      <image:title>AKAP10 Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with AKAP10 antibody at 0.3ug/ml. Predicted molecular weight: ~74kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aire-antibody-bha17105784</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e3938fee-2113-4a5c-8283-2e337701055e.jpg?v=1775785751</image:loc>
      <image:title>AIRE Antibody</image:title>
      <image:caption>IHC staining of FFPE human tonsil tissue with AIRE antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aire-antibody-bha17107255</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_65c5da68-6366-49f9-89e8-23bd171b0481.jpg?v=1775785953</image:loc>
      <image:title>AIRE Antibody</image:title>
      <image:caption>Western blot testing of human spleen lysate with AIRE antibody at 0.3ug/ml. Predicted molecular weight: ~58kDa (isoform 1).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aim2-antibody-bha17107035</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_abc4df8f-4a04-4765-a9f9-12df05f2b270.jpg?v=1775785929</image:loc>
      <image:title>AIM2 Antibody</image:title>
      <image:caption>Western blot testing of IFNb-treated WI-38 lysate with AIM2 antibody at 1ug/ml. Predicted molecular weight: 40~45kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aifm1-antibody-bha17107599</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f641e76c-123f-440e-b36f-2eb24ad7cf9d.jpg?v=1775785995</image:loc>
      <image:title>AIFM1 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with AIFM1 antibody at 0.01ug/ml. Predicted molecular weight: ~67 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aimp1-antibody-bha17107658</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_694a11a3-b808-474b-8415-cb76886a9920.jpg?v=1775785996</image:loc>
      <image:title>AIMP1 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with AIMP1 antibody at 0.3ug/ml. Predicted molecular weight: ~34/37kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/akr1b10-antibody-bha17105959</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_882562a7-6ef4-4a33-af31-7cc53b0c0d16.jpg?v=1775785784</image:loc>
      <image:title>AKR1B10 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A549 cells with AKR1B10 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/akr1c4-antibody-bha17106645</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a11a7d31-b393-4486-a171-e68c11f6a22d.jpg?v=1775785885</image:loc>
      <image:title>AKR1C4 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with AKR1C4 antibody at 0.1ug/ml. Predicted molecular weight: ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/akap6-antibody-bha17107566</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_edb575bf-2930-4d43-804f-4ae572295581.jpg?v=1775785985</image:loc>
      <image:title>AKAP6 Antibody</image:title>
      <image:caption>AKAP6 Antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/akt3-antibody-bha17106475</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c7b73974-e4e6-41c0-88c5-e3e7fd5697c2.jpg?v=1775785868</image:loc>
      <image:title>AKT3 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 [A], Jurkat [B], mouse brain [C] and rat brain [D] lysates with AKT3 antibody at 1ug/ml. Predicted molecular weight: ~56kDa but can be observed from 60~65kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/akr1b1-antibody-aldose-reductase-bha17105821</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_17689e93-2b25-4ccc-bb5e-0e6a322aefa7.jpg?v=1775785759</image:loc>
      <image:title>AKR1B1 Antibody / Aldose reductase</image:title>
      <image:caption>Flow cytometry testing of human U-2 OS cells with AKR1B1 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AKR1B1 antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/akr1c1-2-antibody-bha17105822</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_084885ff-e1cf-4d37-82b9-bca39a4351a9.jpg?v=1775785761</image:loc>
      <image:title>AKR1C1/2 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human HepG2 cells with AKR1C1/2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aldh1a3-antibody-bha17106033</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9fb70eb8-d835-4b83-a1e0-798a4f16960f.jpg?v=1775785801</image:loc>
      <image:title>ALDH1A3 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat kidney, 2) mouse stomach and 3) human HepG2 lysate with ALDH1A3 antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/akap8-antibody-bha17106663</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c545e512-8e48-4a2e-ad6b-6267000d2a18.jpg?v=1775785887</image:loc>
      <image:title>AKAP8 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with AKAP8 antibody at 1ug/ml. Predicted molecular weight: ~76kDa but routinely observed at ~95kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alcohol-dehydrogenase-antibody-adh-bha17105815</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5a685003-cb35-4894-9613-45ba86ae090d.jpg?v=1775785759</image:loc>
      <image:title>Alcohol dehydrogenase Antibody / ADH</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with Alcohol dehydrogenase antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aldh1b1-antibody-bha17105823</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_26f43bcb-eb83-4693-b672-d4167f2b5c39.jpg?v=1775785762</image:loc>
      <image:title>ALDH1B1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat testis, 3) rat RH35, 4) mouse brain and 5) mouse liver tissue lysate with ALDH1B1 antibody. Predicted molecular weight ~57 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aldh1a2-antibody-retinal-dehydrogenase-2-bha17105785</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6f3959c2-df7d-4f4b-b253-35ba452cfdcd.jpg?v=1775785751</image:loc>
      <image:title>ALDH1A2 Antibody / Retinal dehydrogenase 2</image:title>
      <image:caption>Immunofluorescent staining of FFPE human PC-3 cells with ALDH1A2 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aldh7a1-antibody-aldehyde-dehydrogenase-7a1-bha17105824</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_02a91a01-a959-44cf-bae9-dd732874d07a.jpg?v=1775785760</image:loc>
      <image:title>ALDH7A1 Antibody / Aldehyde dehydrogenase 7A1</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse HEPA and 3) human HeLa lysate with ALDH7A1 antibody at 0.5ug/ml. Predicted molecular weight ~58 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aldh2-antibody-bha17106540</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f05b25e1-8e44-448e-94b9-bce3e66c0682.jpg?v=1775785874</image:loc>
      <image:title>ALDH2 Antibody</image:title>
      <image:caption>Western blot testing of mouse liver lysate with ALDH2 antibody at 0.03ug/ml. Predicted molecular weight: ~56kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aldh3a2-antibody-bha17105786</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bc53eab4-431b-4010-b523-c2599dd596fd.jpg?v=1775785753</image:loc>
      <image:title>ALDH3A2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver and 2) human 22RV1 lysate with ALDH3A2 antibody at 0.5ug/ml. Predicted molecular weight: ~54kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aldh1a1-antibody-bha17106999</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9f1837bb-2eec-45ac-871e-55329adfc787.jpg?v=1775785923</image:loc>
      <image:title>ALDH1A1 Antibody</image:title>
      <image:caption>Western blot testing of human [A] and mouse [B] liver, and rat [C] testis lysate with ALDH1A1 antibody at 0.3ug/ml. Predicted molecular weight ~55 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aldh3a2-antibody-bha17107326</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ca05f06c-8ee6-43cd-903e-c640ae6ff283.jpg?v=1775785962</image:loc>
      <image:title>Aldh3a2 Antibody</image:title>
      <image:caption>Western blot testing of rat liver lysate with Aldh3a2 antibody at 0.03ug/ml. Predicted molecular weight: ~54kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alk1-antibody-bha17107357</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_27e28ff7-79e0-4f29-ad5d-facbe33ac619.jpg?v=1775785965</image:loc>
      <image:title>ALK1 Antibody</image:title>
      <image:caption>Western blot testing of MCF7 lysate with ALK1 antibody at 2ug/ml. Predicted molecular weight ~60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aldolase-a-antibody-bha17107694</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8987d3e1-0a12-457e-bf4a-d912d9c08cf7.jpg?v=1775786000</image:loc>
      <image:title>Aldolase A Antibody</image:title>
      <image:caption>Western blot testing of A) human, B) mouse and C) rat skeletal muscle lysates with Aldolase A antibody at 1ug/ml. Predicted molecular weight: ~40kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alpha-2-antiplasmin-antibody-bha17107271</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_17a423c7-122d-48c5-b1ff-07bf6689ce79.jpg?v=1775785953</image:loc>
      <image:title>Alpha-2-Antiplasmin Antibody</image:title>
      <image:caption>IHC staining of FFPE human liver with alpha-2-Antiplasmin antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alix-antibody-pdcd6ip-bha17105618</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_dadbabe5-bc7e-4069-a667-8c3fbf427ee7.jpg?v=1775785725</image:loc>
      <image:title>ALIX Antibody / PDCD6IP</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat testis, 3) rat liver, 4) mouse liver, 5) mouse spleen, 6) mouse NIH3T3 and 7) human HeLa lysate with ALIX antibody. Expected/observed molecular weight ~96 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alp-antibody-bha17106837</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0822c373-5180-4bea-aefc-29f85d73b3e3.jpg?v=1775785907</image:loc>
      <image:title>ALP Antibody</image:title>
      <image:caption>Western blot testing of human tonsil lysate with ALP antibody at 0.5ug/ml. Predicted molecular weight: ~32kDa. Both observed bands are blocked by addition of immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alpha-1-antichymotrypsin-antibody-bha17106648</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0f36b5e5-0754-40a6-a36e-df304e248deb.jpg?v=1775785886</image:loc>
      <image:title>Alpha-1-Antichymotrypsin Antibody</image:title>
      <image:caption>Western blot testing of albumin-depleted serum [A] and plasma [B] lysates with alpha-1-Antichymotrypsin antibody at 0.3ug/ml. Predicted molecular weight: 47/65kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alp-antibody-nat10-bha17107480</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cac08bb6-6742-4739-a679-63f1c0408238.jpg?v=1775785977</image:loc>
      <image:title>ALP Antibody / NAT10</image:title>
      <image:caption>IHC testing of FFPE human colon with ALP antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alox15-antibody-bha17107235</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c8a73bf6-0399-4325-aee1-b9fc5c6b50c1.jpg?v=1775785951</image:loc>
      <image:title>ALOX15 Antibody</image:title>
      <image:caption>Western blot testing of nuclear HeLa lysate with ALOX15 antibody at 0.2ug/ml. Predicted molecular weight: ~75 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alpha-amylase-antibody-bha17105976</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_396101e8-eca8-4585-a404-d7ee4b3c26dc.jpg?v=1775785786</image:loc>
      <image:title>Alpha Amylase Antibody</image:title>
      <image:caption>IHC testing of human pancreatic cancer tissue with Alpha Amylase antibody at 0.5ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alpha-internexin-antibody-ina-neurofilament-66-bha17105759</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_157f7842-0850-45a5-842e-427e44a093af.jpg?v=1775785749</image:loc>
      <image:title>Alpha Internexin Antibody / INA / Neurofilament-66</image:title>
      <image:caption>Immunofluorescent staining of FFPE mouse brain tissue with Alpha Internexin antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alpha-a-crystallin-antibody-cryaa-bha17105727</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a1a9fa88-269a-4343-ab64-ee3b356ae97c.jpg?v=1775785743</image:loc>
      <image:title>Alpha A Crystallin Antibody / CRYAA</image:title>
      <image:caption>Western blot testing of 1) rat spleen, 2) mouse eye and 3) human SMMC-7721 lysate with Alpha A Crystallin antibody. Expected molecular weight: 20-23 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alpha-defensin-1-antibody-defa1-bha17106043</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_879a4f9c-f2fe-4bed-a24e-fdc9e998febc.jpg?v=1775785800</image:loc>
      <image:title>Alpha Defensin 1 Antibody / DEFA1</image:title>
      <image:caption>Western blot testing of 1) rat testis and 2) human HeLa lysate with Alpha Defensin 1 antibody at 0.5ug/ml. Predicted molecular weight ~10 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alpha-synuclein-antibody-bha17106355</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b6d05e24-f7d5-4648-836c-0fa03c61b349.jpg?v=1775785850</image:loc>
      <image:title>Alpha-Synuclein Antibody</image:title>
      <image:caption>Western blot testing of human amygdala [A] and fetal mouse [B] brain lysate with alpha-Synuclein antibody at 0.1ug/ml. Predicted molecular weight ~15 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aldh1b1-antibody-bha17106586</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_eb194d4e-21b3-4701-aebf-2feb476e4883.jpg?v=1775785881</image:loc>
      <image:title>ALDH1B1 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with ALDH1B1 antibody. Predicted molecular weight: ~57 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alpha-catenin-antibody-bha17107456</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1f2ae216-b7dc-468f-994c-6a93261ef4ba.jpg?v=1775785976</image:loc>
      <image:title>Alpha Catenin Antibody</image:title>
      <image:caption>IHC staining of FFPE human prostate with alpha Catenin antibody at 3.8ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/als2-antibody-bha17107547</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0bfb1e60-efb9-41d4-8b0e-f69f13b14c34.jpg?v=1775785984</image:loc>
      <image:title>ALS2 Antibody</image:title>
      <image:caption>IHC testing of FFPE human cortex with ALS2 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/amhr2-antibody-bha17106966</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1590cf32-03f2-48f5-bf9f-30a3d6a727f4.jpg?v=1775785922</image:loc>
      <image:title>AMHR2 Antibody</image:title>
      <image:caption>Western blot testing of human MDA-MB-231 cell lysate with AMHR2 antibody at 1ug/ml. Predicted molecular weight: ~63/52/52 kDa (isoforms 1/2/3).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alpha-synuclein-antibody-bha17107276</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bf7c1bb4-115f-4835-8cf5-c97f7fdb90db.jpg?v=1775785954</image:loc>
      <image:title>Alpha-Synuclein Antibody</image:title>
      <image:caption>Western blot testing of human amygdala lysate with alpha-Synuclein antibody at 0.1ug/ml. Predicted molecular weight ~15 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/als2cr1-antibody-bha17107246</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9255c5f0-8549-492d-9df9-6f5c8ae6829d.jpg?v=1775785952</image:loc>
      <image:title>ALS2CR1 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with ALS2CR1 antibody at 1ug/ml. Predicted/observed molecular weight: ~40kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/amacr-antibody-bha17105787</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_160213d7-4633-463a-b2c2-e20477850ba6.jpg?v=1775785753</image:loc>
      <image:title>AMACR Antibody</image:title>
      <image:caption>IHC staining of FFPE human stomach cancer tissue with AMACR antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/amh-antibody-anti-muellerian-hormone-mif-bha17105972</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_384ae08c-e105-4491-a332-b6823a5bf045.jpg?v=1775785787</image:loc>
      <image:title>AMH Antibody / Anti-Muellerian hormone / MIF</image:title>
      <image:caption>Western blot testing of human 1) 293T and 2) COLO-320 lysate with AMH antibody at 0.5ug/ml. Predicted molecular weight ~60 kDa. Glycosylated homodimer may be seen at ~ 140 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/amphiphysin-antibody-bha17107461</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_550c1ba9-e0e3-4294-aead-2534c859d36c.jpg?v=1775785975</image:loc>
      <image:title>Amphiphysin Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with Amphiphysin antibody at 0.5ug/ml. Predicted molecular weight ~128kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/anapc11-antibody-apc11-bha17107724</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c1a1394e-3d36-4974-adf7-6e655daa4f09.jpg?v=1775786004</image:loc>
      <image:title>ANAPC11 Antibody / APC11</image:title>
      <image:caption>Western blot testing of cerebral cortex lysate with ANAPC11 antibody at 1ug/ml. Predicted molecular weight: ~20kDa (NCBI # NP_001002244.1 or UniProt # Q9NYG5-2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/amhr2-antibody-bha17107172</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cb0a84ae-aece-48f8-8bde-802f95408778.jpg?v=1775785944</image:loc>
      <image:title>AMHR2 Antibody</image:title>
      <image:caption>Western blot testing of human ovay lysate with AMHR2 antibody at 2ug/ml. Predicted molecular weight: ~63/52kDa (isoforms 1/3).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/amhr2-antibody-bha17105788</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ed512083-ff7d-4521-b0b2-d00878581b4f.jpg?v=1775785753</image:loc>
      <image:title>AMHR2 Antibody</image:title>
      <image:caption>IHC staining of FFPE human ovarian cancer tissue with AMHR2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/annexin-a1-antibody-bha17106447</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c7c5cceb-e17a-42a6-a619-923998b1a51f.jpg?v=1775785863</image:loc>
      <image:title>Annexin A1 Antibody</image:title>
      <image:caption>Western blot testing of K562 [A] and NIH3T3 [B] lysates with Annexin A1 antibody at 1ug/ml. Predicted molecular weight ~38kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/angiopoietin-antibody-angpt1-bha17106066</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_dfd47c5d-0e4c-490c-bf42-0dc186b16e45.jpg?v=1775785802</image:loc>
      <image:title>Angiopoietin Antibody / ANGPT1</image:title>
      <image:caption>Western blot testing of human recombinant Angiopoietin protein (1ng/lane) with Angiopoietin antibody at 0.5ug/ml. Expected molecular weight: 57-75 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/alr-antibody-aldehyde-reductase-bha17106499</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7c9bf85b-c56b-48ee-aee2-0090200e8771.jpg?v=1775785868</image:loc>
      <image:title>ALR Antibody / Aldehyde reductase</image:title>
      <image:caption>Western blot of human liver lysate with ALR antibody at 0.1ug/ml. Predicted molecular weight: ~37 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/amd1-antibody-s-adenosylmethionine-decarboxylase-bha17106255</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d1ce1050-ee5e-4356-a8d7-9c4e19a5a4b0.jpg?v=1775785834</image:loc>
      <image:title>AMD1 Antibody / S-adenosylmethionine decarboxylase</image:title>
      <image:caption>IHC testing of FFPE human lung cancer tissue with AMD1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/angiogenin-antibody-bha17105897</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d4bd338e-5e38-4173-a31a-cc1e70602372.jpg?v=1775785777</image:loc>
      <image:title>Angiogenin Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with Angiogenin antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/angpt1-antibody-bha17107735</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5db08401-5fe4-491f-b01b-54c4523c9d09.jpg?v=1775786005</image:loc>
      <image:title>ANGPT1 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing human ANGPT1-FLAG with ANGPT1 antibody [1ug/ml] in Lane A and probed with anti-FLAG [1/1000] in lane C. Mock-transfected HEK293 probed with ANGPT1 antibody [1ug/ml] in Lane B. Predicted molecular weight: ~57kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/angptl4-antibody-bha17106084</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1951f4fc-05b6-4709-85e6-0e8f421c53ae.jpg?v=1775785806</image:loc>
      <image:title>ANGPTL4 Antibody</image:title>
      <image:caption>IHC staining of FFPE human spleen tissue with ANGPTL4 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/annexin-a10-antibody-bha17107013</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e98472f6-7afd-4fcc-92c8-795c459e50f9.jpg?v=1775785927</image:loc>
      <image:title>Annexin A10 Antibody</image:title>
      <image:caption>IHC testing of FFPE human pancreas with Annexin A10 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/angiopoietin-2-antibody-bha17105953</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bf89b94e-3d45-4809-a01f-d2b698b450b2.jpg?v=1775785783</image:loc>
      <image:title>Angiopoietin 2 Antibody</image:title>
      <image:caption>IHC testing of FFPE human placental tissue with Angiopoietin 2 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/angptl8-antibody-betatrophin-bha17106216</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ca2d1e31-ec15-4bae-bacd-d1577ea2cc0e.jpg?v=1775785826</image:loc>
      <image:title>ANGPTL8 Antibody / Betatrophin</image:title>
      <image:caption>Western blot testing of human HepG2 cell lysate with ANGPTL8 antibody at 0.5ug/ml. Predicted molecular weight ~22 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/androgen-receptor-antibody-bha17107000</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_21ba07cb-e106-4505-a3ff-3b5a00a9f4c6.jpg?v=1775785927</image:loc>
      <image:title>Androgen Receptor Antibody</image:title>
      <image:caption>IHC staining of FFPE human prostate with Androgen receptor antibody at 2ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/annexin-viii-antibody-bha17105994</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_85b140c6-c759-4fa4-b58e-f47a0890fd91.jpg?v=1775785790</image:loc>
      <image:title>Annexin VIII Antibody</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) A549 cell lysate with Annexin VIII antibody at 0.5ug/ml. Predicted molecular weight ~37 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/angiotensinogen-antibody-bha17105993</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_98630688-6d8e-4a5f-ba73-905b63783b7b.jpg?v=1775785789</image:loc>
      <image:title>Angiotensinogen Antibody</image:title>
      <image:caption>Western blot testing of mouse 1) liver, 2) spleen, 3) testis and 4) kidney lysate with Angiotensinogen antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/annexin-iv-antibody-bha17105989</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1d7f7d2f-171b-4a3f-afe3-ff7197ff05f3.jpg?v=1775785792</image:loc>
      <image:title>Annexin IV Antibody</image:title>
      <image:caption>IHC staining of FFPE human placental tissue with Annexin IV antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/anti-actin-antibody-acta1-bha17105505</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9b1d93db-ae95-43f3-9e05-f6d1026dccee.jpg?v=1775785700</image:loc>
      <image:title>Anti-Actin Antibody / ACTA1</image:title>
      <image:caption>Western blot testing of 1) rat heart, 2) rat brain, 3) rat kidney, 4) mouse heart, 5) mouse brain, 6) mouse spleen and 7) mouse kidney tissue lysate with anti-Actin antibody. Expected molecular weight: 42-45 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/angptl2-antibody-bha17106094</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d531989b-d9b3-42e8-b63c-da43303ea402.jpg?v=1775785808</image:loc>
      <image:title>ANGPTL2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat stomach and 2) mouse ovary lysate with ANGPTL2 antibody at 0.5ug/ml. Predicted molecular weight ~57 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/anti-cd2-antibody-bha17105739</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_37d60ee2-3033-49d7-9d37-2d35059e0545.jpg?v=1775785742</image:loc>
      <image:title>Anti-Cd2 Antibody</image:title>
      <image:caption>Western blot testing of mouse 1) heart and 2) HEPA lysate with anti-Cd2 antibody. Predicted molecular weight: 38/50 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/annexin-a3-antibody-bha17105297</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7ab05c2b-3493-479a-94c4-e6110e697efc.jpg?v=1775785678</image:loc>
      <image:title>Annexin A3 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat spleen, 2) rat stomach, 3) human HeLa, 4) 22RV1, 5) A549, 6) MCF7 and 7) SW620 antibody with Annexin A3 antibody. Predicted/observed molecular weight ~36 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/anti-cd19-antibody-bha17105322</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3c0629ae-cd37-423a-8340-59b868457bb5.jpg?v=1775785680</image:loc>
      <image:title>Anti-CD19 Antibody</image:title>
      <image:caption>IHC staining of FFPE human appendix tissue with anti-CD19 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ap2a1-antibody-biotin-conjugate-bha17106863</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ff321d0b-caa2-4360-bc23-d18f8a230542.jpg?v=1775785910</image:loc>
      <image:title>AP2A1 Antibody (Biotin Conjugate)</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with biotinylated AP2A1 antibody at 0.01ug/ml. Predicted molecular weight: ~108 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apc2-antibody-bha17105827</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a23dfe1f-7a3d-41da-addb-096fd1b0860c.jpg?v=1775785758</image:loc>
      <image:title>APC2 Antibody</image:title>
      <image:caption>Western blot testing of human HeLa lysate with APC2 antibody at 0.5ug/ml. N-terminal APC2 antibodies generally show three bands above 200 kDa and may show three degradation or splice variant forms at ~121, 81 and 51 kDa (Ref. 1).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ape1-antibody-bha17107792</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_05e0eb38-ff15-457e-bfa9-1343f2859154.jpg?v=1775786011</image:loc>
      <image:title>APE1 Antibody</image:title>
      <image:caption>Western blot testing of A431 [A], HeLa [B] and MCF7 [C] nuclear lysates with APE1 antibody at 0.3ug/ml. Expected/observed molecular weight: ~38kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apa-antibody-aminopeptidase-a-enpep-bha17106930</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a93c860b-131f-40e4-aa96-33ebbc37027e.jpg?v=1775785919</image:loc>
      <image:title>APA Antibody / Aminopeptidase A / ENPEP</image:title>
      <image:caption>Western blot testing of human testis lysate with APA antibody at 1ug/ml. Predicted molecular weight ~109/160 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aph1a-antibody-bha17107233</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_769380b7-233b-46fc-ba1a-1ce0d3e0e517.jpg?v=1775785953</image:loc>
      <image:title>APH1A Antibody</image:title>
      <image:caption>Western blot testing of human brain [cerebral cortex] lysate with APH1A antibody at 0.05ug/ml. Predicted molecular weight: ~27 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apoa4-antibody-bha17107296</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b668754f-efe3-4f47-a7c1-bbb1a0881bba.jpg?v=1775785958</image:loc>
      <image:title>APOA4 Antibody</image:title>
      <image:caption>Western blot testing of human duodenum lysate with APOA4 antibody at 0.01ug/ml. Predicted molecular weight: ~45 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apoa1-antibody-bha17105704</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3149b493-0f30-40e3-8007-5f1143640ff8.jpg?v=1775785739</image:loc>
      <image:title>APOA1 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with APOA1 antibody. Predicted molecular weight ~30 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/antxr2-antibody-bha17107113</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_57beb38c-12a2-406d-b9e5-1fffeb7e1f32.jpg?v=1775785938</image:loc>
      <image:title>ANTXR2 Antibody</image:title>
      <image:caption>Western blot testing of mouse kidney lysate with ANTXR2 antibody at 0.3ug/ml. Predicted molecular weight: ~54 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ap2m1-antibody-bha17105941</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_dbcda236-176d-43cd-bcc2-7ae81d4222bf.jpg?v=1775785781</image:loc>
      <image:title>AP2M1 Antibody</image:title>
      <image:caption>Western blot testing of 1) human U-2 OS, 2) human MCF7 and 3) rat kidney lysate with AP2M1 antibody at 0.5ug/ml. Predicted molecular weight ~50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aplp1-antibody-n-terminal-region-bha17105470</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b201b0a4-4484-4017-aa74-4e9c3fc74c39.jpg?v=1775785693</image:loc>
      <image:title>APLP1 Antibody (N-Terminal Region)</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat testis, 3) human SGC-7901, 4) 22RV1 and 5) MCF7 lysate with APLP1 antibody. Expected molecular weight: 76 kDa (unmodified), ~86 kDa (soluble/glycosylated form), 92~95 kDa (mature form).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aph1a-antibody-aph-1alpha-bha17105632</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_61499a02-30bc-493a-ad07-9cb6b668c768.jpg?v=1775785725</image:loc>
      <image:title>APH1A Antibody / Aph-1alpha</image:title>
      <image:caption>Western blot testing of 1) human U-87 MG, 2) human U-251, 3) rat brain, 4) rat C6, 5) mouse brain and 6) mouse Neuro-2a cell lysate using APH1A antibody. Expected molecular weight: 27~29 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ap2a1-antibody-bha17106862</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d7197a65-6f2e-4a2b-9138-75cb57d24cc1.jpg?v=1775785910</image:loc>
      <image:title>AP2A1 Antibody</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with AP2A1 antibody at 0.01ug/ml. Predicted molecular weight: ~108 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aoc3-antibody-bha17106523</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a885347d-6a17-43c1-99bb-2f195da78439.jpg?v=1775785871</image:loc>
      <image:title>AOC3 Antibody</image:title>
      <image:caption>IHC testing of FFPE human liver with AOC3 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apoa1-antibody-bha17106707</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_36322d4b-cefb-4372-95e0-02db28a7ec31.jpg?v=1775785894</image:loc>
      <image:title>APOA1 Antibody</image:title>
      <image:caption>Western blot testing of liver lysate with APOA1 antibody at 0.5ug/ml. Predicted molecular weight ~30kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apobec3g-antibody-bha17106527</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_839eab71-8e38-46bb-b8b8-f0bc81fd2548.jpg?v=1775785873</image:loc>
      <image:title>APOBEC3G Antibody</image:title>
      <image:caption>Western blot testing of Daudi lysate with APOBEC3G antibody at 0.5ug/ml. Predicted molecular weight: ~46 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apol1-antibody-bha17107660</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b4edb29d-c6d0-46f6-899f-3ac590b3a360.jpg?v=1775785996</image:loc>
      <image:title>APOL1 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with APOL1 antibody at 0.1ug/ml. Predicted molecular weight: ~44/46/42kDa (isoforms 1/2/3).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apoa5-antibody-bha17107202</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5639b2bf-b321-4cff-ab50-0674e8b8326f.jpg?v=1775785947</image:loc>
      <image:title>APOA5 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with APOA5 antibody at 0.3ug/ml. Predicted molecular weight: ~41kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apod-antibody-bha17106886</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a4591207-f2fe-4a7a-8dca-e00c059e339b.jpg?v=1775785913</image:loc>
      <image:title>APOD Antibody</image:title>
      <image:caption>Western blot testing of human kidney [A] and liver [B] lysate with APOD antibody at 0.3ug/ml. Predicted molecular weight: ~21/21-33kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apobec3g-antibody-bha17105789</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_60633e96-f423-4e29-8640-1c9794f22061.jpg?v=1775785752</image:loc>
      <image:title>APOBEC3G Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with APOBEC3G antibody (green). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apobec2-antibody-bha17106741</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_506a5b84-39e8-48e1-8eb8-24cbc4f2acb5.jpg?v=1775785898</image:loc>
      <image:title>APOBEC2 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with APOBEC2 antibody at 1ug/ml with [B] and without [A] blocking peptide. Predicted molecular weight: ~26kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apolipoprotein-a-i-antibody-bha17105515</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_41557310-b4a0-4067-9d9f-bb1b34ec9a13.jpg?v=1775785701</image:loc>
      <image:title>Apolipoprotein A I Antibody</image:title>
      <image:caption>Western blot testing of mouse liver lysate with Apolipoprotein A I antibody. Predicted molecular weight ~30 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apolipoprotein-l4-antibody-bha17106890</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b59c6180-8013-4eed-b5c7-deb11746679a.jpg?v=1775785912</image:loc>
      <image:title>Apolipoprotein L4 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with Apolipoprotein L4 antibody at 0.5ug/ml with [B] and without [A] blocking/immunizing peptide. Predicted molecular weight: ~39 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apoc1-antibody-bha17106980</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cc693738-be59-49d6-a93a-e9287496c533.jpg?v=1775785923</image:loc>
      <image:title>APOC1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human liver with APOC1 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apobec2-antibody-bha17107428</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5c1dbf62-7d8b-47f2-b09a-3fc23ba81406.jpg?v=1775785972</image:loc>
      <image:title>APOBEC2 Antibody</image:title>
      <image:caption>Western blot testing of human muscle lysate with APOBEC2 antibody at 1ug/ml. Predicted molecular weight: ~26kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apobec3d-antibody-bha17107794</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0d58fb32-b7cf-4e29-b4b4-42205cdbed29.jpg?v=1775786010</image:loc>
      <image:title>APOBEC3D Antibody</image:title>
      <image:caption>Western blot testing of A549 lysate with APOBEC3D antibody at 0.3ug/ml. Predicted molecular weight: ~46kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apol6-antibody-bha17106513</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_64cb47b6-387a-4ecb-a9a7-5fc00f0cc670.jpg?v=1775785869</image:loc>
      <image:title>APOL6 Antibody</image:title>
      <image:caption>Western blot testing of human skeletal muscle lysate with APOL6 antibody at 2ug/ml. Predicted molecular weight: ~38kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apobec1-antibody-bha17106719</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fbd8329c-5e95-4a86-8841-07872c7f884a.jpg?v=1775785894</image:loc>
      <image:title>APOBEC1 Antibody</image:title>
      <image:caption>Western blot testing of mouse spleen lysate with APOBEC1 antibody at 1ug/ml. Predicted molecular weight: ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apolipoprotein-f-antibody-bha17107489</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_015408ee-8864-439d-ad0e-9b03e2b75033.jpg?v=1775785979</image:loc>
      <image:title>Apolipoprotein F Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with Apolipoprotein F antibody at 0.5ug/ml. Predicted/observed molecular weight: ~35kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apxl-antibody-shroom2-bha17107266</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e8cbafd9-1c5e-4afb-91f5-e2c7001dedb0.jpg?v=1775785953</image:loc>
      <image:title>APXL Antibody / SHROOM2</image:title>
      <image:caption>IHC testing of FFPE human kidney with APXL antibody at 4ug/ml. HIER: steamed with pH9 Tris/EDTA buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apob-antibody-apolipoprotein-b-bha17105828</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fc8d69e8-9804-4a2f-8d80-5796f2bcf74a.jpg?v=1775785762</image:loc>
      <image:title>APOB Antibody / Apolipoprotein B</image:title>
      <image:caption>Western blot testing of human HeLa lysate with APOB antibody at 0.5ug/ml. Predicted molecular weight: ~516 kDa (ApoB-100), ~240 kDa (ApoB-48).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/appl-antibody-bha17106609</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4483c219-79db-4138-80f4-fbf05fd0ab7c.jpg?v=1775785882</image:loc>
      <image:title>APPL Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with APPL antibody at 0.3ug/ml. Predicted molecular weight: ~80kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apoc3-antibody-apolipoprotein-c-iii-bha17105829</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d7b20e6e-8950-4f82-83a6-a2f2c2440863.jpg?v=1775785761</image:loc>
      <image:title>APOC3 Antibody / Apolipoprotein C III</image:title>
      <image:caption>IHC staining of FFPE mouse liver tissue with APOC3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ap2b1-antibody-bha17105942</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0ea0215b-07c3-4325-883c-eb41e04d3b53.jpg?v=1775785783</image:loc>
      <image:title>AP2B1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) mouse brain and 3) human MCF7 cell lysate with AP2B1 antibody at 0.5ug/ml. Predicted molecular weight ~105 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/app-antibody-bha17106497</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_eab70384-3c12-492c-b140-3f2fb6078ebd.jpg?v=1775785866</image:loc>
      <image:title>APP Antibody</image:title>
      <image:caption>Western blot testing of human cerebral cortex lysate with APP antibody at 1ug/ml. Predicted molecular weight 79~120kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aqp11-antibody-aquaporin-11-bha17105830</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f89f0dea-64b5-4654-8342-ed7ebc9581a3.jpg?v=1775785761</image:loc>
      <image:title>AQP11 Antibody / Aquaporin 11</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain and 3) human HeLa lysate with AQP11 antibody at 0.5ug/ml. Predicted molecular weight 26~30 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/april-antibody-anp32b-phapi2-bha17107463</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cf5fba44-4d51-4d46-97f9-8719261bc552.jpg?v=1775785975</image:loc>
      <image:title>APRIL Antibody / ANP32B / PHAPI2</image:title>
      <image:caption>Western blot testing of A) human tonsil, B) rat spleen, C) pig spleen lysates with APRIL antibody at 0.1ug/ml. Predicted molecular weight: ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aqp0-antibody-bha17105398</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_56cfc2d9-b5f9-4e63-a054-0064046c5485.jpg?v=1775785680</image:loc>
      <image:title>AQP0 Antibody</image:title>
      <image:caption>Western blot testing of rat eye lysate with AQP0 antibody. Observed molecular weight: 28-60 kDa depending on level of glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apol3-antibody-bha17106878</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ab3efa92-c353-499b-b42f-84013d9f54aa.jpg?v=1775785912</image:loc>
      <image:title>APOL3 Antibody</image:title>
      <image:caption>Western blot testing of Daudi lysate with APOL3 antibody at 1ug/ml. Predicted molecular weight: ~44/37/22kDa (isoforms 1/2/3).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/appl1-antibody-bha17107690</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4b1faa88-6224-4371-bd0e-b455c5858f3a.jpg?v=1775785999</image:loc>
      <image:title>APPL1 Antibody</image:title>
      <image:caption>Western blot testing of rat aortic smooth muscle cells before (1) and after (2) infection with human APPL1 adenovirus for 48hrs. APPL1 antibody was used at 0.5ug/ml. The expected ~80kDa response is significantly stronger in the infected sample.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aprt-antibody-adenine-phosphoribosyltransferase-bha17105929</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_41f593d4-2005-4a8d-9393-ca85ce5abcb2.jpg?v=1775785778</image:loc>
      <image:title>APRT Antibody / Adenine phosphoribosyltransferase</image:title>
      <image:caption>Flow cytometry testing of human A549 cells with APRT antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=APRT antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aquaporin-1-antibody-aqp1-bha17105394</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_418db2f3-9924-4fd4-b849-956215db4e8e.jpg?v=1775785683</image:loc>
      <image:title>Aquaporin 1 Antibody / AQP1</image:title>
      <image:caption>IHC staining of FFPE human bladder urothelial carcinoma tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apol5-antibody-bha17107727</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1121db82-e2f4-4ec8-880a-367bb054fbd0.jpg?v=1775786003</image:loc>
      <image:title>APOL5 Antibody</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with APOL5 antibody at 1ug/ml. Predicted molecular weight: ~47kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aquaporin-2-antibody-bha17105433</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_48de7394-b6bc-4a31-8612-13cf22046b69.jpg?v=1775785687</image:loc>
      <image:title>Aquaporin 2 Antibody</image:title>
      <image:caption>Flow cytometry testing of human PC-3 cells with Aquaporin 2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Aquaporin 2 antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aqp4-antibody-aquaporin-4-bha17105484</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_26681243-1244-4549-af36-b997012748eb.jpg?v=1775785699</image:loc>
      <image:title>AQP4 Antibody / Aquaporin 4</image:title>
      <image:caption>IHC testing of FFPE human lung cancer tissue with AQP4 antibody. HIER: Boil the paraffin sections in pH 8 EDTA buffer for 20 minutes and allow to cool prior to staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arachidonate-5-lipoxygenase-antibody-bha17106946</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6d74bfec-b259-4a71-afcb-f737b727b8e4.jpg?v=1775785919</image:loc>
      <image:title>Arachidonate 5-lipoxygenase Antibody</image:title>
      <image:caption>Western blot testing of rat stomach lysate with Arachidonate 5-lipoxygenase antibody at 0.3ug/ml. Predicted molecular weight: ~78kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arf1-antibody-adp-ribosylation-factor-1-bha17106803</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a4993ee6-c986-4e9a-9852-270a4b15a01a.jpg?v=1775785902</image:loc>
      <image:title>ARF1 Antibody / ADP-ribosylation factor 1</image:title>
      <image:caption>Western blot testing of HepG2 cell lysate with ARF1 antibody at 1ug/ml. Predicted molecular weight ~21kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apom-antibody-bha17107327</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ba598f18-6ea9-404c-98aa-dfbd48104cfb.jpg?v=1775785960</image:loc>
      <image:title>Apom Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with Apom antibody at 0.5ug/ml. Predicted molecular weight: ~21/26kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apolipoprotein-e-antibody-apoe-bha17105790</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_97acc216-a61e-4bce-a124-8b6ff2ddc26d.jpg?v=1775785754</image:loc>
      <image:title>Apolipoprotein E Antibody / ApoE</image:title>
      <image:caption>Immunofluorescent staining of FFPE rat liver tissue with Apolipoprotein E antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aquaporin-3-antibody-bha17106075</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_909cd164-480e-4a1b-bf3a-46fb1961565a.jpg?v=1775785803</image:loc>
      <image:title>Aquaporin 3 Antibody</image:title>
      <image:caption>Western blot testing of 1) mouse kidney, 2) mouse brain, 3) rat kidney and 4) rat brain with Aquaporin 3 antibody at 0.5ug/ml. Predicted molecular weight ~32 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arf6-antibody-adp-ribosylation-factor-6-bha17105791</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0d6fd29c-b958-4933-8b03-fd171a5baed0.jpg?v=1775785755</image:loc>
      <image:title>ARF6 Antibody / ADP-ribosylation factor 6</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with ARF6 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/argininosuccinate-synthetase-1-antibody-bha17106894</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8a152b40-059c-4d66-b8a3-45ade40c1608.jpg?v=1775785914</image:loc>
      <image:title>Argininosuccinate synthetase 1 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with Argininosuccinate synthetase 1 antibody at 0.03ug/ml. Predicted molecular weight: ~46 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ara9-antibody-bha17106753</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_18a0e5f8-030b-4dea-abbd-1ba10a380669.jpg?v=1775785898</image:loc>
      <image:title>ARA9 Antibody</image:title>
      <image:caption>Western blot testing of NIH3T3 cell lysate with ARA9 antibody at 0.02ug/ml. Predicted molecular weight: ~37 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arhgef1-antibody-bha17105831</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_443d6424-14e4-44ff-a76b-af095bee0754.jpg?v=1775785765</image:loc>
      <image:title>ARHGEF1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with ARHGEF1 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apol1-antibody-bha17107769</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_11d4f431-9981-4346-8ef9-7ea58b27650e.jpg?v=1775786009</image:loc>
      <image:title>APOL1 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with APOL1 antibody at 0.1ug/ml. Predicted molecular weight: ~44/46/42kDa (isoforms 1/2/3).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/apolipoprotein-d-antibody-bha17106818</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_012844ae-1d09-4c2f-a7f9-ec7acd25e834.jpg?v=1775785905</image:loc>
      <image:title>Apolipoprotein D Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with Apolipoprotein D antibody at 0.3ug/ml. Predicted molecular weight: ~21/21-33kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arginase-antibody-bha17107616</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6c81ba1a-5b79-4a8f-83a1-afba0a718c2c.jpg?v=1775785992</image:loc>
      <image:title>Arginase Antibody</image:title>
      <image:caption>Western blot testing of 1) mouse liver and 2) rat liver lysate with Arginase antibody at 0.05ug/ml. Predicted molecular weight ~35 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arc-antibody-activity-regulated-cytoskeleton-associated-protein-bha17105601</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b35cc670-039e-49a2-9e2b-2bdd5d867450.jpg?v=1775785719</image:loc>
      <image:title>ARC Antibody / Activity-regulated cytoskeleton-associated protein</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat testis, 3) mouse brain, 4) human PANC, 5) human HeLa and 6) human MCF7 lysate with ARC antibody. Expected/observed molecular weight ~45 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arih1-antibody-bha17107114</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5a302379-334c-4798-9e5a-a46ea3145930.jpg?v=1775785938</image:loc>
      <image:title>ARIH1 Antibody</image:title>
      <image:caption>Western blot testing of U937 lysate with ARIH1 antibody at 0.5ug/ml. Predicted molecular weight: ~61 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arfgap1-antibody-bha17105938</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_96f05b9b-b9dc-42bf-8075-c5c981ea56fb.jpg?v=1775785781</image:loc>
      <image:title>ARFGAP1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain and 3 human HeLa cell lysate with ARFGAP1 antibody at 0.5ug/ml. Predicted molecular weight ~45 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arfgap3-antibody-bha17107613</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5143c1f6-c13f-49ca-809a-7dd8881d7bbb.jpg?v=1775785991</image:loc>
      <image:title>ARFGAP3 Antibody</image:title>
      <image:caption>Western blot testing of mouse brain with ARFGAP3 antibody at 2ug/ml. Predicted molecular weight: ~57/52kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arhgdig-antibody-bha17106760</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_24c75949-0b26-4293-bcc2-820fc493abe2.jpg?v=1775785899</image:loc>
      <image:title>ARHGDIG Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with ARHGDIG antibody at 0.5ug/ml. Predicted molecular weight: ~25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arh-antibody-bha17106504</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_33e854b5-daad-4726-8d2b-f5a5588f492e.jpg?v=1775785870</image:loc>
      <image:title>ARH Antibody</image:title>
      <image:caption>IF/ICC testing of fixed and permeabilized human A431 cells with ARH antibody (green) at 10ug/ml and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arl2-antibody-bha17107535</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f6339ac2-9c0e-4b05-9258-400fff911dc8.jpg?v=1775785982</image:loc>
      <image:title>ARL2 Antibody</image:title>
      <image:caption>Western blot testing of U937 lysate with ARL2 antibody at 2ug/ml. Predicted molecular weight: ~20kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arpc4-antibody-bha17106940</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_39df381c-9c7e-443a-bc3d-ab0b1427cf58.jpg?v=1775785916</image:loc>
      <image:title>ARPC4 Antibody</image:title>
      <image:caption>Western blot testing of human lymph node lysate with ARPC4 antibody at 0.03ug/ml. Predicted molecular weight: ~20kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arl4a-antibody-bha17107065</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8deb3cbc-a204-4962-a454-5baf2cc0c34e.jpg?v=1775785931</image:loc>
      <image:title>ARL4A Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with ARL4A antibody at 2ug/ml. Predicted/observed molecular weight: ~23kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arl6ip5-antibody-bha17107688</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_949f9241-9acc-488c-9609-0930ae2f23d0.jpg?v=1775786000</image:loc>
      <image:title>ARL6IP5 Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with ARL6IP5 antibody at 0.1ug/ml. Predicted molecular weight: ~22 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arih2-antibody-bha17106928</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7fbc4746-0fee-403e-b18a-fcdd94fa8dbd.jpg?v=1775785917</image:loc>
      <image:title>ARIH2 Antibody</image:title>
      <image:caption>Western blot testing of HeLa [A] and K562 [B] nuclear lysates with ARIH2 antibody at 2ug/ml. Predicted molecular weight: ~58kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arginase-1-antibody-bha17106385</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4b8dbdba-365d-4f97-9962-2b157883c8cd.jpg?v=1775785855</image:loc>
      <image:title>Arginase 1 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with Arginase 1 antibody at 0.01ug/ml. Predicted molecular weight ~35 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ars2-antibody-srrt-bha17106650</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f66f05c0-4b5f-4545-bd91-e1a41ed86bf0.jpg?v=1775785886</image:loc>
      <image:title>ARS2 Antibody / SRRT</image:title>
      <image:caption>Western blot testing of human Daudi [A] and mouse spleen [B] lysates with ARS2 antibody at 0.1ug/ml. Predicted molecular weight: ~100/140kDa (unmodified/acetylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arpc1b-antibody-bha17106365</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e8b54a04-8e40-4005-b325-617b70ff8eca.jpg?v=1775785852</image:loc>
      <image:title>ARPC1B Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with ARPC1B antibody at 2ug/ml. Predicted molecular weight: ~41 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/armet-antibody-bha17107312</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0b2015af-2789-4954-9f92-98b6ba85a0b0.jpg?v=1775785959</image:loc>
      <image:title>ARMET Antibody</image:title>
      <image:caption>Western blot testing of human pancreas lysate with ARMET antibody at 0.3ug/ml. Predicted molecular weight: ~21kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arpc2-antibody-bha17106882</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5dc66d23-1b67-4b26-8c45-f40455d2da0a.jpg?v=1775785913</image:loc>
      <image:title>ARPC2 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with ARPC2 antibody at 0.2ug/ml. Predicted molecular weight: ~34kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/artemin-antibody-bha17107701</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f988dc84-3d84-40ad-afa8-d8564decbf89.jpg?v=1775786000</image:loc>
      <image:title>Artemin Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate with Artemin antibody at 0.1ug/ml. Predicted molecular weight: ~22kDa, but can observed at 26~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aryl-hydrocarbon-receptor-antibody-bha17107754</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_92d0afb0-df99-42b4-aeff-7ed42b09550b.jpg?v=1775786009</image:loc>
      <image:title>Aryl Hydrocarbon Receptor Antibody</image:title>
      <image:caption>IHC testing of FFPE human kidney with Aryl Hydrocarbon Receptor antibody at 2ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/asporin-antibody-bha17107241</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5b3ca576-3735-426e-8380-e14ec49e3f26.jpg?v=1775785952</image:loc>
      <image:title>Asporin Antibody</image:title>
      <image:caption>Western blot testing of Asponrin antibody with lysate from 1) human tonsil (Ab at 1ug/ml), 2) human uterus (Ab at 0.3ug/ml), 3) mouse skeletal muscle (Ab at 0.3ug/ml), 4) rat skeletal muscle (Ab at 1ug/ml) and 5) human cerebellum (negative control, Ab at 1ug/ml). Predicted molecular weight ~40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ascl3-antibody-bha17107158</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_52812b17-eb52-4952-894f-1ea6878cea6f.jpg?v=1775785942</image:loc>
      <image:title>Ascl3 Antibody</image:title>
      <image:caption>Western blot testing of mouse liver lysate with Ascl3 antibody at 0.1ug/ml. Predicted molecular weight: ~20kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arsb-antibody-bha17107372</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f71dc0ce-80c9-478f-a319-681853258229.jpg?v=1775785965</image:loc>
      <image:title>ARSB Antibody</image:title>
      <image:caption>IHC staining of FFPE human skeletal muscle with ARSB antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/asc-antibody-pycard-bha17106623</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cd05ccd6-d252-4d63-9d8d-866df22fd2bf.jpg?v=1775785884</image:loc>
      <image:title>ASC Antibody / PYCARD</image:title>
      <image:caption>Immunofluorescent staining of fixed and permeabilized human HeLa cells with ASC antibody (green) at 10ug/ml and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aromatase-antibody-cyp19a1-bha17107110</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3c02a94b-0a53-4ae5-b965-cdd1f01c33ff.jpg?v=1775785938</image:loc>
      <image:title>Aromatase Antibody / CYP19A1</image:title>
      <image:caption>Western blot testing of human placenta lysate with Aromatase antibody at 0.1ug/ml. Predicted molecular weight ~58kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arpc1a-antibody-bha17106547</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b1aa16cf-9aad-4e1d-b74b-9ce5f376021d.jpg?v=1775785876</image:loc>
      <image:title>ARPC1A Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with ARPC1A antibody at 0.3ug/ml. Predicted molecular weight: ~42/39 kDa (isoform 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/asf1a-antibody-bha17106772</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2ce7d11b-d6b0-4e63-a35a-68d58cd300eb.jpg?v=1775785899</image:loc>
      <image:title>ASF1A Antibody</image:title>
      <image:caption>Western blot testing of Jurkat cell lysate with ASF1A antibody at 0.01ug/ml. Predicted molecular weight: ~23kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/asf1a-antibody-bha17106896</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9c0d2642-692f-4829-a165-9fe92f796be9.jpg?v=1775785913</image:loc>
      <image:title>ASF1A Antibody</image:title>
      <image:caption>Western blot testing of Jurkat cell lysate with ASF1A antibody at 1ug/ml. Predicted molecular weight: ~23kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/asnsd1-antibody-bha17107814</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3dd7c477-2b0e-44f7-af1c-ed6545aac432.jpg?v=1775786012</image:loc>
      <image:title>ASNSD1 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing human ASNSD1-FLAG probed with ASNSD1 antibody [1ug/ml] in Lane A and anti-FLAG (1/10000) in Lane C. Mock-transfected HEK293 probed with ASNSD1 antibody [1ug/ml] in Lane B. Predicted molecular weight: ~72kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/as160-antibody-bha17106514</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e594ee38-37d2-4d2d-bfe1-1813a2d49b7b.jpg?v=1775785871</image:loc>
      <image:title>AS160 Antibody</image:title>
      <image:caption>Western blot testing of Daudi cell lysate with AS160 antibody at 0.1ug/ml. Predicted molecular weight ~147 kDa but routinely observed at 147-160 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arl6-antibody-bha17107436</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_235bc6cf-5fa5-4242-ad37-2b7dbe937a62.jpg?v=1775785972</image:loc>
      <image:title>ARL6 Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with ARL6 antibody at 0.5ug/ml. Predicted molecular weight: ~22kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arsa-antibody-bha17105320</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_438da530-c8e5-4b2a-8be7-02a19d552312.jpg?v=1775785676</image:loc>
      <image:title>ARSA Antibody</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) rat pancreas, 3) rat skeletal muscle, 4) mouse kidney and 5) human MCF7 lysate with ARSA antibody. Expected molecular weight: 53-63 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/asph-antibody-bha17105539</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a28657b5-9157-4856-beae-d5ac1823afb4.jpg?v=1775785707</image:loc>
      <image:title>ASPH Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat liver, 3) human HeLa, 4) HepG2 and 5) mouse HEPA lysate with ASPH antibody. Predicted molecular weight ~86 kDa, observed here at ~100 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/asic1-antibody-bha17107623</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_438228c7-c31b-40d5-ae01-e38addd94758.jpg?v=1775785992</image:loc>
      <image:title>ASIC1 Antibody</image:title>
      <image:caption>Western blot testing of mouse fetal brain lysate with ASIC1 antibody at 0.3ug/ml. Predicted molecular weight: ~65kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arylsulfatase-d-antibody-bha17106507</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ac25e230-1b4a-426a-baba-72c78a72932c.jpg?v=1775785868</image:loc>
      <image:title>Arylsulfatase D Antibody</image:title>
      <image:caption>Western blot testing of A459 lysate with Arylsulfatase D antibody with [B] and without [A] blocking/immunizing peptide. Predicted molecular weight: ~65/42kDa (isoforms alpha/beta).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/at1r-antibody-bha17105403</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_661bc0ed-3190-46a1-be91-d6a922e5b67c.jpg?v=1775785676</image:loc>
      <image:title>AT1R Antibody</image:title>
      <image:caption>Western blot testing of 1) human HeLa and 2) mouse HEPA1-6 cell lysate with AT1R antibody. Observed molecular weight ~41-50 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atf4-antibody-bha17106791</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cca40c83-3f9d-4b14-a5c0-0b9d8c2dbb38.jpg?v=1775785902</image:loc>
      <image:title>ATF4 Antibody</image:title>
      <image:caption>Western blot testing of K562 lysate with ATF4 antibody at 0.3ug/ml. Predicted molecular weight ~39 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atf2-antibody-bha17107248</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e8304a71-99aa-47af-beee-575d1ed0e993.jpg?v=1775785952</image:loc>
      <image:title>ATF2 Antibody</image:title>
      <image:caption>Western blot of human A) HepG2, B) K562 and C) HeLa cell lysate (nuclear fractions) with ATF2 antibody at 1ug/ml. Expected molecular weight: 65-70 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/aryl-hydrocarbon-receptor-antibody-bha17107337</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7721356d-7a42-486c-bf95-e615f8d7eff4.jpg?v=1775785962</image:loc>
      <image:title>Aryl Hydrocarbon Receptor Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with Aryl Hydrocarbon Receptor antibody at 0.2ug/ml. Predicted molecular weight ~ 95kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atf6-antibody-bha17107703</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_625b39b4-baf1-495e-ad5c-c1b6f8cb4a8e.jpg?v=1775786001</image:loc>
      <image:title>ATF6 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with ATF6 antibody at 2ug/ml. Predicted molecular weight: 75~90kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atf4-antibody-bha17105901</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_055b7870-252b-43aa-b26a-e546bc9dadd5.jpg?v=1775785804</image:loc>
      <image:title>ATF4 Antibody</image:title>
      <image:caption>Western blot testing of human 1) U-2 OS and 2) SW620 cell lysate with ATF4 antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/arnt-antibody-bha17106428</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f1adb213-be6f-4d40-b81b-78122d959ab8.jpg?v=1775785859</image:loc>
      <image:title>ARNT Antibody</image:title>
      <image:caption>Western blot testing of HepG2 nuclear lysate with ARNT antibody at 2ug/ml. Predicted/observed molecular weight: ~87/91-94kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/asl-antibody-adenylosuccinate-lyase-bha17106149</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e7465c14-ee2d-4e9c-9c6f-2bb80e7355fe.jpg?v=1775785817</image:loc>
      <image:title>ASL Antibody / Adenylosuccinate Lyase</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat kidney, 3) rat lung and 4) mouse liver lysate with ASL antibody at 0.5ug/ml. Predicted molecular weight ~52 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atf5-antibody-bha17107006</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_29dcdca7-f53b-41e0-b49d-84179e7043b4.jpg?v=1775785925</image:loc>
      <image:title>ATF5 Antibody</image:title>
      <image:caption>Western blot testing of human heart lyssate with ATF5 antibody at 1.5ug/ml. Predicted molecular weight: ~31kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/asna1-antibody-bha17107772</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f00065e5-cffe-4a87-947d-c60717644853.jpg?v=1775786009</image:loc>
      <image:title>ASNA1 Antibody</image:title>
      <image:caption>Western blot testing of mouse kidney lysate with ASNA1 antibody at 1ug/ml with [B] and without [A] blocking/immunizing peptide. Predicted molecular weight: ~39kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atg14l-antibody-bha17105600</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d5300461-b087-44a4-adb9-c4fd6bdfa9dc.jpg?v=1775785722</image:loc>
      <image:title>ATG14L Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) human HeLa lysate with ATG14L antibody. Expected/observed molecular weight ~59 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atg4c-antibody-apg4c-bha17106765</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_25a6937a-0c5d-4b6b-a8dc-f5c7582e1a3b.jpg?v=1775785899</image:loc>
      <image:title>ATG4C Antibody / APG4C</image:title>
      <image:caption>Western blot testing of human skeletal muscle lysate with ATG4C antibody at 2ug/ml. Predicted molecular weight: ~52kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atg3-antibody-apg3-bha17106201</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a409dd75-7552-427f-9136-0be70fc00050.jpg?v=1775785822</image:loc>
      <image:title>ATG3 Antibody / APG3</image:title>
      <image:caption>Western blot testing of 1) human K562, 2) human Raji, 3) monkey COS-7, 4) human HeLa and 5) mouse NIH 3T3 cell lysate with ATG3 antibody at 0.5ug/ml. Predicted molecular weight ~36 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atoh1-antibody-math1-n-terminal-region-bha17106214</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e74f9df9-383d-471e-b596-c766c3831ac5.jpg?v=1775785827</image:loc>
      <image:title>ATOH1 Antibody / MATH1 (N-Terminal Region)</image:title>
      <image:caption>Western blot testing of 1) human HL60 and 2) rat PC-12 cell lysate with ATOH1 antibody. Predicted molecular weight ~38 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atgl-antibody-bha17107120</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5610f96d-2954-4520-8ee6-c3910b81cb06.jpg?v=1775785937</image:loc>
      <image:title>ATGL Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with ATGL antibody at 0.03ug/ml. Predicted molecular weight ~55kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atp-citrate-lyase-antibody-acl-bha17105810</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3c643a48-2bbb-44db-98b9-ffa2eae43d55.jpg?v=1775785759</image:loc>
      <image:title>ATP Citrate Lyase Antibody / ACL</image:title>
      <image:caption>IHC testing of FFPE human colon cancer tissue with ATP Citrate Lyase antibody at 2ug/ml. HIER: steam sections in pH8 EDTA for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atxn3-antibody-bha17105478</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5982e078-bc39-45fc-8e4d-ca3d56b85807.jpg?v=1775785693</image:loc>
      <image:title>ATXN3 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) human COLO320 and 3) human HeLa lysate with ATXN3 antibody. Predicted/observed molecular weight ~42 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atgl-antibody-pnpla2-bha17107622</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a0c3df78-3c40-4445-94f2-14014b62d745.jpg?v=1775785992</image:loc>
      <image:title>ATGL Antibody / PNPLA2</image:title>
      <image:caption>Western blot testing of human adipose lysate with ATGL antibody at 0.5ug/ml. Predicted molecular weight ~55 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atg16l1-antibody-bha17107510</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d9e71754-232f-46e2-8040-bdf77f8a0987.jpg?v=1775785981</image:loc>
      <image:title>ATG16L1 Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with ATG16L1 antibody at 0.1ug/ml. Predicted molecular weight ~68 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atp5b-antibody-bha17106905</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5b433282-9c58-4db9-bdee-a9390fdd4dbf.jpg?v=1775785914</image:loc>
      <image:title>ATP5B Antibody</image:title>
      <image:caption>Western blot testing of human [A], mouse [B] and rat [C] heart lysates with ATP5B antibody at 0.3ug/ml. Predicted molecular weight: ~56kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atp1b1-antibody-bha17107493</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7d9f7916-e99d-41c6-a4ff-c1c88783d235.jpg?v=1775785979</image:loc>
      <image:title>ATP1B1 Antibody</image:title>
      <image:caption>Western blot testing of rat retina lysate with ATP1B1 antibody at 0.1ug/ml. Predicted molecular weight: ~35/45-50kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atf6-antibody-bha17106006</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cecf01bf-74d3-48fc-8aae-06cae765a859.jpg?v=1775785792</image:loc>
      <image:title>ATF6 Antibody</image:title>
      <image:caption>IHC testing of FFPE human breast cancer tissue with ATF6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atf7-antibody-bha17107228</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1f239442-db27-4a3d-8c2f-f4e5ea582158.jpg?v=1775785953</image:loc>
      <image:title>ATF7 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with ATF7 antibody at 0.5ug/ml. Predicted molecular weight: isoforms of ~53/51/50/34kDa may be detected.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/autotaxin-antibody-bha17107738</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c85f8f4d-10ea-4e45-8044-461acdbe9130.jpg?v=1775786006</image:loc>
      <image:title>Autotaxin Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with Autotaxin antibody at 0.3ug/ml. Expected molecular weight: 99-125 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atx2-antibody-bha17105642</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_36c6534c-ffc7-4809-b6a9-d6eccf3f71d2.jpg?v=1775785728</image:loc>
      <image:title>ATX2 Antibody</image:title>
      <image:caption>IHC staining of FFPE human glioma tissue with ATX2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/axin1-antibody-bha17107016</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fc53a0c1-a880-482c-8222-4ffde5bdd3fd.jpg?v=1775785927</image:loc>
      <image:title>AXIN1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human adrenal cortex with AXIN1 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atxn1-antibody-ataxin-1-bha17105479</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_472e7f75-39d2-43db-a365-105f773784d9.jpg?v=1775785696</image:loc>
      <image:title>ATXN1 Antibody / Ataxin 1</image:title>
      <image:caption>Western blot testing of human 1) MCF7, 2) COLO-320 and 3) PANC-1 lysate with ATXN1 antibody. Commonly observed molecular weight: 87-105 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/avpr1b-antibody-bha17107415</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0ead4fb2-120a-4b64-9ad0-e287addd3d96.jpg?v=1775785971</image:loc>
      <image:title>AVPR1B Antibody</image:title>
      <image:caption>Western blot testing of human amygdala lysate with AVPR1B antibody, &lt;a href=../tds/avpr1b-antibody-r35132&gt;cat # R35132&lt;/a&gt; (0.5ug/ml, lane A) and rat brain lysate with AVPR1B antibody, cat # R34558 (0.05ug/ml, lane B). Predicted molecular weight: ~47/170kDa (unmodified/modified).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/atp4b-antibody-gastric-hydrogen-potassium-atpase-beta-bha17106038</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3193c0ba-303f-4ceb-a961-a8aa6b286a1a.jpg?v=1775785799</image:loc>
      <image:title>ATP4B Antibody / Gastric hydrogen potassium ATPase beta</image:title>
      <image:caption>Western blot testing of 1) rat stomach, 2) mouse stomach and 3) human SGC-7901 (human gastric cancer) lysate with ATP4B antibody at 0.5ug/ml. Predicted molecular weight ~34 kDa (core peptide), ~52 kDa (beta subunit precursor), 60-80 kDa (glycosylated form).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/b3gnt2-antibody-bha17106838</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_df16c99c-94e0-45a5-8b57-ef625a2b54ef.jpg?v=1775785907</image:loc>
      <image:title>B3GNT2 Antibody</image:title>
      <image:caption>Western blot testing of human pancreas lysate with B3GNT2 antibody at 0.1ug/ml. Predicted molecular weight ~46 kDa but may be observed at higher molecular weights due to glycosylation. Both observed bands are blocked by addition of immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bach1-antibody-bha17107104</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fdb163d0-d352-414a-9c9a-df75d6b87931.jpg?v=1775785935</image:loc>
      <image:title>BACH1 Antibody</image:title>
      <image:caption>Western blot testing of human peripheral blood lymphocyte [A] and human spleen [B] lysate with BACH1 antibody at 1ug/ml. Predicted molecular weight: ~82kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/b3gnt8-antibody-bha17105603</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_95048a4d-0b4d-4687-bdce-799ae71f0728.jpg?v=1775785719</image:loc>
      <image:title>B3GNT8 Antibody</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate with B3GNT8 antibody. Expected/observed molecular weight ~43 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/baff-antibody-bha17105684</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5597bbfc-c935-44bd-81e9-35489c18f751.jpg?v=1775785735</image:loc>
      <image:title>BAFF Antibody</image:title>
      <image:caption>Western blot testing of 1) rat kidney, 2) rat spleen, 3) mouse spleen and 4) human placenta lysate with BAFF antibody. Expected/observed molecular weight ~31 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/azin2-antibody-antizyme-inhibitor-2-bha17105804</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5f00c43a-e2e1-4d17-b052-df3e0afc200b.jpg?v=1775785754</image:loc>
      <image:title>AZIN2 Antibody / Antizyme inhibitor 2</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain and 3) human HeLa lysate with AZIN2 antibody at 0.5ug/ml. Predicted molecular weight: 22-52 kDa (multiple isoforms).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/b7-h1-antibody-pd-l1-bha17105895</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8119d7a7-a83e-4524-901d-e74baac10f98.jpg?v=1775785773</image:loc>
      <image:title>B7-H1 Antibody / PD-L1</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate with PD-L1 / B7-H1 antibody at 0.5ug/ml. Expected molecular weight ~34/40-70 kDa (unmodified/glycosylated), observed here at ~62 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bag5-antibody-bha17106649</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d6ab02fe-0627-4a63-84d9-b3ea049b9e7e.jpg?v=1775785886</image:loc>
      <image:title>BAG5 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with BAG5 antibody at 1ug/ml. Predicted molecular weight: ~56/51kDa (isoforms a/b).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bak-antibody-bak1-bha17105577</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_93385881-34ad-47c9-a85b-c0da0153c7d3.jpg?v=1775785719</image:loc>
      <image:title>BAK Antibody / BAK1</image:title>
      <image:caption>Western blot testing of human 1) PC-3, 2) HEK293, 3) Jurkat, 4) Caco-2, 5) U-2 OS, 6) HepG2, 7) HeLa and 8) A549 lysate with BAK antibody. Expected molecular weight ~23 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/avpr1a-antibody-bha17106400</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_464ccbb1-9152-459e-b8cd-cf6181e1b947.jpg?v=1775785855</image:loc>
      <image:title>AVPR1A Antibody</image:title>
      <image:caption>Western blot testing of NIH3T3 lysate with AVPR1A antibody at 0.03ug/ml. Predicted molecular weight ~47/85kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bag3-antibody-bha17107400</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5a4fb663-aaef-473a-a8be-0b8c7e8befdd.jpg?v=1775785969</image:loc>
      <image:title>BAG3 Antibody</image:title>
      <image:caption>Western blot testing of human pancreas lysate with BAG3 antibody at 0.1ug/ml. Predicted molecular weight ~62 kDa but can be observed at 75~80 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bag1-antibody-bha17106080</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f55697ba-1579-4db1-8910-13a16ec073ea.jpg?v=1775785809</image:loc>
      <image:title>BAG1 Antibody</image:title>
      <image:caption>IHC staining of FFPE human tonsil tissue with BAG1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bbc3-antibody-bha17106556</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_17e74a6a-be4a-4bee-8286-c84e3d64118f.jpg?v=1775785876</image:loc>
      <image:title>BBC3 Antibody</image:title>
      <image:caption>Western blot testing of peripheral blood lymphocyte lysate with BBC3 antibody at 0.1ug/ml. Predicted molecular weight: ~26kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bca1-antibody-b-cell-attracting-chemokine-1-cxcl13-bha17105802</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_45ff3bcc-a80c-4836-9d89-4f0f021cd035.jpg?v=1775785756</image:loc>
      <image:title>BCA1 Antibody / B cell-attracting chemokine 1 / CXCL13</image:title>
      <image:caption>IHC staining of FFPE mouse spleen tissue with BCA1 antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bak1-antibody-bha17106344</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_26407c5d-68b4-4648-abaa-2088042bfd5d.jpg?v=1775785848</image:loc>
      <image:title>BAK1 Antibody</image:title>
      <image:caption>Western blot testing of A431 lysate with BAK1 antibody at 0.5ug/ml. Predicted molecular weight: ~23kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/baalc-antibody-bha17107442</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_aea1eb0c-5ebc-44d6-86d8-9d426c9f5510.jpg?v=1775785973</image:loc>
      <image:title>BAALC Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with BAALC antibody at 0.03ug/ml. Predicted molecular weight: ~16kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bat3-antibody-bag6-bha17107756</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d3d18634-d001-4657-885c-0633603f0ec5.jpg?v=1775786007</image:loc>
      <image:title>BAT3 Antibody / BAG6</image:title>
      <image:caption>IHC testing of FFPE human spleen (nucleoli staining) with BAT3 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bbs4-antibody-bha17107595</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3e4764a8-3c38-47cd-adae-125053220291.jpg?v=1775785990</image:loc>
      <image:title>BBS4 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with BBS4 antibody at 1ug/ml. Predicted molecular weight: ~58kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bbs7-antibody-bha17107106</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_32a488aa-11ce-4f38-bc17-12195afa0aa0.jpg?v=1775785935</image:loc>
      <image:title>BBS7 Antibody</image:title>
      <image:caption>Western blot testing of human skeletal muscle lysate with BBS7 antibody at 1ug/ml. Predicted molecular weight: ~80kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bag5-antibody-bha17106628</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c2c1e446-3930-4744-b889-4926248857ec.jpg?v=1775785884</image:loc>
      <image:title>BAG5 Antibody</image:title>
      <image:caption>Western blot testing of nuclear HeLa lysate with BAG5 antibody at 2ug/ml. Predicted molecular weight: ~56/51 kDa (isoforms a/b).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bag2-antibody-bha17106472</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2bb05c03-3549-4399-83e3-934e10bdf05d.jpg?v=1775785865</image:loc>
      <image:title>BAG2 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with BAG2 antibody at 0.3ug/ml. Predicted molecular weight: ~22kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bag5-antibody-bha17106095</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cc13e8b9-240c-41f5-baaf-1e628646c558.jpg?v=1775785808</image:loc>
      <image:title>BAG5 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human T-47D cells with BAG5 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bcl-xl-antibody-bha17106062</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7f168e5a-967e-4f5e-9fa8-34046a4e8da8.jpg?v=1775785805</image:loc>
      <image:title>Bcl-XL Antibody</image:title>
      <image:caption>Flow cytometry testing of fixed and permeabilized human Jurkat cells with Bcl-XL antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Bcl-XL antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bche-antibody-butyrylcholinesterase-bha17105524</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4981343c-6feb-4313-ba74-f2e10e09ca02.jpg?v=1775785703</image:loc>
      <image:title>BCHE Antibody / Butyrylcholinesterase</image:title>
      <image:caption>Western blot testing of mouse liver tissue lysate with BCHE antibody. Expected molecular weight: 66-110 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bcl2-antibody-bha17106309</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5e27b7d3-c2e6-4b05-aa08-234ca2bff76a.jpg?v=1775785841</image:loc>
      <image:title>BCL2 Antibody</image:title>
      <image:caption>Western blot testing of human lymph lysate with BCL2 antibody at 0.1ug/ml. Expected molecular weight: ~26kDa (alpha) and ~22kDa (beta).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bax-antibody-bha17106061</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_50a8bd2f-d9ec-4789-9d70-2be4fb056592.jpg?v=1775785805</image:loc>
      <image:title>Bax Antibody</image:title>
      <image:caption>IHC staining of FFPE human lung cancer tissue with Bax antibody, HRP-labeled secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bcr-antibody-breakpoint-cluster-region-protein-bha17105792</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3cda3c5d-6ef5-488c-9a5a-ebee2a7c2e57.jpg?v=1775785754</image:loc>
      <image:title>BCR Antibody / Breakpoint cluster region protein</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with BCR antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bcl-2-antibody-bha17106278</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d5ab5c09-ab90-4f64-897a-6d318e79566f.jpg?v=1775785837</image:loc>
      <image:title>Bcl-2 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with Bcl-2 antibody (red) and Alpha Tubulin antibody (green). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bcor-antibody-bha17107563</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ae1de759-2023-4eee-af1b-892e2947c52d.jpg?v=1775785988</image:loc>
      <image:title>BCOR Antibody</image:title>
      <image:caption>BCOR Antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bcl2a1-antibody-bha17107717</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e3e94f3a-28b4-475b-9a42-3aa5a97cd8c5.jpg?v=1775786004</image:loc>
      <image:title>Bcl2A1 Antibody</image:title>
      <image:caption>Western blot testing of human bone marrow lysate with Bcl2A1 antibody at 0.2ug/ml. Predicted molecular weight: ~20kDa but may be observed at up to ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bdkrb1-antibody-bha17107522</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6bbb158e-7ec6-464c-bb11-99769a0680e7.jpg?v=1775785982</image:loc>
      <image:title>BDKRB1 Antibody</image:title>
      <image:caption>Western blot testing of K562 lysate with BDKRB1 antibody at 2ug/ml. Predicted molecular weight: ~40kDa, but can be observed at ~35kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/beta-arrestin-2-antibody-bha17107108</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5662a277-3fdf-4ad7-ad66-be3718208524.jpg?v=1775785938</image:loc>
      <image:title>Beta-Arrestin 2 Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with beta-Arrestin 2 antibody at 0.3ug/ml. Predicted molecular weight: 44~47 kDa (isoforms 1-5).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bdnf-antibody-bha17106982</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_affe8312-d9da-4636-b1ac-e6d68b0d36a3.jpg?v=1775785922</image:loc>
      <image:title>BDNF Antibody</image:title>
      <image:caption>Immunofluorescent staining of fixed and permeabilized human U-251 cells with BDNF antibody (green) at 10ug/ml and DAPI nuclear stain.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bbs4-antibody-bha17106851</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_46aea853-f853-4d53-bf67-f51f947b8ff1.jpg?v=1775785909</image:loc>
      <image:title>BBS4 Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with BBS4 antibody at 1ug/ml. Predicted molecular weight: ~58kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/beta-cstf-64-antibody-variants-1-and-3-bha17107729</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_14068a5e-3333-49d4-b71e-f96f2d9e65bb.jpg?v=1775786004</image:loc>
      <image:title>Beta CstF-64 Antibody (variants 1 &amp; 3)</image:title>
      <image:caption>HeLa lysate either in RIPA (lanes 1, 2, 4, 6) or TX100 buffer (lanes 3, 5, 7) overexpressing mouse beta Cstf-64-FLAG immunoprecipitated using beta Cstf-64 (2ug) antibody in lanes 6 &amp; 7 and probed with anti-FLAG [1/1000]. Mock-transfected HeLa in Lane 1.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bdkrb2-antibody-b2-bradykinin-receptor-bha17105833</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e238e356-854d-46f4-b52b-1ea498c66eef.jpg?v=1775785761</image:loc>
      <image:title>BDKRB2 Antibody / B2 bradykinin receptor</image:title>
      <image:caption>Western blot testing of 1) human HaCaT, 2) human A431, 3) human A549, 4) human MCF7, 5) rat C6 and 6) mouse Neuro-2a cell lysate with BDKRB2 antibody at 0.5ug/ml. Predicted molecular weight ~44 kDa but may be observed at higher molecular weights due to glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bcl7a-antibody-bha17107571</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2a23b7c7-9008-4a32-8ba6-f41074a59270.jpg?v=1775785986</image:loc>
      <image:title>BCL7A Antibody</image:title>
      <image:caption>Western blot testing of human lymph node lysate with BCL7A antibody at 1ug/ml. Predicted molecular weight: ~25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bhmt-antibody-bha17106924</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_47d3115e-f772-4c56-b44f-1dc1ff7684e1.jpg?v=1775785917</image:loc>
      <image:title>BHMT Antibody</image:title>
      <image:caption>Western blot testing of rat liver lysate with BHMT antibody at 0.03ug/ml. Predicted molecular weight: ~45kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/beta-2-adrenergic-receptor-antibody-bha17107175</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_58dba711-4ff0-4e74-8d71-fdcef5b723c6.jpg?v=1775785945</image:loc>
      <image:title>Beta-2-Adrenergic receptor Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with beta-2-Adrenergic receptor antibody at 0.2ug/ml. Predicted molecular weight ~46 kDa, but commonly observed at up to 85 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/beta-iii-tubulin-antibody-bha17105925</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a2e1b0f0-f848-45aa-a89c-2b195c2a8b40.jpg?v=1775785780</image:loc>
      <image:title>Beta III Tubulin Antibody</image:title>
      <image:caption>IHC testing of FFPE human breast cancer with Beta III Tubulin antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bid-antibody-bha17106148</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8dbedf01-a93b-4294-a3cb-aee565ee70dd.jpg?v=1775785819</image:loc>
      <image:title>Bid Antibody</image:title>
      <image:caption>Western blot testing of mouse brain tissue with Bid antibody at 0.5ug/ml. Predicted molecular weight ~22 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bim-antibody-bcl2l11-bha17107020</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0b2ed19a-dce0-4252-b0f0-8c1e04bc4a33.jpg?v=1775785927</image:loc>
      <image:title>Bim Antibody / BCL2L11</image:title>
      <image:caption>Western blot testing of K562 lysate with Bim antibody at 0.5ug/ml. Predicted molecular weight: 12-22 kDa (three isoforms).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bend5-antibody-bha17106413</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_12244ef2-8b2a-46ff-a3f0-70be4ea54edc.jpg?v=1775785858</image:loc>
      <image:title>BEND5 Antibody</image:title>
      <image:caption>Western blot testing of Daudi [A], human tonsil [B], human spleen [C] and mouse spleen [D] lysates with BEND5 antibody at 0.3ug/ml. Predicted molecular weight: ~48kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/blnk-antibody-bha17107280</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0fced732-c516-40c3-9249-e9f62c8ae8a8.jpg?v=1775785956</image:loc>
      <image:title>BLNK Antibody</image:title>
      <image:caption>Western blot testing of Daudi lysate with BLNK antibody at 4ug/ml. Predicted molecular weight: ~51kDa but can be observed at 65-70kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bik-antibody-bcl2-interacting-killer-bha17105547</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b61138ac-a66d-47b9-9ef3-6408703f8fc0.jpg?v=1775785709</image:loc>
      <image:title>BIK Antibody / BCL2-interacting killer</image:title>
      <image:caption>Western blot testing of 1) rat spleen, 2) rat stomach, 3) rat intestine, 4) human MCF7, 5) human A549 and 6) human SKOV lysate with BIK antibody. Expected molecular weight ~18 kDa but routinely observed at 18-22 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/biglycan-antibody-bha17106681</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e8bd8c5c-4ec8-48bb-8e6c-44f82b853d14.jpg?v=1775785891</image:loc>
      <image:title>Biglycan Antibody</image:title>
      <image:caption>Western blot testing of rat skin lysate with Biglycan antibody at 0.1ug/ml. Predicted molecular weight: ~42 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bmp4-antibody-bha17105299</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6623f612-13fa-4285-bc2c-89ff4c0d2e50.jpg?v=1775785674</image:loc>
      <image:title>BMP4 Antibody</image:title>
      <image:caption>Western blot testing of mouse 1) lung, 2) liver, 3) HEPA and human 4) HepG2, 5) HeLa lysate with BMP4 antibody. Predicted molecular weight: 54 kDa (precursor), 44 kDa (cleaved dimer), 23 kDa (cleaved monomer).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/beta-catenin-antibody-bha17106102</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b5869930-a5e9-4d25-bf79-4b77c0780003.jpg?v=1775785813</image:loc>
      <image:title>Beta Catenin Antibody</image:title>
      <image:caption>Western blot testing of 1) human placenta, 2) human A431, 3) human SK-OV-3, 4) rat heart and 5) mouse testis lysate with Beta Catenin antibody at 0.5ug/ml. Predicted molecular weight ~85 kDa, but routinely observed at 90-95 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bmp-antibody-bha17106712</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c32350a5-ab40-499e-b674-2b6ab44f3cfc.jpg?v=1775785895</image:loc>
      <image:title>BMP Antibody</image:title>
      <image:caption>Western blot testing of human heart [A] and kidney [B] lysates with BMP antibody at 1ug/ml. Predicted molecular weight: ~111 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bmpr1a-antibody-bha17107481</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_549a1bd3-fc5d-43f8-993d-bbe60d50aed7.jpg?v=1775785977</image:loc>
      <image:title>BMPR1A Antibody</image:title>
      <image:caption>Western blot testing of HeLa cell lysate with BMPR1A antibody at 1ug/ml. Molecular weight: he expected ~60kDa band and additional ~20kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bmp15-antibody-bone-morphogenetic-protein-15-bha17105834</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_85f134e8-a8d8-458f-94df-cbce73811ad1.jpg?v=1775785762</image:loc>
      <image:title>BMP15 Antibody / Bone morphogenetic protein 15</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) MCF7 cell lysate with BMP15 antibody at 0.5ug/ml. Routinely observed molecular weight: ~50 kDa pro form and 16-17 kDa mature form.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bmi1-antibody-bha17107619</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9c989272-ff48-4d32-b35b-46caefb1759b.jpg?v=1775785991</image:loc>
      <image:title>BMI1 Antibody</image:title>
      <image:caption>Western blot testing of K562 nuclear lysate with BMI1 antibody at 0.03ug/ml. Predicted molecular weight: 37-43 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bmp6-antibody-bha17105361</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bf17373a-7ce7-4123-a91d-8a2764c86ff6.jpg?v=1775785677</image:loc>
      <image:title>BMP6 Antibody</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate with BMP6 antibody. Expected molecular weight: ~57 kDa (precursor), ~46 kDa (cleaved precursor), 18-23 kDa (mature).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bmp2-antibody-bha17105298</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_82728a2d-2d3d-4a25-9715-a85efdc6738a.jpg?v=1775785673</image:loc>
      <image:title>BMP2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat lung, 3) human U87, 4) human HeLa lysate with BMP2 antibody. Expected molecular weight: 13-14 kDa per monomer.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bmp5-antibody-bha17105360</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5160606d-0c41-4c84-bc35-0a66ef332a03.jpg?v=1775785677</image:loc>
      <image:title>BMP5 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse liver, 3) human A549 lysate with BMP5 antibody. Expected/observed molecular weight ~51 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bmpr2-antibody-bha17106606</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1b9dd5cc-3ccd-40a6-b1d3-bd1979f9293b.jpg?v=1775785880</image:loc>
      <image:title>BMPR2 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with BMPR2 antibody at 1ug/ml. Predicted molecular weight ~115 kDa (precursor).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bmp4-antibody-bone-morphogenetic-protein-4-bha17106121</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b9929e36-9f4f-4008-a798-b7f00ed0895c.jpg?v=1775785809</image:loc>
      <image:title>BMP4 Antibody / Bone morphogenetic protein 4</image:title>
      <image:caption>Western blot testing of 1) human HepG2, 2) human U-2 OS, 3) human Caco-2, 4) rat lung and 5) mouse lung tissue lysate with BMP4 antibody at 0.5ug/ml. Expected molecular weight: 54 kDa (precursor), 44 kDa (cleaved dimer), 23 kDa (cleaved monomer).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bnip1-antibody-bha17106617</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f395e0be-a1b8-48c6-bf59-9b6d7fe1a8db.jpg?v=1775785882</image:loc>
      <image:title>BNIP1 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with BNIP1 antibody at 0.5ug/ml. Predicted molecular weight: ~26kDa. Both bands are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bmal1-antibody-brain-and-muscle-arnt-like-1-bha17105947</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0a5a0164-1f12-464f-9751-2e8752dc83c5.jpg?v=1775785783</image:loc>
      <image:title>BMAL1 Antibody / Brain and muscle ARNT-like 1</image:title>
      <image:caption>Flow cytometry testing of fixed and permeabilized human MCF7 cells with BMAL1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= BMAL1 antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bpi-antibody-bha17107352</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5e16e1c8-8851-4611-a8fb-d574d243e35f.jpg?v=1775785963</image:loc>
      <image:title>BPI Antibody</image:title>
      <image:caption>Western blot testing of human bone marrow lysate with BPI antibody at 0.3ug/ml. Predicted molecular weight: ~54kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/brain-creatine-kinase-antibody-ckb-bha17107430</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1053dedb-6b5b-4d51-97f8-b1ff5da31208.jpg?v=1775785972</image:loc>
      <image:title>Brain Creatine Kinase Antibody / CKB</image:title>
      <image:caption>Western blot testing of human brain lysate with brain Creatine Kinase antibody at 0.1ug/ml. Predicted molecular weight: ~43 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/brms1-antibody-bha17106087</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ac7aa357-c2ca-480b-a47c-adedac8ed465.jpg?v=1775785806</image:loc>
      <image:title>BRMS1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat kidney, 2) rat liver, 3) mouse liver and 4) human HeLa lysate with BRMS1 antibody at 0.5ug/ml. Predicted molecular weight ~28 kDa, often observed at ~35 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/brca1-antibody-bha17106025</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_83e8d017-326b-43bd-8d01-900d86eb91bd.jpg?v=1775785797</image:loc>
      <image:title>BRCA1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with BRCA1 antibody (green) and Beta Tubulin mAb (red). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/btd-antibody-bha17106831</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_adc909c3-e006-40a6-b42c-a8ba6095f59c.jpg?v=1775785907</image:loc>
      <image:title>BTD Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with BTD antibody at 0.5ug/ml. Predicted molecular weight: ~61kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bruno-like-5-antibody-bha17106911</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f2ddccf6-7dfa-4d0c-8414-97f1f8a2e072.jpg?v=1775785914</image:loc>
      <image:title>Bruno-like 5 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with Bruno-like 5 antibody at 1ug/ml. Predicted molecular weight: ~52kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/btla-antibody-cd272-bha17107287</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_eb3c0300-8d3e-488f-986a-d1c258b60b6e.jpg?v=1775785956</image:loc>
      <image:title>BTLA Antibody / CD272</image:title>
      <image:caption>Western blot testing of mouse spleen lysate with BTLA antibody at 1ug/ml. Predicted molecular weight ~33kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/bst2-antibody-bha17106877</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_92ed3756-eca6-4503-80f3-403c2c7677c8.jpg?v=1775785910</image:loc>
      <image:title>BST2 Antibody</image:title>
      <image:caption>Western blot testing of human spleen lysate with BST2 antibody at 0.3ug/ml. Expected molecular weight: 20-40 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/btbd7-antibody-bha17106965</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bcd56296-7e3b-49ae-967b-e40dec42b1d1.jpg?v=1775785922</image:loc>
      <image:title>BTBD7 Antibody</image:title>
      <image:caption>Western blot of MDCK lysate overexpressing mouse Btbd7 (lane 3) tested with BTBD7 antibody. Lane 1: mock transfection, lane 2: full construct chemically suppressed</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/c14orf68-antibody-bha17107486</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0fbb0831-9db4-46d9-a66d-9d71d8d5fe84.jpg?v=1775785978</image:loc>
      <image:title>C14orf68 Antibody</image:title>
      <image:caption>IHC testing of FFPE human liver with C14orf68 antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/c-raf-antibody-raf1-bha17106131</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a4032144-b668-40ef-b30f-4ca3d6de22be.jpg?v=1775785813</image:loc>
      <image:title>c-Raf Antibody / Raf1</image:title>
      <image:caption>Western blot testing of 1) rat kidney, 2) mouse kidney, 3) human MCF7, 4) human 22RV1 and 5) human HeLa lysate with c-Raf antibody at 0.5ug/ml. Predicted molecular weight ~73 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/c-rel-antibody-bha17105321</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_64f4e55c-70fe-40eb-ab25-2dc3a08e3391.jpg?v=1775785680</image:loc>
      <image:title>c-Rel Antibody</image:title>
      <image:caption>Western blot testing of 1) rat kidney and 2) human HeLa lysate with c-Rel antibody. Expected/observed molecular weight ~69 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/c1qbp-antibody-gc1q-r-bha17105710</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_949c417c-4d3f-437b-adf0-5486d0282f46.jpg?v=1775785737</image:loc>
      <image:title>C1QBP Antibody / GC1q R</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse spleen and 3) human MCF7 lysate with C1QBP antibody. Expected molecular weight ~31 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/c9-antibody-complement-c9-bha17106984</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5ec0a21e-fb44-4041-aa45-0773be482b7c.jpg?v=1775785923</image:loc>
      <image:title>C9 Antibody / Complement C9</image:title>
      <image:caption>Western blot testing of human placenta lysate with C9 antibody at 2ug/ml. Predicted molecular weight: ~63/70kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ca3-antibody-carbonic-anhydrase-iii-bha17105835</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5bc031bb-0a41-406e-b43c-702c7037183f.jpg?v=1775785761</image:loc>
      <image:title>CA3 Antibody / Carbonic Anhydrase III</image:title>
      <image:caption>Western blot testing of 1) rat muscle and 2) mouse muscle with CA3 antibody at 0.5ug/ml. Predicted/observed molecular weight ~29 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cacnb4-antibody-bha17106733</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6f76a395-f29d-43cb-8afb-a6e4eb996307.jpg?v=1775785896</image:loc>
      <image:title>CACNB4 Antibody</image:title>
      <image:caption>Western blot testing of human bone marrow lysate with CACNB4 antibody at 0.2ug/ml. Predicted molecular weight: ~58/55/56kDa (isoforms a/b/c).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cabp1-antibody-l-and-s-isoforms-bha17107064</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_38ad5b8a-d5d7-4209-86ce-1cc24724d15a.jpg?v=1775785931</image:loc>
      <image:title>CABP1 Antibody [L- and S- isoforms]</image:title>
      <image:caption>Western blot testing of human brain lysate with CABP1 antibody at 1ug/ml. Predicted molecular weight: ~26/19kDa (L/S isoforms), observed here at ~19kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cacnb2-antibody-bha17106763</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a4747d3e-b646-4ce4-9c12-1e60ea0e0c06.jpg?v=1775785897</image:loc>
      <image:title>CACNB2 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with CACNB2 antibody at 1ug/ml. Predicted molecular weight: ~68kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cadm1-antibody-bha17107001</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b9fb87fd-77e0-48c0-8b13-9a64525ca484.jpg?v=1775785923</image:loc>
      <image:title>CADM1 Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with CADM1 antibody at 1ug/ml. Predicted molecular weight: ~48/37kDa (isoforms 1/2) with N-linked and O-linked glycosylation each possibly adding ~25kDa to the observed size.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ca2-antibody-carbonic-anhydrase-2-bha17105793</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5e41921a-722d-4962-a6e4-bbc58ba623b2.jpg?v=1775785754</image:loc>
      <image:title>CA2 Antibody / Carbonic Anhydrase 2</image:title>
      <image:caption>Western blot testing of 1) rat ovary, 2) mouse liver and 3) human MCF7 lysate with CA2 antibody at 0.5ug/m. Predicted/observed molecular weight ~29 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ca4-antibody-carbonic-anhydrase-4-bha17106009</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_07bcc3f4-a2f7-45dd-962b-fb278309b512.jpg?v=1775785792</image:loc>
      <image:title>CA4 Antibody / Carbonic anhydrase 4</image:title>
      <image:caption>Western blot testing of 1) rat lung and 2) mouse lung tissue with CA4 antibody at 0.5ug/ml. Predicted molecular weight ~35 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/caldesmon-antibody-cald1-cad-bha17105724</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3393c00e-f7b5-4ccf-9122-60ab0ca8135a.jpg?v=1775785740</image:loc>
      <image:title>Caldesmon Antibody / CALD1 / CAD</image:title>
      <image:caption>Immunofluorescent staining of FFPE human SiHa cells with Caldesmon antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/calcineurin-a-antibody-ppp3ca-bha17105536</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_68634a50-fc55-4b69-9d23-d14ff2a9c361.jpg?v=1775785704</image:loc>
      <image:title>Calcineurin A Antibody / PPP3CA</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) A549 and 3) COLO320 lysate with Calcineurin A antibody. Predicted molecular weight ~61 kDa, observed here at ~84 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/c7-antibody-complement-c7-bha17107598</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b543242f-9f2d-496c-a09f-297fd1b41401.jpg?v=1775785990</image:loc>
      <image:title>C7 Antibody / Complement C7</image:title>
      <image:caption>Western blot testing of human liver lysate with C7 antibody at 0.1ug/ml. Predicted molecular weight: ~94 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cacnb4-antibody-bha17106474</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_53c33048-55f7-4e5c-a8c1-9d8ee0d984fd.jpg?v=1775785865</image:loc>
      <image:title>CACNB4 Antibody</image:title>
      <image:caption>Western blot testing of human bone marrow lysate with CACNB4 antibody at 0.2ug/ml. Predicted molecular weight: ~58/55/56kDa (isoforms a/b/c).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cadm1-antibody-bha17107655</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6b6734ed-d191-4f60-abf1-b8dc0fb9c556.jpg?v=1775785996</image:loc>
      <image:title>CADM1 Antibody</image:title>
      <image:caption>Western blot testing of human colorectal cancer lysate with CADM1 antibody at 1ug/ml. Predicted molecular weight: ~48/37kDa (isoforms 1/2) with N-linked and O-linked glycosylation each possibly adding ~25kDa to the observed size.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cadm4-antibody-bha17107270</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d8b6d18b-08b2-42d1-b4ba-f4b83b56bfc1.jpg?v=1775785954</image:loc>
      <image:title>CADM4 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with CADM4 antibody A) cat # R34370 (0.1ug/ml) and B) cat # &lt;a href=../tds/cadm4-antibody-r35577&gt;R35577&lt;/a&gt; (0.05ug/ml). Predicted molecular weight: ~43/50-70kDa (unmodified/glycosylated)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/calpain-2-antibody-capn2-bha17106231</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_961ef447-a5a5-4fbc-9c5b-261f4ec87d3d.jpg?v=1775785830</image:loc>
      <image:title>Calpain 2 Antibody / CAPN2</image:title>
      <image:caption>Western blot testing of 1) rat kidney, 2) mouse kidney, 3) mouse lung and 4) human MCF7 lysate with Calpain 2 antibody at 0.5ug/ml. Predicted molecular weight ~80 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/calpastatin-antibody-bha17105900</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d82f0024-9d59-44ef-8a76-8bc52a40a092.jpg?v=1775785776</image:loc>
      <image:title>Calpastatin Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with Calpastatin antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/calreticulin-antibody-bha17107167</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_eea83ba6-9e17-405d-8893-0ee0f177036c.jpg?v=1775785945</image:loc>
      <image:title>Calreticulin Antibody</image:title>
      <image:caption>Western blot testing of human [A] and rat [B] lung lysates with Calreticulin antibody at 0.01ug/ml. Predicted molecular weight ~48kDa but routinely observed at 55~60kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/calponin-3-antibody-bha17107125</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8b8b5a14-d3dc-487d-b7de-48a2c62a8b50.jpg?v=1775785940</image:loc>
      <image:title>Calponin 3 Antibody</image:title>
      <image:caption>Western blot testing of human duodenum lysate with Calponin 3 antibody at 0.3ug/ml. Predicted molecular weight: ~36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/calpain-1-antibody-bha17107583</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_59c85326-72be-4b95-ac3d-3ebb9554e87f.jpg?v=1775785988</image:loc>
      <image:title>Calpain 1 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with Calpain 1 antibody at 0.3ug/ml. Predicted molecular weight: ~82kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/calbindin-1-antibody-calb1-bha17107495</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9edc91a0-ebb2-4bd3-954b-07993408424b.jpg?v=1775785981</image:loc>
      <image:title>Calbindin 1 Antibody / CALB1</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with Calbindin 1 antibody at 0.03ug/ml. Predicted molecular weight: ~30 kDa, routinely observed at 27-28 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/capzb-antibody-beta-2-form-specific-bha17107592</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_42f1101f-d073-4d76-9738-556513406fe7.jpg?v=1775785988</image:loc>
      <image:title>CAPZB Antibody [beta 2 form specific]</image:title>
      <image:caption>Western blot of human Jurkat (A), HeLa (B) and mouse NIH3T3 (C) lysates with CAPZB antibody at 0.01ug/ml. Predicted molecular weight: ~30kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/capg-antibody-bha17107261</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9555e5a4-1143-4d4d-a748-6a16cc6bf866.jpg?v=1775785953</image:loc>
      <image:title>CAPG Antibody</image:title>
      <image:caption>Western blot testing of U937 [A] and human spleen [B] lysates with CAPG antibody at 0.3ug/ml. Predicted molecular weight: ~38kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/camk1d-antibody-bha17106349</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b933c696-8702-40a4-a225-22ded22fc8b6.jpg?v=1775785849</image:loc>
      <image:title>CAMK1D Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with CAMK1D antibody at 0.5ug/ml. Predicted molecular weight: ~40kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/caprin1-antibody-gpip137-bha17106927</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_16376f5d-3929-4418-9281-97fe62f1667c.jpg?v=1775785916</image:loc>
      <image:title>CAPRIN1 Antibody / GPIP137</image:title>
      <image:caption>Western blot testing of Jurkat [A] and HeLa [B] lysates with CAPRIN1 antibody at 0.3ug/ml. Predicted molecular weight: ~78kDa but often observed at ~116kDa (phosphorylated CAPRIN1) as well as ~137kDa (GPIP137).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/capg-antibody-bha17107624</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_71d97286-8d51-40f3-93d1-3e3eb363fc12.jpg?v=1775785992</image:loc>
      <image:title>CAPG Antibody</image:title>
      <image:caption>Western blot testing of U937 [A] and human spleen [B] lysates with CAPG antibody at 0.3ug/ml. Predicted molecular weight: ~38kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cannabinoid-receptor-antibody-bha17107218</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f17dddad-24ec-4bea-aaca-7ea35ed25076.jpg?v=1775785949</image:loc>
      <image:title>Cannabinoid Receptor Antibody</image:title>
      <image:caption>Western blot testing of rat brain lysate with Cannabinoid Receptor antibody at 0.1ug/ml. Predicted molecular weight ~53 kDa, can also be observed at ~70kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/calcium-sensing-receptor-antibody-casr-bha17105735</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c8867819-8964-43e4-9aa1-42c1a5b75a1c.jpg?v=1775785742</image:loc>
      <image:title>Calcium Sensing Receptor Antibody / CASR</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) 22RV1 cell lysate with Calcium Sensing Receptor antibody. Predicted molecular weight ~121 kDa, but is routinely observed at up to ~160 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/carboxypeptidase-b2-antibody-cpb2-tafi-bha17105800</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3fcbd02c-3158-4b2a-9d24-34449256e6a5.jpg?v=1775785757</image:loc>
      <image:title>Carboxypeptidase B2 Antibody / CPB2 / TAFI</image:title>
      <image:caption>Western blot testing of 1) human placenta and 2) HepG2 lysate with Carboxypeptidase B2 antibody at 0.5ug/ml. Predicted molecular weight: ~48 kDa but routinely observed at 50-60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cap1-antibody-bha17105697</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_21066166-5037-4894-994b-c414e52f964c.jpg?v=1775785736</image:loc>
      <image:title>CAP1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat thymus, 2) rat spleen, and 3) human SMMC-7721 lysate with CAP1 antibody. Predicted molecular weight ~52 kDa, but routinely observed at 55-60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/card6-antibody-bha17106354</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0b83b3ef-64dc-4973-a089-6a649b783048.jpg?v=1775785849</image:loc>
      <image:title>CARD6 Antibody</image:title>
      <image:caption>IHC testing of FFPE human pancreas with CARD6 antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/caspase-6-antibody-bha17106219</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d55fe6e4-69f2-42f2-9758-d9b34a3b7f1b.jpg?v=1775785827</image:loc>
      <image:title>Caspase-6 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat kidney and 2) mouse kidney with Caspase-6 antibody at 0.5ug/ml. Predicted molecular weight ~33 kDa (precursor).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/carboxypeptidase-m-antibody-cpm-bha17105923</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_40962e38-2252-4225-bf5f-1bfdf4b8fc22.jpg?v=1775785777</image:loc>
      <image:title>Carboxypeptidase M Antibody / CPM</image:title>
      <image:caption>Western blot testing of human HepG2 cell lysate with Carboxypeptidase M antibody at 0.5ug/ml. Expected molecular weight: 51-65 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cav3-antibody-caveolin-3-bha17106817</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b804a471-c512-48b8-b9b7-281c2551839b.jpg?v=1775785904</image:loc>
      <image:title>CAV3 Antibody / Caveolin-3</image:title>
      <image:caption>Western blot testing of human heart lysate with CAV3 antibody at 0.3ug/ml. Predicted molecular weight: ~17 kDa but routinely observed at 20~25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/caspase-6-antibody-bha17107686</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5d960e06-4875-405a-b52c-41c75e149f41.jpg?v=1775785999</image:loc>
      <image:title>Caspase 6 Antibody</image:title>
      <image:caption>Western blot testing of human colon lysate with Caspase 6 antibody at 0.5ug/ml. Predicted molecular weight: ~33 kDa (precursor).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/caspase-7-antibody-bha17105485</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_aa401985-0b1f-4f2a-829a-b351a08fce06.jpg?v=1775785695</image:loc>
      <image:title>Caspase-7 Antibody</image:title>
      <image:caption>Western blot testing of 1) human A549, 2) rat spleen and 3) rat lung lysate using Caspase-7 antibody. Expected/observed molecular weight ~34 kDa (full length).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/caspase-2-antibody-bha17105439</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_912dd1ff-7491-46ed-9f4c-05908e7a22b4.jpg?v=1775785687</image:loc>
      <image:title>Caspase-2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat lung, 2) mouse liver, 3) human A549, 4) PANC and 5) 293 lysate with Caspase-2 antibody. Predicted molecular weight: ~47 kDa (full), ~31 kDa (large+small subunit), ~11 kDa (small subunit).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cathepsin-f-antibody-bha17106396</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ec50df84-35ea-4041-b0a9-5ff00938e48b.jpg?v=1775785854</image:loc>
      <image:title>Cathepsin F Antibody</image:title>
      <image:caption>Western blot testing of human ovay lysate with Cathepsin F antibody at 0.3ug/ml. Routinely observed at 30-35kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cb1-antibody-bha17107627</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_34ade2bb-09a5-45a5-b7e9-7bed09ac08b0.jpg?v=1775785993</image:loc>
      <image:title>CB1 Antibody</image:title>
      <image:caption>Western blot testing of rat brain lysate with CB1 antibody at 0.3ug/ml. Predicted molecular weight ~53kDa, can also be observed at ~70kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/catalase-antibody-bha17105712</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b0c3a50e-0503-4ff5-a091-de321e5502dc.jpg?v=1775785737</image:loc>
      <image:title>Catalase Antibody</image:title>
      <image:caption>Western blot testing of 1) rat skeletal muscle, 2) mouse skeletal muscle and 3) human A549 lysate with Catalase antibody. Expected/observed molecular weight ~60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cathepsin-k-antibody-bha17107498</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_525dc7ec-9dcc-486d-980c-1491cc23ae7b.jpg?v=1775785980</image:loc>
      <image:title>Cathepsin K Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with Cathepsin K antibody at 1ug/ml. Predicted molecular weight ~37 kDa, with an ~46 kDa pro form and an ~27 kDa mature form.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cbara1-antibody-micu1-bha17107009</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_98e4b23d-d66f-4804-aeae-6ab8e79fd119.jpg?v=1775785926</image:loc>
      <image:title>CBARA1 Antibody / MICU1</image:title>
      <image:caption>Western blot testing of K562 lysate with CBARA1 antibody at 0.5ug/ml. Predicted molecular weight: ~55 kDa. Both observed bands are blocked with addition of the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cbfb-antibody-core-binding-factor-subunit-beta-bha17106755</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0ec0da98-56fe-4faa-b769-31c7faad159d.jpg?v=1775785897</image:loc>
      <image:title>CBFB Antibody / Core-binding factor subunit beta</image:title>
      <image:caption>Western blot testing of human Daudi lysate with CBFB antibody at 0.3ug/ml. Predicted molecular weight: ~22 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/caveolin-1-antibody-bha17106531</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9405a199-03e6-4df2-af5b-1f5621b7e89a.jpg?v=1775785873</image:loc>
      <image:title>Caveolin 1 Antibody</image:title>
      <image:caption>Western blot testing of human spleen lysate with Caveolin 1 antibody at 0.01ug/ml. Alpha and beta CAV1 differ by 30 amino acids at the N-terminus.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccl3-antibody-mip-1-alpha-bha17105282</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_227702b5-4f9a-436a-903f-23f0d0705dd2.jpg?v=1775785677</image:loc>
      <image:title>CCL3 Antibody / MIP-1 alpha</image:title>
      <image:caption>Western blot testing of human Jurkat cell lysate with CCL3 antibody. Expected molecular weight: 11/8 kDa (precursor/mature).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cathepsin-g-antibody-ctsg-bha17105839</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_753db691-ca0d-4d68-94d6-dcaaf733d9f4.jpg?v=1775785763</image:loc>
      <image:title>Cathepsin G Antibody / CTSG</image:title>
      <image:caption>IHC staining of FFPE human tonsil tissue with Cathepsin G antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cckar-antibody-bha17107015</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f53baca9-6d4f-4ff0-8d4d-96554082c3cc.jpg?v=1775785925</image:loc>
      <image:title>CCKAR Antibody</image:title>
      <image:caption>IHC testing of FFPE human pancreas with CCKAR antibody at 10ug/ml. HIER: microwaved with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccl20-antibody-mip-3-alpha-bha17106150</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c2ebe029-b5ec-44ff-bf0e-4f09fbcd57d8.jpg?v=1775785816</image:loc>
      <image:title>Ccl20 Antibody / Mip-3 alpha</image:title>
      <image:caption>Western blot testing of 1) rat testis and 2) mouse testis tissue lysate with Ccl20 antibody at 0.5ug/ml. Predicted molecular weight ~11 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/catalase-antibody-bha17106601</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_deb165c9-21d5-40fc-8237-aa65c7b7dd50.jpg?v=1775785880</image:loc>
      <image:title>Catalase Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with Catalase antibody at 1ug/ml. Predicted molecular weight ~60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/caspase-4-antibody-large-subunit-bha17106411</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b9e1fa6c-f91c-429d-bfdd-65b7ab079073.jpg?v=1775785856</image:loc>
      <image:title>Caspase 4 Antibody (large subunit)</image:title>
      <image:caption>Western blot testing of human heart lysate with Caspase 4 antibody at 0.3ug/ml. Expected molecular weight ~43 kDa (precursor), ~30 kDa (pro domain + large subunit), ~20 kDa (large subunit).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cbr1-antibody-bha17107127</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c0c1f64a-2381-4d95-8ef7-17d06170ab1d.jpg?v=1775785940</image:loc>
      <image:title>CBR1 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with CBR1 antibody at 0.2ug/ml. Predicted molecular weight: ~30kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccn3-antibody-nov-c-terminal-region-bha17106256</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_19766572-7b03-4bd6-a2cd-7c4f4ed51837.jpg?v=1775785834</image:loc>
      <image:title>CCN3 Antibody / NOV (C-Terminal Region)</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with CCN3 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccdc6-antibody-bha17105836</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_80f54e50-c10f-4bfd-9ae6-023f17710b66.jpg?v=1775785763</image:loc>
      <image:title>CCDC6 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat testis and 2) human MCF7 lysate with CCDC6 antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa, routinely observed at ~65 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cckbr-antibody-bha17107014</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1440d058-7906-46b1-8416-2b3ff9760f61.jpg?v=1775785929</image:loc>
      <image:title>CCKBR Antibody</image:title>
      <image:caption>Western blot testing of mouse pancreas with CCKBR antibody at 1ug/ml. Predicted molecular weight ~48 kDa, but can be observed at 68-97 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccm2-antibody-bha17107322</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_372b4875-6c5d-4bef-a3f5-6f9d89e8dc30.jpg?v=1775785959</image:loc>
      <image:title>CCM2 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with CCM2 antibody at 0.03ug/ml. Predicted molecular weight: ~49kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccdc3-antibody-bha17107773</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8d9d6edc-cd2d-43b2-be2a-fd9034016007.jpg?v=1775786009</image:loc>
      <image:title>CCDC3 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing human CCDC3-FLAG and probed with anti-FLAG in the left panel and with CCDC3 antibody (0.5ug/ml) in the right panel (empty vector transfection in each of the first lanes).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccs-antibody-bha17105948</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7475224e-5a19-4f6f-80e9-07a72890806e.jpg?v=1775785783</image:loc>
      <image:title>CCS Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat spleen, 3) mouse brain, 4) mouse spleen and 5) human 293T lysate with CCS antibody at 0.5ug/ml. Predicted molecular weight ~34 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cbf-antibody-bha17106629</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_86e8d6ae-43f2-4c08-ab7b-4b7e5a2172b8.jpg?v=1775785884</image:loc>
      <image:title>CBF Antibody</image:title>
      <image:caption>Western blot testing of mouse fetal brain lysate with CBF antibody at 0.5ug/ml. Predicted molecular weight: ~120kDa, observed here at ~140kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccl11-antibody-eotaxin-bha17105468</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f6fb3174-25bb-42a2-b1ef-00a3ec755a3b.jpg?v=1775785692</image:loc>
      <image:title>CCL11 Antibody / Eotaxin</image:title>
      <image:caption>IHC staining of FFPE human colon cancer tissue with CCL11 antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccr1-antibody-bha17106204</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_92b441f6-483b-4650-b789-1dd0680df8cc.jpg?v=1775785823</image:loc>
      <image:title>CCR1 Antibody</image:title>
      <image:caption>Western blot testing of rat PC-12 cell lysate with CCR1 antibody at 0.5ug/ml. Predicted molecular weight 40-45 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccl19-antibody-bha17106195</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_660b5953-5bff-4794-abd4-5cd84c361f4b.jpg?v=1775785822</image:loc>
      <image:title>Ccl19 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat thymus, 2) rat lung, 3) rat spleen, 4) rat stomach, 5) rat PC-12 cells, 6) mouse thymus and 7) mouse NIH3T3 lysate with Ccl19 antibody at 0.5ug/ml. Predicted molecular weight ~12 kDa, observed here at ~20 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccl20-antibody-bha17106417</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4e6003e3-cf53-4a37-b10a-901762bf5ecc.jpg?v=1775785858</image:loc>
      <image:title>CCL20 Antibody</image:title>
      <image:caption>IHC testing of FFPE human liver with CCL20 antibody at 6ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cct3-antibody-tcp1-gamma-bha17105714</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1d25e429-4901-44ca-b365-63653f222f99.jpg?v=1775785741</image:loc>
      <image:title>CCT3 Antibody / TCP1 gamma</image:title>
      <image:caption>Western blot testing of 1) rat kidney and 2) human HeLa lysate with CCT3 antibody. Expected molecular weight ~61 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cct3-antibody-bha17107049</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_851e7419-fa3d-4398-98ab-e37946557e47.jpg?v=1775785930</image:loc>
      <image:title>CCT3 Antibody</image:title>
      <image:caption>Western blot testing of mouse testis lysate with CCT3 antibody at 0.01ug/ml. Predicted molecular weight: ~61 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccr5-antibody-bha17106281</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ab150f0d-8add-46fc-a3b8-7df9d69771d3.jpg?v=1775785837</image:loc>
      <image:title>CCR5 Antibody</image:title>
      <image:caption>Western blot testing of human 1) Jurkat and 2) MCF7 cell lysate with CCR5 antibody at 0.5ug/ml. Predicted molecular weight ~41 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd105-antibody-bha17106224</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5f6592a7-ad2e-4a5e-a1cd-5d5ae52183d8.jpg?v=1775785828</image:loc>
      <image:title>CD105 Antibody</image:title>
      <image:caption>IHC testing of FFPE mouse kidney tissue with CD105 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccndbp1-antibody-bha17107684</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_64609304-3aa0-43d0-98b0-28022aed680f.jpg?v=1775785999</image:loc>
      <image:title>CCNDBP1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human prostate with CCNDBP1 at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd119-antibody-ifngr1-bha17105998</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_325fdc10-a804-4e1e-a55d-434729410932.jpg?v=1775785791</image:loc>
      <image:title>CD119 Antibody / IFNGR1</image:title>
      <image:caption>Western blot testing of human HepG2 cell lysate with CD119 antibody at 0.5ug/ml. Predicted molecular weight: ~54 kDa (unmodified), 80-100 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccl4-antibody-mip-1-beta-bha17105304</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c84f374a-6fde-421f-8a2d-94e838f27b3e.jpg?v=1775785677</image:loc>
      <image:title>CCL4 Antibody / MIP-1 beta</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate with CCL4 antibody. Expected molecular weight: 10/8 kDa (precusor/mature).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ccl5-antibody-rantes-bha17105307</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_841411e5-0cc5-489b-a1bc-c604e5e9a000.jpg?v=1775785673</image:loc>
      <image:title>CCL5 Antibody / RANTES</image:title>
      <image:caption>Western blot testing of human HUT cell lysate with CCL5 antibody. Expected/observed molecular weight ~11 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd133-antibody-c-terminal-region-bha17106200</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cc21882b-0c05-48cf-8f6a-ca50436f3825.jpg?v=1775785823</image:loc>
      <image:title>CD133 Antibody (C-Terminal Region)</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse liver, 3) human MCF7, 4) human COLO320 and 5) human HeLa lysate with CD133 antibody at 0.5ug/ml. Predicted molecular weight: ~97 kDa (unmodified), ~130 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd11a-antibody-lfa-1-bha17106008</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a9c79b3f-2cea-47c5-9ce2-77e20853d053.jpg?v=1775785795</image:loc>
      <image:title>CD11a Antibody / LFA-1</image:title>
      <image:caption>Western blot testing of human 1) Jurkat and 2) CCRF-CEM cell lysate with CD11a antibody at 0.5ug/ml. Predicted molecular weight: ~129 kDa (unmodified), up to 200 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd142-antibody-tissue-factor-bha17105351</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_54bd278e-ceac-4c00-9c48-1d307d5b640a.jpg?v=1775785676</image:loc>
      <image:title>CD142 Antibody / Tissue Factor</image:title>
      <image:caption>Western blot testing of mouse lung lysate with CD142 antibody. Expected molecular weight ~33/45-50 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd14-antibody-bha17106115</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_432f2cf8-5db2-4826-84f4-bbf59bfad4d4.jpg?v=1775785814</image:loc>
      <image:title>Cd14 Antibody</image:title>
      <image:caption>IHC testing of FFPE mouse spleen tissue with Cd14 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd138-antibody-syndecan-1-bha17106170</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ea243995-fd17-4e2d-9fce-6a035ed73316.jpg?v=1775785818</image:loc>
      <image:title>CD138 Antibody / Syndecan-1</image:title>
      <image:caption>Western blot testing of human placenta lysate with CD138 antibody at 0.5ug/ml. Predicted molecular weight ~32 kDa but often observed higher due to glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd14-antibody-bha17107475</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a346c7e5-d6a2-4fbe-88e9-04b6e82141f0.jpg?v=1775785979</image:loc>
      <image:title>CD14 Antibody</image:title>
      <image:caption>Western blot testing of human lymph node lysate with CD14 antibody at 1ug/ml. Predicted molecular weight 48~56 kDa depending on presence of C-terminal leader sequence on the protein.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd153-antibody-cd30l-bha17105415</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_00f84c5b-4ae9-46ac-8c0d-be7dbe4d9396.jpg?v=1775785674</image:loc>
      <image:title>CD153 Antibody / CD30L</image:title>
      <image:caption>IHC testing of FFPE human tonsil with CD153 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd147-antibody-basigin-bha17106022</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_55c9d352-ffb9-4e41-9f69-e8f094743391.jpg?v=1775785797</image:loc>
      <image:title>CD147 Antibody / Basigin</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) placenta, 3) Jurkat, 4) U-2 OS, 5) K562, 6) MCF-7, 7) COLO-320, 8) HepG2 and 9) PANC-1 lysate with CD147 antibody. Expected molecular weight: 27-66 kDa depending on level of glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd166-antibody-bha17106064</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_88b0dba6-4b6c-4e66-9685-383e7e56589d.jpg?v=1775785805</image:loc>
      <image:title>CD166 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human liver cancer tissue with CD166 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd19-antibody-bha17106885</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_080fd0f3-0550-427f-a3da-98c107da7deb.jpg?v=1775785912</image:loc>
      <image:title>CD19 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with CD19 antibody at 2ug/ml. Predicted molecular weight: 60~100 kDa depending on level of glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd212-antibody-il12rb1-bha17105932</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c762481c-a5c7-41fb-bb5f-88f8ab17a8d3.jpg?v=1775785779</image:loc>
      <image:title>CD212 Antibody / IL12RB1</image:title>
      <image:caption>Western blot testing of human HepG2 cell lysate with CD212 antibody at 0.5ug/ml. Predicted molecular weight: ~73/100 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd20-antibody-bha17106448</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4611e9a4-4756-42d4-acb2-4d5a6f150fcb.jpg?v=1775785863</image:loc>
      <image:title>CD20 Antibody</image:title>
      <image:caption>Western blot testing of human lymph node lysate with CD20 antibody at 0.05ug/ml. Predicted molecular weight ~33 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd20-antibody-biotin-conjugate-bha17106449</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0f75f6b7-1083-4ca6-9f23-5c6dbf04a51c.jpg?v=1775785862</image:loc>
      <image:title>CD20 Antibody [Biotin Conjugate]</image:title>
      <image:caption>Western blot testing of human Daudi lysate with biotinylated CD20 antibody at 0.3ug/ml. Predicted molecular weight ~33kDa. An NAP blocker was used in place of non-fat milk as blocking solution and diluent. (1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd22-antibody-bha17105348</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f36383e7-ef10-47b0-9924-376995a7d8af.jpg?v=1775785672</image:loc>
      <image:title>CD22 Antibody</image:title>
      <image:caption>Western blot testing of 1) human Raji and 2) rat thymus and 3) mouse thymus lysate with CD22 antibody. Expected molecular weight: 76/95 kDa (alpha/beta, unmodified), 130-150 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd28-antibody-bha17107297</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b020265b-80dd-4db5-871e-5712043da4ae.jpg?v=1775785957</image:loc>
      <image:title>Cd28 Antibody</image:title>
      <image:caption>Western blot testing of mouse thymus lysate with Cd28 antibody at 0.3ug/ml. Expected molecular weight depending on level of glycosylation: ~25-44 kDa (monomer), ~50-90kDa (dimer).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd2bp2-antibody-bha17107793</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_05f6afa8-c7c6-4f84-b802-1590138b6bbc.jpg?v=1775786010</image:loc>
      <image:title>CD2BP2 Antibody</image:title>
      <image:caption>Western blot testing of human thymus lysate with CD2BP2 antibody at 0.3ug/ml. Predicted molecular weight: ~38kDa but routinley observed at ~52kDa due to the acidic nature of the protein.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd27-antibody-bha17105695</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ff76590e-58b7-4e37-a06a-f6c5f2160ca9.jpg?v=1775785737</image:loc>
      <image:title>CD27 Antibody</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate with CD27 antibody. Predicted molecular weight ~29/45 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd29-antibody-integrin-beta-1-itgb1-bha17107631</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_57b18345-f97e-42b7-8b3f-2aec0cc4be9b.jpg?v=1775785993</image:loc>
      <image:title>CD29 Antibody / Integrin beta 1 / ITGB1</image:title>
      <image:caption>Western blot testing of gastrointestinal cancer [A] and gall bladder cancer [B] lysates with CD29 antibody at 0.5ug/ml. Predicted molecular weight: 88/130~150 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd3-zeta-antibody-bha17107410</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8bab729e-23d8-4ec5-b413-3932fe46c8e1.jpg?v=1775785969</image:loc>
      <image:title>CD3 zeta Antibody</image:title>
      <image:caption>Western blot testing of human tonsil [A] and Jurkat [B] lysates with CD3 zeta antibody at 0.03ug/ml. Predicted molecular weight: ~19kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd33-antibody-bha17105702</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6b22c2d7-f883-4a6e-a9c1-8344c7f558c7.jpg?v=1775785736</image:loc>
      <image:title>CD33 Antibody</image:title>
      <image:caption>Western blot testing of mouse lung lysate with CD33 antibody. Predicted molecular weight is 40-67 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd32-antibody-cd32b-fcgr2b-bha17107733</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b344b4ab-a06f-4dd9-bb03-c17a41496df0.jpg?v=1775786007</image:loc>
      <image:title>CD32 Antibody / CD32B / FCGR2B</image:title>
      <image:caption>Western blot testing of human Daudi lysate with CD32 antibody at 1ug/ml. Predicted molecular weight: 34-40 kDa depending on the level of glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd33-antibody-bha17105703</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_06fdb0fb-6e07-415e-a8a9-cbea86869e7c.jpg?v=1775785737</image:loc>
      <image:title>CD33 Antibody</image:title>
      <image:caption>IHC staining of FFPE human tonsil tissue with CD33 antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd36-antibody-bha17105334</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_61e23371-9eaa-4220-a575-e6d0814e11d7.jpg?v=1775785678</image:loc>
      <image:title>CD36 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat heart, 3) mouse liver, 4) mouse heart and 5) human SMCC lysate with CD36 antibody. Expected molecular weight: ~53/88 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd4-antibody-bha17107408</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_de88573f-5484-4eaa-a5c0-2dba4602e71f.jpg?v=1775785970</image:loc>
      <image:title>CD4 Antibody</image:title>
      <image:caption>Western blot testing of human spleen lysate with CD4 antibody at 1ug/ml. Predicted molecular weight ~31kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd3d-antibody-bha17107117</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_adde1962-d12c-4c7b-a00e-d06b79893c30.jpg?v=1775785938</image:loc>
      <image:title>CD3D Antibody</image:title>
      <image:caption>Western blot testing of Jurkat [A] and MOLT4 [B] lysates with CD3D antibody at 1ug/ml. Predicted molecular weight: ~19kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd40-antibody-bha17105837</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9eca51f4-0104-4bce-8ecf-5f00489bed51.jpg?v=1775785762</image:loc>
      <image:title>CD40 Antibody</image:title>
      <image:caption>Flow cytometry testing of human PBM cells with CD40 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CD40 antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd40-antibody-bha17106282</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4e2a1d94-923f-4411-a718-d590c58c7f19.jpg?v=1775785837</image:loc>
      <image:title>CD40 Antibody</image:title>
      <image:caption>Western blot testing of rat PC-12 cell lysate with CD40 antibody at 0.5ug/ml. Predicted molecular weight is 30-45 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd38-antibody-bha17106995</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5680d468-7af9-4cc1-ae2d-e48b3f60d90d.jpg?v=1775785924</image:loc>
      <image:title>CD38 Antibody</image:title>
      <image:caption>Western blot testing of human spinal cord cancer lysate with CD38 antibody at 2ug/ml. Expected molecular weight: 34-46 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd44-antibody-bha17106280</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_df07400a-f62f-4ed4-b25d-70bc4da6dbfe.jpg?v=1775785838</image:loc>
      <image:title>CD44 Antibody</image:title>
      <image:caption>Western blot testing of 1) human HeLa, 2) human 22RV1, 3) rat spleen, 4) rat thymus and 5) mouse spleen lysate with CD44 antibody at 0.5ug/ml. Predicted molecular weight ~81 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd40-antibody-bha17105838</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5c523846-9c87-409e-bcbf-b4df938667cf.jpg?v=1775785763</image:loc>
      <image:title>CD40 Antibody</image:title>
      <image:caption>Western blot testing of mouse spleen lysate with CD40 antibody at 0.5ug/ml. Predicted molecular weight is 32-45 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd44-antibody-bha17107681</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1c0daa5d-fb04-4da9-a341-55b2ba141d7d.jpg?v=1775785999</image:loc>
      <image:title>CD44 Antibody</image:title>
      <image:caption>Western blot testing of U2OS lysate with CD44 antibody at 0.03ug/ml. Predicted molecular weight ~81kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd48-antibody-bha17105986</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0d096852-4fdf-4bf7-9179-d5d7411b9bab.jpg?v=1775785789</image:loc>
      <image:title>CD48 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HEL, 2) RT-4 and 3) HaCaT cell lysate with CD48 antibody at 0.5ug/ml. Expected molecular weight 28 kDa (unmodified), up to 50 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd46-antibody-bha17105324</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2c3b7a31-b364-4fb6-9336-66abf7b6eaf2.jpg?v=1775785677</image:loc>
      <image:title>CD46 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human T-47D cells with CD46 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd47-antibody-iap-bha17106123</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_78e6defc-e1ff-4275-9683-715e4e68b6aa.jpg?v=1775785811</image:loc>
      <image:title>CD47 Antibody / IAP</image:title>
      <image:caption>Flow cytometry testing of fixed human A549 cells with CD47 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CD47 antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd57-antibody-bha17107225</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_da53b7bc-5ae2-4757-bc9e-af5296ec23c3.jpg?v=1775785949</image:loc>
      <image:title>CD57 Antibody</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with CD57 antibody at 0.1ug/ml with [B] and without [A] immunizing peptide. Predicted/observed molecular weight ~38kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd62l-antibody-l-selectin-bha17105313</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_362ae3f4-4a11-470f-bfe0-e9ab7107830d.jpg?v=1775785673</image:loc>
      <image:title>CD62L Antibody / L-Selectin</image:title>
      <image:caption>Western blot testing of 1) human placenta, 2) Jurkat, 3) CEM, 4) HL60, 5) rat spleen and 6) mouse spleen with CD62L antibody. Expected/observed molecular weight: 42~95 kDa depending on level of glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd58-antibody-lfa3-bha17105717</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2ee3231a-e766-48c5-b507-d4f31c41e2f4.jpg?v=1775785742</image:loc>
      <image:title>CD58 Antibody / LFA3</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) K562 cell lysate with CD58 antibody. Predicted molecular weight: 28/40-70 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd62l-antibody-bha17106147</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_98e36dcb-ea77-4f29-b1cd-581787b8ae32.jpg?v=1775785815</image:loc>
      <image:title>CD62L Antibody</image:title>
      <image:caption>Western blot testing of recombinant human protein with CD62L antibody at 0.5ug/ml. Expected molecular weight: 42~95 kDa depending on level of glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd59-antibody-bha17105312</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e472a214-beed-4770-8290-07c9b5142f35.jpg?v=1775785680</image:loc>
      <image:title>CD59 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with CD59 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd74-antibody-bha17107201</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_be1555e3-96e1-4890-aea3-2cdb8fdf6aab.jpg?v=1775785947</image:loc>
      <image:title>CD74 Antibody</image:title>
      <image:caption>IHC staining of FFPE human tonsil tissue with CD74 antibody at 5ug/ml. Required HIER: steamed antigen retrieval with pH6 citrate buffer; AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd74-antibody-bha17107329</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_96bb288d-a3a4-480e-b868-c065df375a06.jpg?v=1775785961</image:loc>
      <image:title>CD74 Antibody</image:title>
      <image:caption>Western blot testing of human tonsil lysate with CD74 antibody. Expected molecular weight: 33-43 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd9-antibody-bha17105746</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0cbf121f-9be3-4b54-8868-665f46323fdf.jpg?v=1775785745</image:loc>
      <image:title>Cd9 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE mouse HEPA1-6 cells with Cd9 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd80-antibody-bha17107160</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_16c7e822-f6f0-403c-9449-c3dcf09c7618.jpg?v=1775785946</image:loc>
      <image:title>CD80 Antibody</image:title>
      <image:caption>Western blot testing of human lymph node lysate with CD80 antibody at 1ug/ml. Expected molecular weight: 34-75 kDa depending on the level of glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdc25c-antibody-bha17105400</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d5e411df-3e01-4ba6-adc1-6abce802d587.jpg?v=1775785677</image:loc>
      <image:title>CDC25C Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with CDC25 antibody (green) and Alpha Tubulin mAb (red). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd90-antibody-bha17105971</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fa2e7c74-9ad7-4fa1-9f7a-0bcb480be813.jpg?v=1775785788</image:loc>
      <image:title>CD90 Antibody</image:title>
      <image:caption>IHC testing of FFPE mouse spleen tissue with CD90 antibody. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdc25b-antibody-m-phase-inducer-phosphatase-2-bha17105399</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1dc9fd88-7e09-4915-b370-cea3bacf35c5.jpg?v=1775785679</image:loc>
      <image:title>CDC25B Antibody / M-phase inducer phosphatase 2</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with CDC25B antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdc37-antibody-bha17105575</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a566c73d-89ec-4a6d-a4db-0eb62d881a9c.jpg?v=1775785713</image:loc>
      <image:title>Cdc37 Antibody</image:title>
      <image:caption>Western blot testing of human 293 cell lysate with Cdc37 antibody. Expected/observed molecular weight 44~50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdcp1-antibody-sima135-bha17105741</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6563d646-0ec8-46a5-b017-2e9a4b82c6f5.jpg?v=1775785744</image:loc>
      <image:title>CDCP1 Antibody / SIMA135</image:title>
      <image:caption>Western blot testing of human SW620 cell lysate with CDCP1 antibody. Expected molecular weight: 93 kDa (unmodified), 130-140 kDa (glycosylated), ~70 kDa (cleaved).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdc20-antibody-bha17106125</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_87b37cd9-36c2-4d96-a364-2e819b873131.jpg?v=1775785818</image:loc>
      <image:title>Cdc20 Antibody</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate with Cdc20 antibody at 0.5ug/ml. Predicted molecular weight ~55 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdcp1-antibody-bha17107800</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_68462b38-3043-45a1-af49-96fb76f7509d.jpg?v=1775786012</image:loc>
      <image:title>CDCP1 Antibody</image:title>
      <image:caption>Western blot testing of human colon lysate with CDCP1 antibody at 1ug/ml. Expected molecular weight: 93 kDa (unmodified), 130-140 kDa (glycosylated), ~70 kDa (cleaved). Both observed bands are blocked by addition of immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdc25c-antibody-bha17105401</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_88605413-33cd-4f98-bc62-8a3ad32378c5.jpg?v=1775785678</image:loc>
      <image:title>CDC25C Antibody</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) SW620 and 3) MCF7 lysate with CDC25C antibody. Expected molecular weight: ~53/60 kDa (unmodified/phosphorylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cd90-antibody-thy1-bha17107750</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_25b610a6-fac5-4a66-930d-a51440f6b666.jpg?v=1775786007</image:loc>
      <image:title>CD90 Antibody / Thy1</image:title>
      <image:caption>Western blot testing of human tonsil lysate with CD90 antibody at 0.1ug/ml. Predicted molecular weight 18~35kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdh11-antibody-bha17106383</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e3bd3339-1ac2-4e28-90b1-44cd98033253.jpg?v=1775785853</image:loc>
      <image:title>CDH11 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing CDH11-MYC with CDH11 antibody [1ug/ml] in Lane A and with anti-MYC [1/1000] in lane C. Mock-transfected probed with anti-CDH11 [1ug/ml] in Lane B. Predicted molecular weight: ~88kDa but can be observed at 120-130kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdk10-antibody-bha17106303</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ec808746-7fd1-4f3d-9cc3-7dcecca70c51.jpg?v=1775785839</image:loc>
      <image:title>CDK10 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with CDK10 antibody at 2ug/ml. Predicted molecular weight: ~41kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdk6-antibody-bha17105798</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ead9e950-9a33-464d-bead-242ed01023fb.jpg?v=1775785753</image:loc>
      <image:title>Cdk6 Antibody</image:title>
      <image:caption>IHC staining of FFPE human intestinal cancer with Cdk6 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdc6-antibody-bha17105643</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_41d29c84-60e2-442a-9358-6284c6dfc064.jpg?v=1775785725</image:loc>
      <image:title>CDC6 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) human Jurkat, 3) MM231 and 4) HT1080 lysate with CDC6 antibody. Predicted/observed molecular weight: ~62 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdh11-antibody-bha17106950</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_eda3eaf6-7b30-49db-8284-dda6ed90cf98.jpg?v=1775785919</image:loc>
      <image:title>CDH11 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing CDH11-MYC with CDH11 antibody [1ug/ml] in Lane A and with anti-MYC [1/1000] in lane C. Mock-transfected probed with anti-CDH11 [1ug/ml] in Lane B. Predicted molecular weight: ~88kDa but can be observed at 120-130kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdk4-antibody-bha17105296</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_037f58dc-e69a-4939-b4e8-de29d06f396d.jpg?v=1775785678</image:loc>
      <image:title>Cdk4 Antibody</image:title>
      <image:caption>Western blot testing of 1) human HeLa, 2) human K562, 3) rat PC-12, 4) mouse NIH 3T3 and 5) mouse RAW264.7 cell lysate with Cdk4 antibody. Predicted molecular weight ~34 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdk9-antibody-bha17105463</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8f67424c-a0e4-4f4f-8099-1dcfc71538a0.jpg?v=1775785694</image:loc>
      <image:title>Cdk9 Antibody</image:title>
      <image:caption>Western blot testing of human Jurkat lysate with Cdk9 antibody. Predicted/observed molecular weight ~43 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdr2-antibody-bha17106057</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_231510ac-760d-4562-a4f1-4169d9e063da.jpg?v=1775785802</image:loc>
      <image:title>CDR2 Antibody</image:title>
      <image:caption>Western blot testing of 1) mouse kidney and 2) human MCF7 lysate with CDR2 antibody at 0.5ug/ml. Expected molecular weight: 52-62 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdt1-antibody-bha17106339</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_72dd58fc-9297-49e3-8ec2-3faf7bf3b1a1.jpg?v=1775785846</image:loc>
      <image:title>CDT1 Antibody</image:title>
      <image:caption>Western blot testing of human ovay lysate with CDT1 antibody at 0.05ug/ml. Predicted molecular weight ~60 kDa, commonly observed at 60-70 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdk7-antibody-bha17105462</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1fa0fda2-cd64-4078-af72-2cae5d16c42a.jpg?v=1775785689</image:loc>
      <image:title>Cdk7 Antibody</image:title>
      <image:caption>Western blot testing of human 1) MCF7, 2) HeLa, 3) A549, 4) HepG2 and 293 cell lysate with Cdk7 antibody. Predicted/observed molecular weight ~37 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdx2-antibody-bha17106920</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cccacfbc-7492-45e0-aff3-24c7ae4ac74a.jpg?v=1775785916</image:loc>
      <image:title>CDX2 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with CDX2 antibody at 1ug/ml. Predicted molecular weight: 33-40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdk2-antibody-bha17105376</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e6286021-cffc-44a1-829e-90f5ff08e888.jpg?v=1775785679</image:loc>
      <image:title>Cdk2 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A549 cells with Cdk2 antibody (green) and Beta Tubulin mAb (red). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdk7-antibody-bha17107192</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e1838555-8d01-4d5c-b2d8-3db882cd48e1.jpg?v=1775785947</image:loc>
      <image:title>CDK7 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with CDK7 antibody at 0.3ug/ml. Predicted molecular weight: ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cenpa-antibody-bha17105457</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7c8be376-addc-4a73-b18d-6bc7f882c8de.jpg?v=1775785691</image:loc>
      <image:title>CENPA Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat lung, 3) rat pancreas, 4) human HeLa lysate with CENPA antibody. Predicted/observed molecular weight ~16 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cdkn2a-antibody-pancreatic-isoform-specific-bha17107245</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4887436d-aaec-44df-adb5-3825fa1459e3.jpg?v=1775785954</image:loc>
      <image:title>CDKN2A Antibody (pancreatic isoform specific)</image:title>
      <image:caption>Western blot testing of HeLa lysate with CDKN2A antibody at 1ug/ml. Predicted molecular ~12kDa, observed here at ~17kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cfh-antibody-bha17107162</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e80f7274-edfc-459e-8e8e-0a7efac97725.jpg?v=1775785943</image:loc>
      <image:title>CFH Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with CFH antibody at 0.03ug/ml. Predicted molecular weight: ~139 kDa, observed here at ~170 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cebpb-antibody-bha17106563</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_96b386de-693a-4e2b-ae58-269a685b6ab2.jpg?v=1775785877</image:loc>
      <image:title>CEBPB Antibody</image:title>
      <image:caption>Western blot testing of mouse NIH3T3 lysate with CEBPB antibody at 1ug/ml. Predicted molecular weight: ~33/36-41 kDa (mouse/human).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cgrp-antibody-calca-calcitonin-bha17105699</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5cdf780e-cc0c-4f02-a4fe-ab811ced1604.jpg?v=1775785735</image:loc>
      <image:title>CGRP Antibody / CALCA / Calcitonin</image:title>
      <image:caption>IHC testing of FFPE human thyroid cancer tissue with CGRP antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ces1-antibody-carboxylesterase-1-bha17107710</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_eeee1b60-4c6b-4f46-89f8-62c8b47f4eaf.jpg?v=1775786004</image:loc>
      <image:title>CES1 Antibody / Carboxylesterase 1</image:title>
      <image:caption>Western blot testing of human liver lysate with CES1 antibody at 0.03ug/ml. Predicted molecular weight: ~63 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chi3l1-antibody-chitinase-3-like-protein-1-bha17106185</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_22024aab-d300-4d35-99f0-8b05673c7ab8.jpg?v=1775785822</image:loc>
      <image:title>Chi3l1 Antibody / Chitinase-3-like protein 1</image:title>
      <image:caption>Western blot testing of mouse 1) RAW264.7 and 2) HEPA1-6 cell lysate with Chi3l1 antibody at 0.5ug/ml. Expected molecular weight: 39-43 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chd2-antibody-bha17106240</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_45de3fae-69ba-4cef-9329-fff954520eb6.jpg?v=1775785831</image:loc>
      <image:title>CHD2 Antibody</image:title>
      <image:caption>IHC testing of FFPE rat brain tissue with CHD2 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chrna4-antibody-nacra4-bha17107226</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9c4793e0-da02-4e46-8998-60e1f83d36c1.jpg?v=1775785950</image:loc>
      <image:title>CHRNA4 Antibody / NACRA4</image:title>
      <image:caption>Western blot testing of rat brain lysate with CHRNA4 antibody at 0.3ug/ml. Predicted/observed molecular weight: ~70kDa. Both observed bands are blocked by addition of immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chfr-antibody-bha17107316</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a14032d0-e4d0-4e40-a90c-b9bfc9d92b67.jpg?v=1775785959</image:loc>
      <image:title>CHFR Antibody</image:title>
      <image:caption>IHC testing of FFPE human cerebellum with CHFR antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chrm1-antibody-bha17106596</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7cb44cb2-09a6-49e1-b969-71a9cee822cb.jpg?v=1775785881</image:loc>
      <image:title>CHRM1 Antibody</image:title>
      <image:caption>Western blot testing of mouse heart lysate with CHRM1 antibody at 0.3ug/ml. Predicted molecular weight: ~51 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chk1-antibody-bha17106670</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_856c3a5c-c508-4160-9f59-cc5bc9c69935.jpg?v=1775785887</image:loc>
      <image:title>CHK1 Antibody</image:title>
      <image:caption>Western blot testing of rat thymus lysate with CHK1 antibody at 2ug/ml. Predicted molecular weight ~54kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chat-antibody-bha17106409</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bf72f2b2-3764-4710-ab79-a9728a48accf.jpg?v=1775785858</image:loc>
      <image:title>ChAT Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with ChAT antibody at 0.03ug/ml. Predicted molecular weight ~74 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chit1-antibody-bha17106813</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bb5031cf-66eb-4942-aefa-b577833d5148.jpg?v=1775785907</image:loc>
      <image:title>CHIT1 Antibody</image:title>
      <image:caption>Western blot testing of Daudi lysate with CHIT1 antibody at 1ug/ml. Predicted molecular weight: ~52kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chmp5-antibody-bha17107633</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4fcdf345-047b-4796-8609-6905415e6b50.jpg?v=1775785994</image:loc>
      <image:title>CHMP5 Antibody</image:title>
      <image:caption>Western blot testing of K562 lysate with CHMP5 antibody at 1ug/ml. Predicted molecular weight: ~25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cgrp-antibody-calca-calcitonin-bha17105744</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e26773cc-2843-4cdd-89ac-dd0ae60a64fd.jpg?v=1775785743</image:loc>
      <image:title>CGRP Antibody / CALCA / Calcitonin</image:title>
      <image:caption>IHC staining of FFPE rat brain tissue with CGRP antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chchd3-antibody-bha17107315</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7125c0d9-308a-42db-9af0-b4b1b2002c73.jpg?v=1775785960</image:loc>
      <image:title>CHCHD3 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with CHCHD3 antibody at 1ug/ml. Predicted molecular weight: ~26kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chrm2-antibody-bha17105983</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e9dc88c2-b02e-4118-b462-d42c14c58364.jpg?v=1775785788</image:loc>
      <image:title>CHRM2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse brain lysate with CHRM2 antibody at 0.5ug/ml. Predicted molecular weight ~52 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chrna7-antibody-bha17107470</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_244d6b89-40f5-4a12-9f4f-7700a475b91d.jpg?v=1775785976</image:loc>
      <image:title>CHRNA7 Antibody</image:title>
      <image:caption>IHC staining of FFPE rat cerebral cortex [A] and rat hippocampus [B] with CHRNA antibody at 5ug/ml; DAPI nuclear counter stain (blue); HIER: pH6 citrate buffer at 95-98oC.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chrna5-antibody-bha17106016</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e0ec405a-edef-406e-a043-7ae937188a35.jpg?v=1775785797</image:loc>
      <image:title>CHRNA5 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat skeletal muscle and 2) human HepG2 lysate with CHRNA5 antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chk1-antibody-checkpoint-kinase-1-bha17105951</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_30226a53-30d1-4d40-b812-4a471b4c4111.jpg?v=1775785784</image:loc>
      <image:title>CHK1 Antibody / Checkpoint kinase 1</image:title>
      <image:caption>Flow cytometry testing of fixed and permeabilized human K562 cells with CHK1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CHK1 antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ciita-antibody-bha17105799</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3bb828f2-3202-4e10-a593-d14015a5fd96.jpg?v=1775785755</image:loc>
      <image:title>CIITA Antibody</image:title>
      <image:caption>Western blot testing of 1) rat thymus, 2) mouse thymus and 3) MCF7 lysate with CIITA antibody at 0.5ug/ml. Predicted/observed molecular weight ~123 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chrne-antibody-bha17106659</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e1a466ce-6cc8-4308-80f7-a5d71019f8cf.jpg?v=1775785887</image:loc>
      <image:title>CHRNE Antibody</image:title>
      <image:caption>Western blot testing of mouse fetal skeletal muscle lysate with CHRNE antibody at 1ug/ml. Predicted molecular weight: ~55kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/choline-acetyltransferase-antibody-bha17106014</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_404816ac-d3ec-4b9f-8709-ff9806a3a693.jpg?v=1775785794</image:loc>
      <image:title>Choline acetyltransferase Antibody</image:title>
      <image:caption>Western blot testing of 1) rat testis and 2) mouse testis tissue with Choline acetyltransferase antibody at 0.5ug/ml. Predicted molecular weight ~83/74/70 kDa (isoforms M/S/R), observed here at ~84 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/choline-acetyltransferase-antibody-bha17107302</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1d0052ee-e613-48fc-890b-37b5140e10f5.jpg?v=1775785958</image:loc>
      <image:title>Choline acetyltransferase Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with Choline acetyltransferase antibody at 0.2ug/ml. Predicted molecular weight ~74 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chrna5-antibody-bha17107224</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_150ec08a-201b-4945-bde5-a252e1568138.jpg?v=1775785949</image:loc>
      <image:title>CHRNA5 Antibody</image:title>
      <image:caption>Western blot testing of KELLY cell lysate with CHRNA5 antibody at 1ug/ml. Predicted molecular weight: ~53kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cib1-antibody-calcium-and-integrin-binding-protein-1-bha17105645</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_99d34fe1-fc09-4409-b2b7-e1b164d49b1f.jpg?v=1775785725</image:loc>
      <image:title>CIB1 Antibody / Calcium and integrin-binding protein 1</image:title>
      <image:caption>Western blot testing of 1) human A431, 2) rat PC-12 and 3) mouse brain tissue lysate with CIB1 antibody. Predicted molecular weight ~21 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chuk-antibody-bha17106809</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_106bcdbb-bb32-4e21-90b0-5db00821a2b5.jpg?v=1775785905</image:loc>
      <image:title>CHUK Antibody</image:title>
      <image:caption>Western blot testing of HeLa nuclear lysate with CHUK antibody at 1ug/ml. Predicted molecular weight: ~85kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ckap4-antibody-bha17106073</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b6ef8332-16b5-40ba-b009-755d60720709.jpg?v=1775785802</image:loc>
      <image:title>CKAP4 Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with CKAP4 antibody at 0.5ug/ml. Predicted molecular weight ~64 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ck20-antibody-krt20-cytokeratin-20-bha17107699</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_22619580-ef7a-40d0-a4ee-3700c417fe9a.jpg?v=1775785999</image:loc>
      <image:title>CK20 Antibody / KRT20 / Cytokeratin 20</image:title>
      <image:caption>Western blot testing of human colon lysate with CK20 antibody at 0.03ug/ml. Predicted molecular weight: ~49kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ciap2-antibody-bha17105553</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3da230e6-2598-4ac2-9581-089c3502391e.jpg?v=1775785711</image:loc>
      <image:title>cIAP2 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HepG2 and 2) HeLa lysate with cIAP2 antibody. Predicted/observed molecular weight ~68 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cilp-antibody-bha17107721</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7fdf7374-04ec-463c-a787-adb97b6260da.jpg?v=1775786004</image:loc>
      <image:title>CILP Antibody</image:title>
      <image:caption>Western blot testing of rat spinal cord lysate with CILP antibody at 0.03ug/ml. Predicted molecular weight: ~133kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/clatherin-light-chain-antibody-lca-lcb-bha17106373</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_09c85aea-b02e-4fff-9899-f4310a8ba288.jpg?v=1775785852</image:loc>
      <image:title>Clatherin Light Chain Antibody (LCA/LCB)</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with Clatherin Light Chain antibody at 0.1ug/ml. The expected molecular weight is 17~27 kDa. A ~35kDa band has also been reported (PMID: 10942733).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/chx10-antibody-vsx2-bha17106254</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_228f6438-d7fa-476e-a7a9-7b90933d7117.jpg?v=1775785832</image:loc>
      <image:title>CHX10 Antibody / VSX2</image:title>
      <image:caption>Western blot testing of mouse eye ball lysate with CHX10 antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ckm-antibody-creatine-kinase-m-bha17107707</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_efc20616-a880-4860-9b37-bac5d4b6e3f8.jpg?v=1775786002</image:loc>
      <image:title>CKM Antibody / Creatine kinase M</image:title>
      <image:caption>Western blot testing of A) human skeletal muslce, B) mouse skeletal muscle, C) human heart and D) mouse heart with CKM antibody at 0.01ug/ml. Predicted molecular weight: ~43kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ck19-antibody-cytokeratin-19-bha17105269</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_18d0381e-eade-4eaa-95c6-a951a567de41.jpg?v=1775785677</image:loc>
      <image:title>CK19 Antibody / Cytokeratin 19</image:title>
      <image:caption>Western blot testing of human 1) placenta, 2) MCF7, 3) SW620, 4) COLO-320, 5) HepG2 and 6) PANC-1 lysate with CK19 antibody. Expected molecular weight ~43 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cip2a-antibody-p90-autoantigen-c-terminal-region-bha17105615</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9debaf54-6b88-47ca-b5ed-8210d7ece2c1.jpg?v=1775785722</image:loc>
      <image:title>CIP2A Antibody / p90 Autoantigen (C-Terminal Region)</image:title>
      <image:caption>Western blot testing of 1) mouse testis and 2) human HeLa lysate with CIP2A antibody. Routinely observed at 90 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/clca1-antibody-bha17107758</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bdcc58fb-134d-4a1d-967c-b3ecc624c711.jpg?v=1775786007</image:loc>
      <image:title>CLCA1 Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with CLCA1 antibody at 0.3ug/ml. Predicted molecular weight: ~100/125kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/clec1b-antibody-bha17107324</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_09a9764f-9f15-4287-9e2b-094c98d997a5.jpg?v=1775785958</image:loc>
      <image:title>CLEC1B Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with CLEC1B antibody at 1ug/ml. Predicted molecular weight: ~27 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/clu-antibody-clusterin-apolipoprotein-j-apo-j-bha17105287</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_84fc9625-50b2-418e-905f-504b32dd4a0d.jpg?v=1775785673</image:loc>
      <image:title>CLU Antibody / Clusterin / Apolipoprotein J / APO-J</image:title>
      <image:caption>Western blot testing of human 1) SKOV, 2) U87 and 3) PANC cell lysate with CLU antibody. Predicted molecular weight: 75-80 kDa (heterodimer precursor), 36-39 kDa (alpha subunit), 34-36 kDa (beta subunit).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/clpp-antibody-bha17106739</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7960c746-7750-4614-86cf-bbebd465446a.jpg?v=1775785896</image:loc>
      <image:title>CLPP Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with CLPP antibody at 1ug/ml. Predicted molecular weight: ~30 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/clock-antibody-bha17106717</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_45e43919-17f9-4ff7-a732-7d97ca8d500b.jpg?v=1775785893</image:loc>
      <image:title>CLOCK Antibody</image:title>
      <image:caption>Western blot testing of mouse [A] and rat [B] skeletal muscle lysate with CLOCK antibody at 0.03ug/ml. Predicted molecular weight ~95 kDa but routinely observed at 95-110 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/clic4-antibody-bha17107607</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_34ce8c2b-ba67-44e0-8f55-b1a0b16c3f1b.jpg?v=1775785992</image:loc>
      <image:title>CLIC4 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with CLIC4 antibody at 0.1ug/ml. Predicted molecular weight: ~29 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/clusterin-antibody-apolipoprotein-j-apo-j-bha17107295</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4977ea0c-9fcd-41e6-9261-55d0ed59764f.jpg?v=1775785957</image:loc>
      <image:title>Clusterin Antibody / Apolipoprotein J / APO-J</image:title>
      <image:caption>Western blot testing of human prostate lysate with Clusterin antibody at 0.03ug/ml. Predicted molecular weight: 75-80kDa (heterodimer precursor), 36-39kDa (alpha subunit), 34-36kDa (beta subunit).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/clec16a-antibody-bha17106775</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0079c31a-6e47-490a-af56-8990187e4831.jpg?v=1775785901</image:loc>
      <image:title>CLEC16A Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with CLEC16A antibody at 2ug/ml. Predicted molecular weight: ~118kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cll-1-antibody-bha17107672</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_050e45b2-8774-4800-a123-93a5e3371f87.jpg?v=1775785998</image:loc>
      <image:title>CLL-1 Antibody</image:title>
      <image:caption>Western blot testing of U937 lysate with CLL-1 antibody at 0.3ug/ml. Predicted molecular weight: ~31/37kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/clusterin-antibody-apolipoprotein-j-apo-j-bha17106827</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ba5d0253-1e55-459a-8d31-b75cd584a20d.jpg?v=1775785905</image:loc>
      <image:title>Clusterin Antibody / Apolipoprotein J / APO-J</image:title>
      <image:caption>Western blot testing of human colon lysate with Clusterin antibody at 0.3ug/ml. Predicted molecular weight: 75-80kDa (heterodimer precursor), 36-39kDa (alpha subunit), 34-36kDa (beta subunit).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cnpase-antibody-cnp-bha17105913</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f6676620-b3f5-41f4-82e9-2469cdc84ee2.jpg?v=1775785777</image:loc>
      <image:title>CNPase Antibody / CNP</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain and 3) human HeLa lysate with CNPase antibody at 0.5ug/ml. Predicted molecular weight ~47 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/clu-antibody-clusterin-apolipoprotein-j-apo-j-bha17106828</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0e58a8cc-c98c-40c8-891d-4da19556d1b9.jpg?v=1775785906</image:loc>
      <image:title>Clu Antibody / Clusterin / Apolipoprotein J / APO-J</image:title>
      <image:caption>Western blot testing of rat brain lysate with Clu antibody at 0.3ug/ml. Predicted molecular weight: 75-80 kDa (heterodimer precursor), 36-39 kDa (alpha subunit), 34-36 kDa (beta subunit).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/clip-antibody-cap-gly-domain-containing-linker-protein-1-bha17107777</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_02bbfce7-1f24-4855-8d03-c97b9188608d.jpg?v=1775786014</image:loc>
      <image:title>CLIP Antibody / CAP-GLY domain containing linker protein 1</image:title>
      <image:caption>Immunofluorescent staining of fixed and permeabilized human A549 cells with CLIP antibody (green) at 10ug/ml and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cntf-antibody-bha17105382</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_94a134ba-9bd4-4cc2-ad0f-4815e4343123.jpg?v=1775785679</image:loc>
      <image:title>CNTF Antibody</image:title>
      <image:caption>Western blot testing of human MCF7 cell lysate with CNTF antibody. Expected/observed molecular weight ~23 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cofilin-2-antibody-cfl2-bha17105722</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_199dc005-aea0-4fa4-a528-2f0b81239cb2.jpg?v=1775785741</image:loc>
      <image:title>Cofilin 2 Antibody / CFL2</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with Cofilin 2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cnbp-antibody-bha17107040</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_97863aa1-5a5e-41ab-8a71-b472659f4d3e.jpg?v=1775785929</image:loc>
      <image:title>CNBP Antibody</image:title>
      <image:caption>Western blot testing of human muscle lysate with CNBP antibody at 2ug/ml. Predicted molecular weight: ~19kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/clusterin-antibody-apolipoprotein-j-apo-j-bha17106479</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b6ee5725-2c17-4c6b-a7f4-269e112698b2.jpg?v=1775785866</image:loc>
      <image:title>Clusterin Antibody / Apolipoprotein J / APO-J</image:title>
      <image:caption>Western blot testing of mouse testis lysate with Clusterin antibody at 0.3ug/ml. Predicted molecular weight: 75-80kDa (heterodimer precursor), 36-39kDa (alpha subunit), 34-36kDa (beta subunit).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cnn2-antibody-bha17106640</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_34c4ff3b-bf44-476f-b19f-a217dc40c76e.jpg?v=1775785885</image:loc>
      <image:title>CNN2 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 lysates with CNN2 antibody at 0.03ug/ml with [B] and without [A] blocking/immunizing peptide. Predicted molecular weight: ~34kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/col4a3bp-antibody-bha17106562</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ed0e511a-9cd2-4f5f-b180-9104dca584ad.jpg?v=1775785875</image:loc>
      <image:title>COL4A3BP Antibody</image:title>
      <image:caption>Western blot testing of mouse heart lysate with COL4A3BP antibody at 0.5ug/ml. Predicted molecular weight: ~70kDa, observed here at ~60kDa. Both observed bands are blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cntfr-antibody-bha17106467</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f3290ca1-08ec-4d58-9ab9-6ad35ba9fc59.jpg?v=1775785862</image:loc>
      <image:title>CNTFR Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with CNTFR antibody at 0.3ug/ml. Predicted molecular weight: ~41kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cog1-antibody-bha17107256</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7e23ff8f-72bf-487b-9eff-7032365cc7cf.jpg?v=1775785951</image:loc>
      <image:title>COG1 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with COG1 antibody at 0.1ug/ml. The expected ~110kDa band and the additional ~45kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/collagen-i-antibody-col1a1-bha17105755</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_49aa7d8b-b2ee-4ec0-80f6-359555c54c72.jpg?v=1775785748</image:loc>
      <image:title>Collagen I Antibody / COL1A1</image:title>
      <image:caption>IHC staining of FFPE rat lung tissue with Collagen I antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cog7-antibody-bha17107505</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5d804187-8428-4f63-8df1-2609454ea001.jpg?v=1775785981</image:loc>
      <image:title>COG7 Antibody</image:title>
      <image:caption>Western blot testing of MOLT4 lysate with COG7 antibody at 0.03ug/ml. Predicted molecular weight: ~86 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/col4a3bp-antibody-bha17107455</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f3f7a438-d56a-4870-bf6c-0e2c2bf346cf.jpg?v=1775785975</image:loc>
      <image:title>COL4A3BP Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with COL4A3BP antibody at 1ug/ml. Predicted molecular weight: ~70kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/connexin-46-antibody-gja3-bha17105690</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_400aa4bb-9ccc-4c87-ae6d-91e3531fcf3c.jpg?v=1775785733</image:loc>
      <image:title>Connexin 46 Antibody / GJA3</image:title>
      <image:caption>Western blot testing of 1) rat heart, 2) rat kidney, 3) human placenta, 4) mouse NIH3T3 lysate with Connexin 46 antibody. Predicted molecular weight ~46 kDa but can be observed 5-10 kDa higher (Ref 1).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cops2-antibody-bha17107556</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5137d8dd-0236-440e-9041-0a995e426575.jpg?v=1775785985</image:loc>
      <image:title>COPS2 Antibody</image:title>
      <image:caption>Western blot testing of mouse NIH3T3 lysates with COPS2 antibody at 0.03ug/ml. Predicted molecular weight: ~51 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cofilin-2-antibody-cfl2-bha17106575</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_25c208aa-9057-4120-bae4-ce8584356728.jpg?v=1775785878</image:loc>
      <image:title>Cofilin 2 Antibody / CFL2</image:title>
      <image:caption>Western blot testing of human skeletal muscle lysate with Cofilin 2 antibody at 0.003ug/ml. Predicted molecular weight: ~19 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/comt-antibody-bha17105358</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4af1213e-b960-49a4-aa61-ae409911ebdf.jpg?v=1775785679</image:loc>
      <image:title>COMT Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat liver, 3) rat kidney, 4) mouse brain, 5) Jurkat, 6) CEM and 7) HeLa lysate with COMT antibody. Predicted molecular weight: ~30/25 kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/comt-antibody-bha17107033</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_457f8c90-fa87-48c5-8a84-26d8a28d55a8.jpg?v=1775785927</image:loc>
      <image:title>COMT Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with COMT antibody at 0.3ug/ml. Predicted molecular weight: ~30/25kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cofilin-antibody-bha17105370</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_063b559a-d2ba-487c-be4f-5c1586aad63f.jpg?v=1775785682</image:loc>
      <image:title>Cofilin Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human MCF7 cells with Cofilin antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/contactin-1-antibody-gp135-bha17106889</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_908f7188-389b-4e1d-8be2-ce8791aa6422.jpg?v=1775785915</image:loc>
      <image:title>Contactin 1 Antibody / GP135</image:title>
      <image:caption>Western blot testing of human cerebellum [A], mouse brain [B] and rat brain [C] lysates with Contactin 1 antibody at 0.3ug/ml. Predicted molecular weight: ~113/135-150kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/complement-factor-b-antibody-cfb-bha17105713</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5316adfc-3760-4f77-ac27-26f3caab1f71.jpg?v=1775785738</image:loc>
      <image:title>Complement Factor B Antibody / CFB</image:title>
      <image:caption>Western blot testing of human 1) A549, 2) 293 and 3) HeLa cell lysate with Complement Factor B antibody. Expected/observed molecular weight ~86 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cox-2-antibody-ptgs2-bha17107671</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1284fc03-6065-498b-89b6-76162c1f01f6.jpg?v=1775785998</image:loc>
      <image:title>COX-2 Antibody / PTGS2</image:title>
      <image:caption>Western blot testing of H460 lysate with COX-2 antibody at 0.5ug/ml. Predicted molecular weight ~69 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/coro1a-antibody-bha17107464</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d69f1f4a-943c-4451-8b62-f65ca80e4a92.jpg?v=1775785976</image:loc>
      <image:title>CORO1A Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with CORO1A antibody at 0.3ug/ml. Predicted molecular weight: ~51 kDa, observed here at ~60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/copine-1-antibody-bha17106328</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cd255b8b-f940-4540-9419-d113917b040d.jpg?v=1775785845</image:loc>
      <image:title>Copine 1 Antibody</image:title>
      <image:caption>Western blot testing of human skin lysate with Copine 1 antibody at 0.1ug/ml. Predicted molecular weight: ~59kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/copa-antibody-bha17106483</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6811f938-c64a-45b0-98c7-fa2a1881c1cc.jpg?v=1775785865</image:loc>
      <image:title>COPA Antibody</image:title>
      <image:caption>Western blot testing of human prostate lysate with COPA antibody at 0.5ug/ml with [B] and without [A] blocking/immunizing peptide. Predicted molecular weight: ~138kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cpi-17-antibody-ppp1r14a-bha17106078</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1ce2a269-99c7-465b-9012-093732c0548f.jpg?v=1775785807</image:loc>
      <image:title>CPI-17 Antibody / PPP1R14A</image:title>
      <image:caption>IHC testing of FFPE human lung cancer tissue with CPI-17 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cope-antibody-coatomer-subunit-epsilon-bha17106245</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5dc4d13b-5bc1-42f8-aabb-07db10329434.jpg?v=1775785833</image:loc>
      <image:title>COPE Antibody / Coatomer subunit epsilon</image:title>
      <image:caption>Immunofluorescent staining of FFPE human MCF7 cells with COPE antibody (green) at 5ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/connexin-45-antibody-bha17105426</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_54746070-f1a5-4f75-8027-06cb29d8293f.jpg?v=1775785684</image:loc>
      <image:title>Connexin 45 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat stomach, 2) human HeLa and 3) human PANC lysate with Connexin 45 antibody. Expected/observed molecular weight ~45 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cpt1a-antibody-cpt1-l-bha17106637</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7c93d07b-d891-4279-b7b0-40edb048472e.jpg?v=1775785885</image:loc>
      <image:title>CPT1A Antibody / CPT1-L</image:title>
      <image:caption>Western blot testing of human liver lysate with CPT1A antibody at 0.1ug/ml. Predicted molecular weight ~86 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/collagen-i-antibody-col1a1-bha17105701</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_64932c1b-d683-4bf7-8475-7f19d6c19ba8.jpg?v=1775785741</image:loc>
      <image:title>Collagen I Antibody / COL1A1</image:title>
      <image:caption>Immunofluorescent staining of FFPE human placental tissue with Collagen I antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cpt1b-antibody-bha17106572</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_37859209-d981-44ea-84fa-762e96021269.jpg?v=1775785878</image:loc>
      <image:title>CPT1B Antibody</image:title>
      <image:caption>IHC testing of FFPE human heart with CPT1B antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cpt1c-antibody-bha17107488</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3fed453c-55c0-417b-9335-26ff8edd6624.jpg?v=1775785980</image:loc>
      <image:title>CPT1C Antibody</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with CPT1C antibody at 1ug/ml. Predicted molecular weight: ~91/90/81kDa (isoforms 1/2/3).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cpeb-antibody-bha17107801</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7ead6bc6-9ac6-41ed-bb66-f93555db865e.jpg?v=1775786011</image:loc>
      <image:title>CPEB Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with CPEB antibody at 0.5ug/ml. Both the expected ~65kDa band and the additional ~48kDa band are blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cp-antibody-ceruloplasmin-bha17105592</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8e4703ca-d72e-4933-a0ce-521d2ffc0a4d.jpg?v=1775785718</image:loc>
      <image:title>CP Antibody / Ceruloplasmin</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse liver and 3) mouse HEPA1-6 lysate with CP antibody. Expected molecular weight ~130 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/creb3l2-antibody-bha17106679</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4960a2c9-0321-4805-b581-780dc0c533c4.jpg?v=1775785890</image:loc>
      <image:title>CREB3L2 Antibody</image:title>
      <image:caption>IHC staining of FFPE human placenta with CREB3L2 antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/crem-antibody-bha17107541</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3e4604d2-4e76-402d-a3a3-7f6c30e571c3.jpg?v=1775785985</image:loc>
      <image:title>CREM Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with CREM antibody at 1ug/ml. Predicted molecular weight: ~33 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/crisp2-antibody-bha17107267</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_88ffd393-ba79-4438-a561-cc40012876dc.jpg?v=1775785952</image:loc>
      <image:title>CRISP2 Antibody</image:title>
      <image:caption>Western blot of HEK293 transfected with human CRISP2-MYC tested with CRISP2 antibody (0.1ug/ml) in Lane A and anti-MYC (1/1000) in lane C. Mock-transfected HEK293 probed with CRISP2 (1ug/ml) in Lane B. Predicted molecular weight: ~27/31kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cp110-antibody-bha17106381</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f73ee0bd-d922-448e-92e9-65677a68ff25.jpg?v=1775785851</image:loc>
      <image:title>CP110 Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with CP110 antibody at 1ug/ml. The expected ~110 kDa band and the additional ~65/37 kDa bands are all blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/crkl-antibody-crk-like-protein-bha17107346</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_91183891-e220-496b-a267-81d5eee16615.jpg?v=1775785963</image:loc>
      <image:title>CrkL Antibody / Crk-like protein</image:title>
      <image:caption>Western blot testing of K562 lysate with CrkL antibody at 0.01ug/ml. Expected molecular weight: 34~39kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/creb3l2-antibody-bha17107203</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3d1412ae-35fb-4520-b2d7-2b36c5a0c703.jpg?v=1775785949</image:loc>
      <image:title>CREB3L2 Antibody</image:title>
      <image:caption>Western blot testing of rat testis lysate with CREB3L2 antibody at 1ug/ml. Predicted molecular weight: ~57kDa (rat isoform 1).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/creb-antibody-bha17106697</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7292197b-1235-44b2-ada0-92fcf2e9ff1c.jpg?v=1775785892</image:loc>
      <image:title>CREB Antibody</image:title>
      <image:caption>Western blot testing of human Jurkat [A] and mouse NIH3T3 [B] nuclear lysates with CREB antibody at 0.1ug/ml. Predicted molecular weight is 37kDa but routinely observed at ~43kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/crf1-antibody-bha17107596</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_30bffe4c-6d6d-4485-966e-f40ee42a3e49.jpg?v=1775785990</image:loc>
      <image:title>CRF1 Antibody</image:title>
      <image:caption>Western blot testing of human duodenum lysate with CRF1 antibody at 2ug/ml. Predicted molecular weight: ~48/60-70 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/creb3l1-antibody-oasis-bha17105631</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c6cd223f-c924-4307-80c8-10adec7ca652.jpg?v=1775785724</image:loc>
      <image:title>CREB3L1 Antibody / OASIS</image:title>
      <image:caption>Western blot testing of 1) human placenta, 2) HeLa, 3) A549, 4) MM231, and 5) COLO320 lysate with CREB3L1 antibody. Predicted molecular weight ~57 kDa. The ~47 kDa isoform may also be visualized.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cpt1b-antibody-bha17105623</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_903403fe-b620-4da2-ad9d-d3b3121b8ead.jpg?v=1775785725</image:loc>
      <image:title>CPT1B Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE mouse heart tissue with CPT1B antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/crf1-antibody-bha17107393</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_93f62eab-1858-42f5-8cd4-bdf864abb234.jpg?v=1775785968</image:loc>
      <image:title>CRF1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human cortex (brain) tissue with CRF1 antibody at 5ug/ml. Required HIER: steamed antigen retrieval with pH6 citrate buffer; AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/crtc2-antibody-torc2-bha17107130</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_65f1e236-08d2-4303-977f-f550f2ffe2e3.jpg?v=1775785940</image:loc>
      <image:title>CRTC2 Antibody / TORC2</image:title>
      <image:caption>Western blot testing of HeLa lysate with CRTC2 antibody at 1ug/ml. Predicted molecular weight: ~73 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/crtc2-antibody-torc2-bha17106796</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_351984a1-ea88-4f6f-8bee-050054c4ab66.jpg?v=1775785902</image:loc>
      <image:title>CRTC2 Antibody / TORC2</image:title>
      <image:caption>Western blot testing of Jurkat lysate with CRTC2 antibody at 0.3ug/ml. Predicted molecular weight: ~73 kDa, observed here at ~85 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/creb3l1-antibody-oasis-bha17106552</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6349d64c-a3f8-4b3e-8245-317b2a8cd63e.jpg?v=1775785875</image:loc>
      <image:title>CREB3L1 Antibody / OASIS</image:title>
      <image:caption>Western blot testing of A549 lysate with CREB3L1 antibody at 2ug/ml. Predicted molecular weight: ~57 kDa. The ~47 kDa isoform may also be visualized.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/crm1-antibody-xpo1-exportin-1-bha17105731</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_06b5a4ad-39e6-4a5d-beab-ca609bf9780d.jpg?v=1775785744</image:loc>
      <image:title>CRM1 Antibody / XPO1 / Exportin 1</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with CRM1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cry2-antibody-cryptochrome-2-bha17105589</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_05c0c399-d3f8-49af-91d0-991cc0f7c4ea.jpg?v=1775785717</image:loc>
      <image:title>CRY2 Antibody / Cryptochrome 2</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) rat brain, 3) mouse brain, 4) human 22RV1 lysate with CRY2 antibody. Expected/observed molecular weight ~67 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cpt2-antibody-bha17107795</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_11aa13f3-9048-4ced-b20d-fb56ab6a5d4d.jpg?v=1775786011</image:loc>
      <image:title>CPT2 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with CPT2 antibody at 1ug/ml. Predicted molecular weight: ~74kDa. Both observed bands are blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/crtc2-antibody-torc2-bha17106638</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_24ffe8b1-3346-4cdb-b1e9-e5df6e07cb0b.jpg?v=1775785885</image:loc>
      <image:title>CRTC2 Antibody / TORC2</image:title>
      <image:caption>Western blot testing of Jurkat lysate with CRTC2 antibody at 1ug/ml. Predicted molecular weight: ~73 kDa, observed here at ~90 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/crtc2-antibody-torc2-bha17107129</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2b91046f-72e5-421a-b878-fd96ba25991d.jpg?v=1775785939</image:loc>
      <image:title>CRTC2 Antibody / TORC2</image:title>
      <image:caption>Western blot testing of rat spinal cord lysate with CRTC2 antibody at 0.03ug/ml. Predicted molecular weight: ~73 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/crot-antibody-bha17107719</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3128abac-d1d8-42c5-a817-1dee810931e8.jpg?v=1775786003</image:loc>
      <image:title>Crot Antibody</image:title>
      <image:caption>Western blot testing of mouse liver lysate with Crot antibody at 1ug/ml. Predicted molecular weight: ~70kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/crp-antibody-bha17105995</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_75c5c5a7-0f46-42d2-bd3c-99c415852020.jpg?v=1775785790</image:loc>
      <image:title>Crp Antibody</image:title>
      <image:caption>IHC testing of FFPE rat kidney tissue with Crp antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cripto-1-antibody-bha17107121</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a79e5322-6b5a-4b38-a154-9fb9fcc64a58.jpg?v=1775785937</image:loc>
      <image:title>Cripto-1 Antibody</image:title>
      <image:caption>IHC testing of FFPE mouse embryonic liver with Cripto-1 antibody. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/creb3-antibody-bha17107133</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_462c93f1-3f71-4960-b00e-3258abacbf8d.jpg?v=1775785939</image:loc>
      <image:title>CREB3 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 lysate with CREB3 antibody at 0.3ug/ml. Predicted molecular weight: ~42kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/csrp3-antibody-bha17106392</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_29cac7c2-90ed-4fa9-873f-9a2684a7690b.jpg?v=1775785854</image:loc>
      <image:title>CSRP3 Antibody</image:title>
      <image:caption>Western blot testing of human [A], mouse [B] and rat [C] heart lysate with CSRP3 antibody at 0.01ug/ml. Predicted molecular weight: ~21 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/csk-antibody-bha17106918</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_adadf4e5-8770-4e2e-8aaf-19617082f5a2.jpg?v=1775785917</image:loc>
      <image:title>CSK Antibody</image:title>
      <image:caption>IHC staining of FFPE human colon with CSK antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cryptochrome-i-antibody-bha17105573</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_77033563-fdf8-4f7d-b103-9af880f8bf71.jpg?v=1775785715</image:loc>
      <image:title>Cryptochrome I Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat testis, 3) human HeLa lysate with Cryptochrome I antibody. Predicted/observed molecular weight ~66 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/csf1r-antibody-bha17107406</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c2aa39cc-7368-44b4-8653-7f025f6e2ecd.jpg?v=1775785969</image:loc>
      <image:title>CSF1R Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing Human CSF1R with MYC tag with CSF1R antibody (0.5ug/ml) in Lane A and probed with anti-MYC tag (1/1000) in lane C. Mock-transfected HEK293 probed with CSF1R antibody (1ug/ml) in Lane B.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/csrp2-antibody-bha17106943</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_294a356a-38ec-4fff-9c10-0909671894c7.jpg?v=1775785919</image:loc>
      <image:title>CSRP2 Antibody</image:title>
      <image:caption>Western blot testing of human [A], mouse [B] and rat [C] kidney lysates with CSRP2 antibody at 0.2ug/ml. Predicted/observed molecular weight: ~21/26kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/csen-antibody-bha17107217</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_74709df5-570d-423b-959a-16b3625b3d70.jpg?v=1775785951</image:loc>
      <image:title>CSEN Antibody</image:title>
      <image:caption>Western blot of HEK293 lysate overexpressing human KCNIP3-MYC probed with CSEN antibody [1ug/ml] in Lane A and anti-MYC [1/1000] in lane C. Mock-transfected HEK293 probed with CSEN antibody [1ug/ml] in Lane B. Predicted molecular weight: ~29kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ctbp1-antibody-bha17105548</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_690d7190-f261-4e3e-9fbd-40c33dd91c38.jpg?v=1775785710</image:loc>
      <image:title>CTBP1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human T-47D cells with CTBP1 antibody (red) and Alpha Tubulin mAb (green). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/csnk1a1-antibody-bha17105454</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c1b315eb-4230-4a01-957b-8704a0b89c77.jpg?v=1775785690</image:loc>
      <image:title>CSNK1A1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat kidney, 3) mouse kidney and 4) human HeLa lysate with CSNK1A1 antibody. Expected/observed molecular weight ~39 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/csnk1e-antibody-bha17107730</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f3a8b562-204c-4e6e-8b0e-3de2f57f3b09.jpg?v=1775786004</image:loc>
      <image:title>CSNK1E Antibody</image:title>
      <image:caption>Western blot of HEK293 lysate overexpressing human CSNK1E tested with CSNK1E antibody [mock transfection in lane 1]. Predicted molecular weight: ~47kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/crx-antibody-bha17106646</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a40d1984-f9ca-4d4b-ad87-1abc7efe2da5.jpg?v=1775785885</image:loc>
      <image:title>CRX Antibody</image:title>
      <image:caption>Western blot testing of rat retina lysate with CRX antibody at 1ug/ml. Predicted molecular weight: ~32kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/csnk2b-antibody-bha17107763</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_66646fb5-37aa-445b-8c5a-b1443ccd484c.jpg?v=1775786008</image:loc>
      <image:title>CSNK2B Antibody</image:title>
      <image:caption>Western blot testing of A) mouse NIH3T3 and human B) HeLa, C) K562, D) MCF7 and E) HepG2 lysates with CSNK2B antibody at 0.3ug/ml. Predicted molecular weight: ~25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/crx-antibody-bha17105957</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c99afd2a-6b41-4109-9362-37d69ecb50d7.jpg?v=1775785783</image:loc>
      <image:title>CRX Antibody</image:title>
      <image:caption>Western blot testing of human HepG2 cell lysate with CRX antibody at 0.5ug/ml. Predicted molecular weight ~32 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/csf1r-antibody-bha17107593</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_718916f7-8a72-49e2-a3bd-1030de2653c0.jpg?v=1775785991</image:loc>
      <image:title>CSF1R Antibody</image:title>
      <image:caption>Western blot testing of human ThP-1 cell lysate with CSF1R antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ctla-4-antibody-cd152-bha17106104</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_502b1349-09ea-42ff-841a-aecf61935e61.jpg?v=1775785810</image:loc>
      <image:title>CTLA-4 Antibody / CD152</image:title>
      <image:caption>IHC testing of FFPE mouse spleen tissue with CTLA-4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ctcf-antibody-bha17105458</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_64b747c5-dc23-46bc-a02a-dbf70524f182.jpg?v=1775785690</image:loc>
      <image:title>CTCF Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with CTCF antibody (green) and Alpha Tubulin mAb (red). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/csn1-antibody-bha17107725</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fe059b63-bcce-4c45-a20a-6cb134fcc53e.jpg?v=1775786004</image:loc>
      <image:title>CSN1 Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with CSN1 antibody at 0.5ug/ml. Predicted molecular weight: ~58kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/csb-antibody-cockayne-syndrome-b-bha17105846</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c2e7497d-a670-490b-b764-94f34698d6b3.jpg?v=1775785763</image:loc>
      <image:title>CSB Antibody / Cockayne Syndrome B</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) A431 and 3) SiHa cell lysate with CSB antibody at 0.5ug/ml. Predicted/observed molecular weight: ~168 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ctsk-antibody-cathepsin-k-bha17105443</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_884118cd-9005-47ed-be64-9f008e725c40.jpg?v=1775785692</image:loc>
      <image:title>CTSK Antibody / Cathepsin K</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) 22RV1 cell lysate with CTSK antibody. Predicted molecular weight ~37 kDa, with an ~46 kDa pro form and an ~27 kDa mature form.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ctdsp1-antibody-bha17106747</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1fdcbfd5-f5da-4464-ba3c-35c069861621.jpg?v=1775785897</image:loc>
      <image:title>CTDSP1 Antibody</image:title>
      <image:caption>Western blot testing of mouse testis lysate with CTDSP1 antibody at 0.1ug/ml. Predicted molecular weight: ~29kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/csnk1d-antibody-bha17106675</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_512a08ad-9ae3-4941-a8b7-ec084c8ba626.jpg?v=1775785890</image:loc>
      <image:title>CSNK1D Antibody</image:title>
      <image:caption>Western blot testing of HEK293 cell lysate with CSNK1D antibody at 0.3ug/ml. Predicted molecular weight: ~47 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ctgf-antibody-bha17105392</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_96dc0059-63af-4369-8702-4f599dcd1d93.jpg?v=1775785677</image:loc>
      <image:title>CTGF Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat thymus and 3) human HeLa lysate with CTGF antibody. Predicted/observed molecular weight ~38 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cullin-1-antibody-cul1-bha17105556</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_34a076e6-74fc-4d6c-a79a-ca076593e893.jpg?v=1775785709</image:loc>
      <image:title>Cullin 1 Antibody / CUL1</image:title>
      <image:caption>Western blot testing of 1) rat spleen, 2) rat lung, 3) rat thymus, 4) mouse lung, 5) human SW620 lysate with Cullin 1 antibody. Predicted/observed molecular weight ~90 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cxcl2-antibody-bha17105346</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d6b2d9ff-e12a-400c-85f0-9985aab6b8e6.jpg?v=1775785673</image:loc>
      <image:title>CXCL2 Antibody</image:title>
      <image:caption>Western blot testing of human recombinant protein with CXCL2 antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cxcl5-antibody-bha17105513</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9744a7d3-9482-4948-a8f4-a3a976db5121.jpg?v=1775785700</image:loc>
      <image:title>Cxcl5 Antibody</image:title>
      <image:caption>Western blot testing of rat recombinant protein with Cxcl5 antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cx3cr1-antibody-cmkbrl1-bha17106662</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b45fc33a-6d28-4a70-98f0-5830da2d69fb.jpg?v=1775785888</image:loc>
      <image:title>CX3CR1 Antibody / CMKBRL1</image:title>
      <image:caption>Western blot testing of KELLY [A] and U251-MG [B] lysates with CX3CR1 antibody at 2ug/ml. Predicted molecular weight ~40kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cxcl2-antibody-bha17105402</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_beff2e51-fb68-403e-a302-b9130361c677.jpg?v=1775785677</image:loc>
      <image:title>CXCL2 Antibody</image:title>
      <image:caption>Western blot testing of mouse recombinant protein with CXCL2 antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cxcr4-antibody-bha17106046</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3baad2c0-ac74-4b49-8f08-5bd665d27518.jpg?v=1775785801</image:loc>
      <image:title>CXCR4 Antibody</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate with CXCR4 antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa but may be observed at higher molecular weights due to glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cullin-3-antibody-bha17106335</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4343849d-9dba-4036-944a-2aafec410f7a.jpg?v=1775785847</image:loc>
      <image:title>Cullin 3 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with Cullin 3 antibody at 1ug/ml. Predicted molecular weight: ~89kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cybrd1-antibody-bha17106464</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1d3875ce-e764-45e0-bbe9-c134ba4c5f33.jpg?v=1775785864</image:loc>
      <image:title>CYBRD1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human testis with CYBRD1 antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ctbp2-antibody-bha17105490</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_25a2e745-d7c5-45cf-b4f3-c0c27b772252.jpg?v=1775785699</image:loc>
      <image:title>CTBP2 Antibody</image:title>
      <image:caption>Western blot testing of human 1) COLO320, 2) 293, and 3) HeLa lysate with CTBP2 antibody. Predicted/observed molecular weight ~49 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cxcl16-antibody-bha17105840</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fa00bd74-c5a8-4b90-ae34-821871e98b51.jpg?v=1775785762</image:loc>
      <image:title>CXCL16 Antibody</image:title>
      <image:caption>Western blot testing of human 1) CEM and 2) A549 lysate with CXCL16 antibody at 0.5ug/ml. Predicted molecular weight ~29 kDa, glycosylated form ~60 kDa, cleaved glycosylated form ~35 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyclin-a2-antibody-bha17105347</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_359a92ed-1449-4dcb-bf06-900d706d7d77.jpg?v=1775785677</image:loc>
      <image:title>Cyclin A2 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with Cyclin A2 antibody at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyb5r3-antibody-bha17106420</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4db2f591-5161-4b56-a7a4-b57e7c9e7223.jpg?v=1775785857</image:loc>
      <image:title>Cyb5r3 Antibody</image:title>
      <image:caption>Western blot testing of mouse lung lysate with Cyb5r3 antibody at 0.1ug/ml. Predicted molecular weight (mouse): ~34/32kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyclin-a1-antibody-bha17105507</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c8902731-d2da-4ca1-9b87-3907fe9598cf.jpg?v=1775785700</image:loc>
      <image:title>Cyclin A1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human PC-3 cells with Cyclin A1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cxxc4-antibody-bha17107089</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a69e76ac-a1b7-4799-81fc-a6808621e13d.jpg?v=1775785933</image:loc>
      <image:title>CXXC4 Antibody</image:title>
      <image:caption>IHC testing of FFPE human breast with CXXC4 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyb5r3-antibody-bha17106419</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_664ffeaa-8328-465c-a21c-6febbc3f676f.jpg?v=1775785860</image:loc>
      <image:title>CYB5R3 Antibody</image:title>
      <image:caption>Western blot testing of human umbilical cord lysate with CYB5R3 antibody at 0.01ug/ml. Predicted molecular weight (human): ~34/32/38kDa (isoforms 1/2/3).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyclin-t1-antibody-bha17105794</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_24c21c0b-df41-46f4-9d38-02837cfc6be4.jpg?v=1775785755</image:loc>
      <image:title>Cyclin T1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat kidney, 2) mouse spleen and 3) human Jurkat lysate with Cyclin T1 antibody at 0.5ug/ml. Predicted/observed molecular weight ~81 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyclin-d1-antibody-ccnd1-bha17105371</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_da47da61-7462-4b36-b9be-f79178df1275.jpg?v=1775785677</image:loc>
      <image:title>Cyclin D1 Antibody / CCND1</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with Cyclin D1 antibody (green) and Alpha Tubulin mAb (red). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyp17a1-antibody-bha17105906</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e496ee6f-0ae8-4bb5-b20e-dbe2d8127938.jpg?v=1775785776</image:loc>
      <image:title>CYP17A1 Antibody</image:title>
      <image:caption>Western blot testing of 22RV1 cell lysate (prostate carcinoma) with CYP17A1 antibody at 0.5ug/ml. Predicted molecular weight ~57 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyclophilin-a-antibody-ppia-bha17106049</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f5f13b69-b1a5-42a1-83e9-498dc140e529.jpg?v=1775785803</image:loc>
      <image:title>Cyclophilin A Antibody / PPIA</image:title>
      <image:caption>IHC testing of FFPE human intestinal cancer tissue with Cyclophilin A antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyp26a1-antibody-bha17107654</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b391ca10-a945-4974-996d-669b307f4f66.jpg?v=1775786000</image:loc>
      <image:title>CYP26A1 Antibody</image:title>
      <image:caption>IHC testing of PFA-fixed and TX100-treated HeLa cells with CYP26A1 antibody at 2.5ug/ml (DAPI nuclear counterstaining in blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyp1b1-antibody-bha17105584</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1c6750dc-a8c4-4de9-b9ab-0b338789ef3c.jpg?v=1775785718</image:loc>
      <image:title>CYP1B1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human liver cancer tissue with CYP1B1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyp24a1-antibody-bha17105535</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_64ace86e-088a-4010-ad23-50894454d190.jpg?v=1775785705</image:loc>
      <image:title>CYP24A1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat thymus, 2) rat lung, 3) HeLa, 4) 22RV1, 5) A431 and 6) mouse HEPA lysate with CYP24A1 antibody. Predicted/observed molecular weight ~59 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyp17a1-antibody-bha17107542</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_59155263-9f49-42cd-9124-8d23ac25fce6.jpg?v=1775785986</image:loc>
      <image:title>CYP17A1 Antibody</image:title>
      <image:caption>Western blot testing of human ovay lysate with CYP17A1 antibody at 0.3ug/ml. Predicted molecular weight: ~57kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyp2b6-antibody-bha17107208</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_82f1045e-dcd3-4c21-b539-f09ba83bfabf.jpg?v=1775785948</image:loc>
      <image:title>CYP2B6 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 [A] and K562 [B] lysates with CYP2B6 antibody at 0.1ug/ml. Predicted molecular weight: ~56kDa, observed here at ~75kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyp2c8-antibody-bha17107414</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0e2f94b8-de24-4f40-bba8-0b89ae2de083.jpg?v=1775785971</image:loc>
      <image:title>CYP2C8 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with CYP2C8 antibody at 0.1ug/ml. Predicted molecular weight: ~56kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyld-antibody-bha17106700</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_021f1a71-d356-44d0-95e8-83b3f56c644d.jpg?v=1775785892</image:loc>
      <image:title>Cyld Antibody</image:title>
      <image:caption>Western blot testing of rat brain lysate with Cyld antibody at 0.5ug/ml. Predicted molecular weight ~107 kDa, observed here at ~125 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cystatin-8-antibody-bha17106642</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bd20149b-89cf-4eab-8889-ba71c5d50300.jpg?v=1775785884</image:loc>
      <image:title>Cystatin 8 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing human CST8-MYC probed with Cystatin 8 antibody [0.3ug/ml] in Lane A and anti-MYC [1/1000] in lane C. Mock-transfected HEK294 probed with Cystatin 8 antibody [1ug/ml] in Lane B.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyclophilin-a-antibody-bha17106938</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_335ff082-3fe1-4172-b4ce-13e86e6a273d.jpg?v=1775785917</image:loc>
      <image:title>Cyclophilin A Antibody</image:title>
      <image:caption>Western blot testing of human lymph lysate with Cyclophilin A antibody at 0.1ug/ml. Predicted molecular weight ~18 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyp2d6-antibody-bha17105990</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_54e18d5e-20db-49e5-a641-4cf115a8fb32.jpg?v=1775785790</image:loc>
      <image:title>CYP2D6 Antibody</image:title>
      <image:caption>IHC testing of FFPE human liver cancer tissue with CYP2D6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyp3a4-antibody-cytochrome-p450-3a4-bha17105841</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bb8d9813-ad77-42c1-b166-8cd935fcd85d.jpg?v=1775785763</image:loc>
      <image:title>CYP3A4 Antibody / Cytochrome P450 3A4</image:title>
      <image:caption>IHC testing of FFPE human liver cancer tissue with CYP3A4 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyld-antibody-bha17105660</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_feb1e54d-861b-4294-87e6-e2898fdc7898.jpg?v=1775785728</image:loc>
      <image:title>CYLD Antibody</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) rat brain and 3) human HeLa lysate with CYLD antibody. Predicted/observed molecular weight ~107 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyp2d5-antibody-cyp2d10-bha17106372</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a2701875-f159-40fb-8f06-1af39f8812d2.jpg?v=1775785852</image:loc>
      <image:title>Cyp2d5 Antibody / Cyp2d10</image:title>
      <image:caption>Western blot testing of rat spleen lysate with Cyp2d5 antibody at 2ug/ml. Predicted molecular weight: ~57kDa, observed here at ~65kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cytokeratin-14-antibody-bha17105920</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cdbe036b-0f2e-4ca2-92b7-f8c0beb2c0f9.jpg?v=1775785779</image:loc>
      <image:title>Cytokeratin 14 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse NIH3T3 and 3) human HepG2 lysate with Cytokeratin 14 antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyp1a2-antibody-bha17107197</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d0e88516-9416-45ff-8999-48f2eac6a9f3.jpg?v=1775785946</image:loc>
      <image:title>Cyp1a2 Antibody</image:title>
      <image:caption>Western blot testing of fetal mouse liver lysate with Cyp1a2 antibody at 1ug/ml. Predicted molecular weight ~58 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyt19-antibody-bha17106289</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6a0f2ecb-db78-4da0-8d68-596a29f9489c.jpg?v=1775785839</image:loc>
      <image:title>Cyt19 Antibody</image:title>
      <image:caption>IHC testing of FFPE human kidney with Cyt19 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cystatin-3-antibody-bha17107088</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1aa78196-df2e-41da-a8e9-950de1025627.jpg?v=1775785935</image:loc>
      <image:title>Cystatin 3 Antibody</image:title>
      <image:caption>Western blot testing of mouse testis lysate with Cystatin 3 antibody at 0.01ug/ml. Predicted molecular weight: ~16 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cystathionase-antibody-bha17105414</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5e2df273-2d17-43a7-85f8-a3def9b56e16.jpg?v=1775785675</image:loc>
      <image:title>Cystathionase Antibody</image:title>
      <image:caption>Western blot testing of 1) human K562, 2) human HepG2, 3) rat RH35, 4) rat liver, 5) rat kidney and 6) mouse liver lysate with Cystathionase antibody. Predicted molecular weight ~44 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cytochrome-c-antibody-bha17106234</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0c4652d2-9c30-43c6-8c4e-7cf78eeb8834.jpg?v=1775785830</image:loc>
      <image:title>Cytochrome C Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat heart, 3) mouse brain, 4) mouse heart and human 5) HeLa, 6) MCF7, 7) 293T, 8) HepG2 and 9) Jurkat lysate with Cytochrome C antibody at 0.5ug/ml. Predicted molecular weight: 12~14 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cyclophilin-b-antibody-bha17106229</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_37a91763-cdf8-47df-92b2-8f719ff25886.jpg?v=1775785831</image:loc>
      <image:title>Cyclophilin B Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with Cyclophilin B antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cytokeratin-19-antibody-bha17107211</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ffe1b3cc-ad08-425a-a3c3-d07da5ff064d.jpg?v=1775785948</image:loc>
      <image:title>Cytokeratin 19 Antibody</image:title>
      <image:caption>Western blot testing of human colon cancer lysate with Cytokeratin 19 antibody at 0.03ug/ml. Predicted/observed molecular weight ~43/40-43kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cytokeratin-18-antibody-bha17105979</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_84807d1a-7ed7-4d87-9360-f1ce443c69bf.jpg?v=1775785791</image:loc>
      <image:title>Cytokeratin 18 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse liver, 3) human HeLa and 4) human HepG2 lysate with Cytokeratin 18 antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cytohesin-2-antibody-bha17106770</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2e2d9ea5-b492-4edd-bb9a-0fe6c57a09ff.jpg?v=1775785899</image:loc>
      <image:title>Cytohesin 2 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with Cytohesin 2 antibody at 0.5ug/ml. Predicted molecular weight: ~47kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cytoglobin-antibody-bha17106076</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e39394e5-3139-4fb8-bc8f-9ae1ea7588ff.jpg?v=1775785806</image:loc>
      <image:title>Cytoglobin Antibody</image:title>
      <image:caption>IHC testing of FFPE human intestinal cancer tissue with Cytoglobin antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cytokeratin-5-antibody-bha17105902</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_570c7f10-16fc-41bf-8766-9f381994b50a.jpg?v=1775785775</image:loc>
      <image:title>Cytokeratin 5 Antibody</image:title>
      <image:caption>IHC testing of FFPE human tonsil tissue with Cytokeratin 5 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cytokeratin-8-antibody-bha17105980</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4a6319e8-ff6e-4e71-b65b-9707ded0f712.jpg?v=1775785790</image:loc>
      <image:title>Cytokeratin 8 Antibody</image:title>
      <image:caption>IHC testing of FFPE human breast cancer tissue with Cytokeratin 8 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/cytokeratin-20-antibody-krt20-ck20-bha17106988</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e5d17916-3987-4262-a007-f8199e1dba9d.jpg?v=1775785923</image:loc>
      <image:title>Cytokeratin 20 Antibody / KRT20 / CK20</image:title>
      <image:caption>Western blot testing of human colon lysate with Cytokeratin 20 antibody at 0.03ug/ml. Predicted molecular weight: ~49kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dapp1-antibody-bha17107391</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_617533b7-916f-4316-9a34-db7e89a07bf6.jpg?v=1775785967</image:loc>
      <image:title>DAPP1 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate over expressing human DAPP1-FLAG with DAPP1 antibody (0.1ug/ml) in Lane A and anti-FLAG (1/3000) in lane C. Mock-transfected HEK293 probed with DAPP1 antibody (1ug/ml) in Lane B. Predicted molecular weight: ~32kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dbi-antibody-diazepam-binding-inhibitor-bha17105918</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_956ae72d-9844-45b2-b4d5-9e6c640c1d3f.jpg?v=1775785779</image:loc>
      <image:title>DBI Antibody / Diazepam Binding Inhibitor</image:title>
      <image:caption>Western blot testing of human placenta lysate with DBI antibody at 0.5ug/ml. Predicted molecular weight ~10 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dbf4-antibody-bha17106592</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_06f530cb-42c9-485f-b6a0-8dfe939856dc.jpg?v=1775785879</image:loc>
      <image:title>Dbf4 Antibody</image:title>
      <image:caption>Western blot testing of mouse testis lysate with Dbf4 antibody at 1ug/ml. Predicted molecular weight: ~74kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/darc-antibody-bha17107184</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fc8704d0-3613-41be-ae61-5b6c80f85bf1.jpg?v=1775785947</image:loc>
      <image:title>DARC Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with DARC antibody at 0.1ug/ml. Predicted molecular weight: ~36 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/darpp-32-antibody-bha17105672</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_19a8e9b4-e666-4f40-a2ad-ce775a612516.jpg?v=1775785732</image:loc>
      <image:title>DARPP-32 Antibody</image:title>
      <image:caption>Western blot testing of 1) human Caco-2, 2) rat brain and 3) mouse brain tissue lysate with DARPP-32 antibody. Expected molecular weight ~32 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dapk2-antibody-bha17107258</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5cd1c83e-59e1-4601-b0ce-69a97f4c0c21.jpg?v=1775785953</image:loc>
      <image:title>DAPK2 Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with DAPK2 antibody at 2ug/ml. Predicted/observed molecular weight: ~43kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ddah1-antibody-bha17105756</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a82d83b5-b8bb-41f8-8711-021e76c115f2.jpg?v=1775785746</image:loc>
      <image:title>DDAH1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat kidney, 2) mouse kidney and 3) human HeLa lysate with DDAH1 antibody at 0.5ug/ml. Expected molecular weight: 31-38 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dcdc2-antibody-bha17106554</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fbf4dc79-b59c-431c-ba08-a8f7383b11d3.jpg?v=1775785878</image:loc>
      <image:title>DCDC2 Antibody</image:title>
      <image:caption>Western blot testing of COS7 cell lysate transfected with full length human DCDC2 [A] and untransfected control COS7 cells [B] with DCDC2 antibody at 0.2ug/ml. Predicted molecular weight: ~53/26kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dbc1-antibody-bha17106963</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d69bac61-4395-435e-bf13-67160770addb.jpg?v=1775785922</image:loc>
      <image:title>DBC1 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 [A] and MCF7 [B] nuclear lysates with DBC1 antibody at 0.5ug/ml. Predicted molecular weight: ~103/140kDa (unmodified/acetylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ddb2-antibody-bha17105621</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b4165fe1-8552-4666-983b-73992d69e717.jpg?v=1775785722</image:loc>
      <image:title>DDB2 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with DDB2 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dcxr-antibody-bha17107086</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9129e514-5eae-4ac2-bef1-9312f2ec7d08.jpg?v=1775785934</image:loc>
      <image:title>DCXR Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with DCXR antibody at 0.1ug/ml. Predicted molecular weight: ~26kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dc-sign-antibody-bha17107683</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_db381ec9-a286-44e1-ab6b-f3ba27d4307b.jpg?v=1775786001</image:loc>
      <image:title>DC-SIGN Antibody</image:title>
      <image:caption>IF/ICC staining of fixed and permeabilized human ThP-1 cells with DC-SIGN antibody (green) at 10ug/ml and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ddx19-antibody-bha17106621</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1fadc928-2d62-49a1-ae80-5fa30e5e9e63.jpg?v=1775785884</image:loc>
      <image:title>DDX19 Antibody</image:title>
      <image:caption>Western blot testing of K562 cell lysate with DDX19 antibody at 0.5ug/ml. Predicted molecular weight: ~50kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dagla-antibody-bha17107723</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_dc5b21d6-c633-4406-95fa-d906e7f6695e.jpg?v=1775786004</image:loc>
      <image:title>DAGLA Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with DAGLA antibody at 0.3ug/ml. Predicted molecular weight: ~115 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ddb1-antibody-bha17106613</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6db05e3c-e4a2-4110-8dd4-66aa274348a9.jpg?v=1775785882</image:loc>
      <image:title>DDB1 Antibody</image:title>
      <image:caption>Western blot testing of mouse NSO lysate with DDB1 antibody at 1ug/ml. Predicted molecular weight: ~127 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dcx-antibody-doublecortin-bha17105914</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_22c917bf-f6c4-4c5c-8df5-ab31b0a4a8f5.jpg?v=1775785776</image:loc>
      <image:title>DCX Antibody / Doublecortin</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse brain with DCX antibody at 0.5ug/ml. Predicted molecular weight: 40-50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dazl-antibody-bha17107066</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6f999019-f159-4c5e-9373-252f66075ac5.jpg?v=1775785933</image:loc>
      <image:title>DAZL Antibody</image:title>
      <image:caption>Western blot testing of rat testis lysate with DAZL antibody at 1ug/ml. Predicted molecular weight: ~32 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/daxx-antibody-bha17105673</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ea7d1a29-3318-4217-8aa4-6374de9a3b66.jpg?v=1775785735</image:loc>
      <image:title>Daxx Antibody</image:title>
      <image:caption>Flow cytometry testing of human 293T cells with Daxx antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Daxx antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dbh-antibody-dopamine-beta-hydroxylase-bha17106631</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8057b7ea-be97-465f-a22a-e4bac85b7ed9.jpg?v=1775785883</image:loc>
      <image:title>DBH Antibody / Dopamine beta-hydroxylase</image:title>
      <image:caption>Western blot testing of Jurkat lysate with DBH antibody at 2ug/ml. Predicted molecular weight ~69 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ddah2-antibody-bha17105757</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a0ea0d2e-5435-4d11-92a1-4f105db8b454.jpg?v=1775785745</image:loc>
      <image:title>DDAH2 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with DDAH2 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ddx5-antibody-bha17107808</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4a95563d-c164-4140-b231-36e30e2e52ca.jpg?v=1775786013</image:loc>
      <image:title>DDX5 Antibody</image:title>
      <image:caption>Western blot testing of mouse NIH3T3 [A] and human HeLa [B], A431 [C] and Jurkat [D] nuclear lysates with DDX5 antibody at 0.3ug/ml. Predicted molecular weight: ~68 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ddx6-antibody-bha17106306</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_737ca022-2309-49b1-9274-523f6e4b8f5d.jpg?v=1775785840</image:loc>
      <image:title>DDX6 Antibody</image:title>
      <image:caption>Western blot testing of Daudi [A], Jurkat [B] and HepG2 [C] lysates with DDX6 antibody at 0.3ug/ml. Predicted molecular weight: ~53kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dbnl-antibody-bha17106292</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1df7a529-458e-4bed-881d-a7bb881945f4.jpg?v=1775785838</image:loc>
      <image:title>DBNL Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with DBNL antibody at 1ug/ml. Predicted molecular weight: ~49kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ddx3-antibody-n-terminal-region-bha17106151</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6aaa8489-5a24-4562-9d58-686369303214.jpg?v=1775785817</image:loc>
      <image:title>DDX3 Antibody (N-Terminal Region)</image:title>
      <image:caption>Immunofluorescent staining of FFPE human SiHa cells with DDX3 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dap3-antibody-bha17107670</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_76be2e4d-1945-4bd5-aa94-9cbae3d4303a.jpg?v=1775786001</image:loc>
      <image:title>DAP3 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with DAP3 antibody at 3ug/ml. Predicted molecular weight: ~46/41/42 kDa (isoforms 1/2/3).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ddb1-antibody-bha17105574</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_733e9f51-f0d5-43af-a896-72128009a836.jpg?v=1775785717</image:loc>
      <image:title>DDB1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with DDB1 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/def6-antibody-bha17106320</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8f51b2fc-763a-4779-85cd-0444a3f32daa.jpg?v=1775785843</image:loc>
      <image:title>DEF6 Antibody</image:title>
      <image:caption>Western blot testing of human thymus lysate with DEF6 antibody at 1ug/ml. Predicted molecular weight: ~74kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dentt-antibody-bha17107813</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_97384181-68ea-466c-acd5-74dddea628b3.jpg?v=1775786013</image:loc>
      <image:title>DENTT Antibody</image:title>
      <image:caption>IHC testing of FFPE human human testis with DENTT antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/defensin-1-3-antibody-bha17106538</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9f0f3a87-5aa9-4b58-8648-2ab06a6ffd99.jpg?v=1775785873</image:loc>
      <image:title>Defensin 1/3 Antibody</image:title>
      <image:caption>IHC staining of FFPE human thymus with Defensin 1/3 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dio2-antibody-bha17106997</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f3f20a44-742f-4d1b-8add-335ab7579151.jpg?v=1775785924</image:loc>
      <image:title>DIO2 Antibody</image:title>
      <image:caption>IHC testing of PFA-fixed cryosectioned mouse hippocampus with DIO2 antibody at 2ug/ml. HIER: microwaved with pH4.5 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/decorin-antibody-bha17107359</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_60ab7662-0395-4206-a9d4-cfad50196bbc.jpg?v=1775785964</image:loc>
      <image:title>Decorin Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with Decorin antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa (non-glycanated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dcx-antibody-bha17107782</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2a22ec3b-0c1c-4761-b3e8-c10684ba4c8d.jpg?v=1775786011</image:loc>
      <image:title>DCX Antibody</image:title>
      <image:caption>Western blot testing of mouse fetal brain lysate with DCX antibody at 0.5ug/ml. Predicted molecular weight: 40-50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dishevelled-2-antibody-bha17105950</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_73b7625c-8263-44ea-9f28-78d946b8cf63.jpg?v=1775785782</image:loc>
      <image:title>Dishevelled 2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver and 2) mouse kidney lysate with Dishevelled 2 antibody at 0.5ug/ml. Predicted molecular weight ~79 kDa, can be observed at 90-95 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dixdc1-antibody-bha17106725</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e927a705-6831-480e-a621-4a7d138ae6c3.jpg?v=1775785896</image:loc>
      <image:title>DIXDC1 Antibody</image:title>
      <image:caption>Western blot testing of human skeletal muscle lysate with DIXDC1 antibody at 0.5ug/ml. Predicted molecular weight: ~54kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dj-1-antibody-park7-bha17106294</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_26d26b05-bc56-4b39-818a-6af0258b56aa.jpg?v=1775785839</image:loc>
      <image:title>DJ-1 Antibody / PARK7</image:title>
      <image:caption>Western blot testing of HeLa [A] and Jurkat [B] lysates with DJ-1 antibody at 0.05ug/ml. Predicted molecular weight ~20 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dkc1-antibody-bha17107462</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8e15d1b1-9521-4312-ae77-89c0b33b4a4d.jpg?v=1775785976</image:loc>
      <image:title>DKC1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human spleen with DKC1 antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dgat2-antibody-bha17107377</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cd6eb1ef-1bc0-49cd-bb03-318fe4a1ab29.jpg?v=1775785966</image:loc>
      <image:title>DGAT2 Antibody</image:title>
      <image:caption>IHC testing of FFPE human liver with DGAT2 antibody at 3ug/ml. HIER: microwave with pH9 Tris/EDTA buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dlg1-antibody-sap97-bha17107693</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_20735790-c997-4b51-aa4a-c18014084aea.jpg?v=1775786001</image:loc>
      <image:title>DLG1 Antibody / SAP97</image:title>
      <image:caption>Western blot testing of KELLY cell lysate with DLG1 antibody at 0.3ug/ml. Predicted molecular weight: ~103kDa, rountinely observed at ~140kDa (Ref 1).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dj-1-antibody-park7-biotin-conjugate-bha17106295</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_515a0e79-c357-4ffb-bf5e-e475eff5407c.jpg?v=1775785838</image:loc>
      <image:title>DJ-1 Antibody / PARK7 [Biotin Conjugate]</image:title>
      <image:caption>Western blot testing of human Jurkat lysate with biotinylated DJ-1 antibody at 0.2ug/ml. Predicted molecular weight ~20 kDa. An NAP blocker was used in place of non-fat milk as blocking solution and diluent. (1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dkk2-antibody-bha17106362</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_81006286-d613-4f0e-9e5e-404f4e5c7e08.jpg?v=1775785850</image:loc>
      <image:title>DKK2 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with DKK2 antibody at 2ug/ml. Expected molecular weight: 28-35 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dhodh-antibody-dihydroorotate-dehydrogenase-bha17105842</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_dea97fac-b102-4464-9dc4-d4c2ff1e57da.jpg?v=1775785763</image:loc>
      <image:title>DHODH Antibody / Dihydroorotate dehydrogenase</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse spleen and 3) human HepG2 lysate with DHODH antibody at 0.5ug/ml. Predicted/observed molecular weight ~43 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dkk3-antibody-bha17106286</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_95a686e0-3c2c-4453-ad68-16ddc764732b.jpg?v=1775785840</image:loc>
      <image:title>DKK3 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate with DKK3 antibody at 2ug/ml. Predicted molecular weight: ~38kDa, but can be observed at up to 70kDa due to glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/disc1-antibody-bha17107196</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2d83ce94-93bd-41d3-879b-d14a5de86718.jpg?v=1775785950</image:loc>
      <image:title>DISC1 Antibody</image:title>
      <image:caption>Western blot testing of human hippocampus lysate with DISC1 antibody at 0.1ug/ml. Predicted molecular weight: ~94 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dll4-antibody-center-region-bha17107413</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_55a4eee1-7237-42e5-958f-8131da1a9535.jpg?v=1775785971</image:loc>
      <image:title>DLL4 Antibody (Center Region)</image:title>
      <image:caption>Western blot testing of human [A], mouse [B] and rat [C] lung lysates with DLL4 antibody at 0.3ug/ml. Predicted/observed molecular weight 75~85kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dlx5-antibody-bha17106367</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_97eccf60-df5b-45bd-a2a0-e7c3950d8ec6.jpg?v=1775785850</image:loc>
      <image:title>DLX5 Antibody</image:title>
      <image:caption>Western blot testing of human bone marrow lysate with DLX5 antibody at 1ug/ml. Predicted molecular weight: ~31kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dll1-antibody-bha17106358</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_713864e9-23d6-4562-8ef8-ad0cb60fc0ff.jpg?v=1775785851</image:loc>
      <image:title>DLL1 Antibody</image:title>
      <image:caption>Western blot testing of mouse heart lysate with DLL1 antibody at 0.3ug/ml. Predicted molecular weight ~78 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dna-polymerase-eta-antibody-polh-bha17105683</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0ded05a9-091f-4706-9bff-fc9ccbdd41e1.jpg?v=1775785733</image:loc>
      <image:title>DNA polymerase eta Antibody / POLH</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) human HeLa and 3) human SW620 lysate with DNA polymerase eta antibody. Expected/observed molecular weight ~78 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dmtf1-antibody-bha17106443</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bf7613d0-bbd4-4c2f-babf-f33a0f6d9076.jpg?v=1775785862</image:loc>
      <image:title>DMTF1 Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with DMTF1 antibody at 1ug/ml. Predicted molecular weight: ~84kDa (isoforms a), observed here at ~70kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dkk1-antibody-bha17106375</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f7337af0-6500-408d-bd12-3e2668165284.jpg?v=1775785851</image:loc>
      <image:title>DKK1 Antibody</image:title>
      <image:caption>Western blot testing of human bone marrow lysate with DKK1 antibody at 1ug/ml. Predicted molecular weight: 26-40 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dmrt1-antibody-bha17105689</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_19ad31ce-62cf-42ec-97d0-540d47a531da.jpg?v=1775785734</image:loc>
      <image:title>DMRT1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat testis and 2) mouse testis lysate with DMRT1 antibody. Expected/observed molecular weight ~39 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dmrt2-antibody-bha17107471</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_40e5e53b-42a7-41a8-8f40-b04a3b8862ec.jpg?v=1775785976</image:loc>
      <image:title>DMRT2 Antibody</image:title>
      <image:caption>IHC testing of FFPE human kidney with DMRT2 antibody at 2ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dmp1-antibody-bha17106895</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_56455f18-0e42-4eb3-b49a-a8a84e2190d9.jpg?v=1775785912</image:loc>
      <image:title>DMP1 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with DMP1 antibody at 1ug/ml. Predicted molecular weight: ~56kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dkk2-antibody-bha17105671</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b9c7344a-6447-4022-bfb9-5e300aabe6a8.jpg?v=1775785731</image:loc>
      <image:title>DKK2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat heart, 2) rat brain and 3) human A549 lysate with DKK2 antibody. Expected molecular weight: 28-35 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dishevelled-antibody-dvl1-bha17107389</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1a4e920f-9fb1-472e-8041-34fe25709b18.jpg?v=1775785967</image:loc>
      <image:title>Dishevelled Antibody / DVL1</image:title>
      <image:caption>Western blot testing of porcine MII oocyte lysate with Dishevelled antibody at 1ug/ml. Predicted molecular weight: ~76kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dmtf1-antibody-bha17106502</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9589fde4-f6ca-4148-9cb1-054182d0a962.jpg?v=1775785868</image:loc>
      <image:title>DMTF1 Antibody</image:title>
      <image:caption>Western blot testing of human [A], mouse [B] and rat [C] testis lysate with DMTF1 antibody at 1ug/ml. Predicted molecular weight: ~84/75kDa (isoforms a/b).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dnajb9-antibody-bha17107732</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a243f9b7-053e-4309-8aa4-237af610e3e2.jpg?v=1775786004</image:loc>
      <image:title>DNAJB9 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with DNAJB9 antibody at 1ug/ml. Predicted molecular weight: ~26kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dnajc5g-antibody-bha17106692</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a0a3af6a-3dc7-40a2-8351-c77168317287.jpg?v=1775785892</image:loc>
      <image:title>DNAJC5G Antibody</image:title>
      <image:caption>IHC testing of FFPE human testis with DNAJC5G antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dld-antibody-bha17105276</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5c73a990-c3a7-4f0b-bc11-1c709893ada3.jpg?v=1775785677</image:loc>
      <image:title>DLD Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human MCF7 cells with DLD antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dok5-antibody-docking-protein-5-bha17106418</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f74dbe04-1959-4c47-a71f-d2905c55d603.jpg?v=1775785858</image:loc>
      <image:title>DOK5 Antibody / Docking protein 5</image:title>
      <image:caption>Western blot testing of HEK293 cell lysate overexpressing DOK5 with DOK5 antibody [mock transfection in lane 1]. Predicted molecular weight: ~36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dpm3-antibody-bha17107107</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5eeb170a-92f4-4bb8-ada7-0c2d19a95424.jpg?v=1775785936</image:loc>
      <image:title>DPM3 Antibody</image:title>
      <image:caption>Western blot testing of K562 lysate with DPM3 antibody at 2ug/ml. Predicted molecular weight: ~10/13kDa (short/long isoform).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dr4-antibody-tnfrsf10a-bha17105928</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f407f03a-a30a-4c06-ba13-bf275b9baaec.jpg?v=1775785779</image:loc>
      <image:title>DR4 Antibody / TNFRSF10A</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with DR4 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/doublecortin-antibody-bha17107506</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ed07a208-5da3-4058-8797-00a7bc5f8ac0.jpg?v=1775785982</image:loc>
      <image:title>Doublecortin Antibody</image:title>
      <image:caption>Western blot testing of mouse fetal brain lysate with Doublecortin antibody at 0.01ug/ml. Predicted molecular weight: 40-50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dr5-antibody-trail-r2-bha17105952</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8e811a3d-91ff-4cd5-87c4-6cb1b02fc94e.jpg?v=1775785786</image:loc>
      <image:title>DR5 Antibody / TRAIL R2</image:title>
      <image:caption>IHC testing of FFPE mouse intestine tissue with DR5 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/drak2-antibody-bha17107209</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_51df530c-5f18-49bd-8f6a-6cbc6cbb57b0.jpg?v=1775785947</image:loc>
      <image:title>DRAK2 Antibody</image:title>
      <image:caption>Western blot testing of MOLT4 lysate with DRAK2 antibody at 1ug/ml. Predicted molecular weight: ~42kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dtx3-antibody-bha17107409</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_15bcb151-33ba-4719-a51b-0a45c3c9cec6.jpg?v=1775785970</image:loc>
      <image:title>DTX3 Antibody</image:title>
      <image:caption>Western blot testing of NIH3T3 lysate with DTX3 antibody at 0.3ug/ml. Predicted molecular weight: ~38 kDa, observed here at ~90 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/duox1-antibody-bha17106835</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_16ee8aec-797b-4507-80e0-402d77f2d780.jpg?v=1775785907</image:loc>
      <image:title>DUOX1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human thyroid gland with DUOX1 antibody at 4ug/ml. HIER: steamed with pH9 Tris/EDTA buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dpp10-antibody-bha17106526</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_82bb84d5-c742-47be-9327-ccb4da6d3202.jpg?v=1775785872</image:loc>
      <image:title>DPP10 Antibody</image:title>
      <image:caption>Western blot testing of human bone marrow lysate with DPP10 antibody at 0.1ug/ml. Predicted molecular weight: ~90 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dusp10-antibody-bha17106457</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b5a8cf1a-cff6-48c1-b13e-0715890ca840.jpg?v=1775785862</image:loc>
      <image:title>DUSP10 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with DUSP10 antibody at 0.5ug/ml. Predicted molecular weight: ~53 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dysadherin-antibody-bha17107053</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1b276280-8a9a-4c7e-8476-6232a03ac795.jpg?v=1775785930</image:loc>
      <image:title>Dysadherin Antibody</image:title>
      <image:caption>Western blot testing of human spleen lysate with Dysadherin antibody at 0.5ug/ml. Predicted molecular weight: ~19kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/duox1-antibody-bha17106477</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ef2cb4d6-f57a-4762-bad5-8fed906a2651.jpg?v=1775785867</image:loc>
      <image:title>DUOX1 Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with DUOX1 antibody at 0.1ug/ml. Predicted molecular weight: ~177/140kDa (isoforms 1/2). Both observed bands are blocked by addition of immunizingn peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dscam-antibody-bha17106708</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_05d2f341-aa13-49d3-bfaf-28049116a416.jpg?v=1775785892</image:loc>
      <image:title>DSCAM Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with DSCAM antibody at 2ug/ml. Predicted molecular weight: ~174 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dusp8-antibody-bha17106307</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6e084168-6daa-44a0-99a8-5a82334391f5.jpg?v=1775785840</image:loc>
      <image:title>DUSP8 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum with DUSP8 antibody at 2ug/ml. Predicted molecular weight: ~66kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dvl3-antibody-bha17106077</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_142dd2ad-9b20-48a8-8026-3cd4e1845ee3.jpg?v=1775785805</image:loc>
      <image:title>DVL3 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse brain lysate with DVL3 antibody at 0.5ug/ml. Predicted molecular weight ~78 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dyx1c1-antibody-bha17107803</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fb2941d1-51da-4277-ab2d-27d42e9cfaff.jpg?v=1775786011</image:loc>
      <image:title>DYX1C1 Antibody</image:title>
      <image:caption>Western blot testing of human brain frontal cortex lysate with DYX1C1 antibody at 0.5ug/ml. Predicted molecular weight: ~48/44/44kDa (isoforms a/b/c).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/e-cadherin-antibody-bha17106731</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0d996fa9-dcea-4d5e-948b-fa6048e177f9.jpg?v=1775785896</image:loc>
      <image:title>E-Cadherin Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with E-Cadherin antibody at 0.5ug/ml. Expected molecular weight: 135 kDa (precursor), 80-120 kDa (mature, depending on gylcosylation level).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dusp16-antibody-bha17106311</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c30ad3fa-c806-46b7-8597-72145b781910.jpg?v=1775785843</image:loc>
      <image:title>DUSP16 Antibody</image:title>
      <image:caption>IHC testing of FFPE human placenta with DUSP16 antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dyrk1a-antibody-bha17107776</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_11e8b23d-8dc7-4514-81fe-61cf29710f1b.jpg?v=1775786009</image:loc>
      <image:title>DYRK1A Antibody</image:title>
      <image:caption>Western blot testing of K562 lysate with DYRK1A antibody at 0.5ug/ml. Predicted molecular weight ~85 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/e-cadherin-antibody-cdh1-bha17105300</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d52c2e33-578e-4c98-b6aa-cf82ddc0ec7c.jpg?v=1775785684</image:loc>
      <image:title>E-Cadherin Antibody / CDH1</image:title>
      <image:caption>Immunofluorescent staining of FFPE human MCF7 cells with E-Cadherin antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/e2f3-antibody-bha17105931</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_82a43f53-8e7d-4ff9-8c31-0f18fe431de9.jpg?v=1775785779</image:loc>
      <image:title>E2F3 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse heart and 3) human U-2 OS lysate with E2F3 antibody at 0.5ug/ml. Predicted molecular weight ~49 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/e2f6-antibody-bha17107667</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_19fa7277-dc16-47cb-8e35-d57c2c5aab99.jpg?v=1775785998</image:loc>
      <image:title>E2F6 Antibody</image:title>
      <image:caption>Western blot testing of human skeletal muscle lysate with E2F6 antibody at 1ug/ml. Predicted molecular weight: ~32kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/e2f4-antibody-bha17106656</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f60843b8-2b6b-4ec6-9dc5-05d18ec15b31.jpg?v=1775785886</image:loc>
      <image:title>E2F4 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with E2F4 antibody at 2ug/ml. Expected molecular weight ~44 kDa (unmodified) and 60-65 kDa (phosphorylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/e2f3-antibody-bha17106604</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_757d8f46-ce7a-4f9b-a4c0-1c5ccc3629ab.jpg?v=1775785880</image:loc>
      <image:title>E2F3 Antibody</image:title>
      <image:caption>Western blot testing of mouse fetal lung lysate with E2F3 antibody at 1ug/ml with [B] and without [A] blocking/immunizing peptide. Predicted molecular weight: ~49 kDa but can also be observed from 56~66 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ece1-antibody-endothelin-converting-enzyme-1-bha17106031</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_35d534f7-f03c-4dec-84e5-0c57e986546f.jpg?v=1775785797</image:loc>
      <image:title>ECE1 Antibody / Endothelin converting enzyme 1</image:title>
      <image:caption>Immunohistochemical staining of FFPE human lung cancer tissue with ECE1 antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ebf1-antibody-bha17107164</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_122651ea-21d3-4edb-8080-5b5a51724fc9.jpg?v=1775785942</image:loc>
      <image:title>EBF1 Antibody</image:title>
      <image:caption>Western blot testing of human adipose lysate with EBF1 antibody at 0.3ug/ml. Predicted molecular weight: ~65kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/eb3-antibody-mapre3-bha17107383</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_39c4b6d5-e3ba-469c-98bc-03c10174ef75.jpg?v=1775785966</image:loc>
      <image:title>EB3 Antibody [MAPRE3]</image:title>
      <image:caption>Western blot testing of human [A], mouse [B] and rat [C] brain lysate with EB3 antibody at 0.1ug/ml. Predicted molecular weight: ~32kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/e2f7-antibody-bha17106622</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ffc9c8b7-77bb-4bfe-8377-df4cc169d6c9.jpg?v=1775785885</image:loc>
      <image:title>E2F7 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with E2F7 antibody at 0.3ug/ml. Predicted molecular weight: ~100kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/dyx1c1-antibody-bha17107354</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5453625d-ef2e-44af-bf6c-431dbde56f64.jpg?v=1775785966</image:loc>
      <image:title>DYX1C1 Antibody</image:title>
      <image:caption>IHC staining of FFPE human cerebral cortex with DYX1C1 antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ecsm2-antibody-bha17107659</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bed27834-d793-4224-a5b2-bbb40dde2cb6.jpg?v=1775785997</image:loc>
      <image:title>ECSM2 Antibody</image:title>
      <image:caption>Western blot testing of human A) lung and B) umbical cord lysates with ECSM2 antibody at 1ug/ml. Predicted molecular weight: ~21/40-60 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ebp1-antibody-erbb3-binding-protein-1-pa2g4-bha17105930</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_207e0ab5-36db-4d3d-9f8b-438ec16a0e8d.jpg?v=1775785780</image:loc>
      <image:title>EBP1 Antibody / ErbB3-binding protein 1 / PA2G4</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse NIH3T3 and 3) human HepG2 lysate with EBP1 antibody at 0.5ug/ml. Observed molecular weight 42 kDa (p42 isoform) and 48 kDa (p48 isoform).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/e2f4-antibody-bha17105843</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_58fe6c7c-7817-4986-b4eb-685ad00f8ba8.jpg?v=1775785763</image:loc>
      <image:title>E2F4 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) U-2 OS and 3) MCF7 lysate with E2F4 antibody at 0.5ug/ml. Expected molecular weight ~44 kDa (unmodified) and 60-65 kDa (phosphorylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ebag9-antibody-rcas1-bha17107288</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8ff8adf8-05e6-472a-8ed4-388efe5e2313.jpg?v=1775785956</image:loc>
      <image:title>EBAG9 Antibody / RCAS1</image:title>
      <image:caption>Western blot testing of A431 lysate with EBAG9 antibody at 0.2ug/ml with [B] and without [A] blocking/immunizing peptide. Predicted molecular weight: ~25/29-34 kDa (isoform 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/eg-vegf-antibody-prok1-bha17105564</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a885e3c9-b35b-47f7-8fe0-e5f30c7bd01d.jpg?v=1775785711</image:loc>
      <image:title>Eg-Vegf Antibody / Prok1</image:title>
      <image:caption>Western blot testing of 1) mouse liver and 2) mouse spleen lysate with Eg-Vegf antibody. Expected molecular weight ~12/10 kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/egfl7-antibody-bha17107122</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9a793ee4-10fc-4ddd-84a2-b945328e54ac.jpg?v=1775785938</image:loc>
      <image:title>EGFL7 Antibody</image:title>
      <image:caption>Western blot testing of human heart [A], kidney [B] and lung [C] lysates with EGFL7 antibody at 1ug/ml. Predicted molecular weight: ~29/27kDa (pro/mature form).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ednrb-antibody-bha17105373</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b5be6ff9-2693-4ca2-864f-f6bcfdac8fc6.jpg?v=1775785676</image:loc>
      <image:title>EDNRB Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with EDNRB antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/egf-antibody-bha17106124</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9d46551b-52ab-4fdd-b05a-6ba8fe0275ff.jpg?v=1775785812</image:loc>
      <image:title>Egf Antibody</image:title>
      <image:caption>IHC testing of FFPE rat kidney tissue with Egf antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/eg-vegf-antibody-prokineticin-1-bha17105492</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_84fe96b4-bce2-413e-976c-dba7697efb6c.jpg?v=1775785696</image:loc>
      <image:title>EG-VEGF Antibody / Prokineticin-1</image:title>
      <image:caption>Western blot testing of human MCF7 cell lysate with EG-VEGF antibody. Expected molecular weight ~12 kDa, observed here at ~20 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/e2f4-antibody-bha17107783</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e66fb199-e5e0-4502-abe2-8db8dcdd515d.jpg?v=1775786009</image:loc>
      <image:title>E2F4 Antibody</image:title>
      <image:caption>Western blot testing of A431 [A] and HeLa [B] lysates with E2F4 antibody at 0.3ug/ml. Expected molecular weight ~44 kDa (unmodified) and 60-65 kDa (phosphorylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/egr2-antibody-bha17107131</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f8bd445a-57c7-43dc-8963-2bbce2b17bf6.jpg?v=1775785938</image:loc>
      <image:title>EGR2 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 cell lysate with EGR2 antibody at 2ug/ml. Expected/observed molecular weight ~53 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/egr4-antibody-bha17107586</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_67ec415f-f246-4211-a3b0-916447255e09.jpg?v=1775785988</image:loc>
      <image:title>EGR4 Antibody</image:title>
      <image:caption>Western blot testing of human hippocampus lysate with EGR4 antibody at 0.3ug/ml. Predicted molecular weight: ~51kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/eef1a2-antibody-bha17107662</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_753981ed-13bd-4c46-82aa-dc46f8a25940.jpg?v=1775785998</image:loc>
      <image:title>EEF1A2 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with EEF1A2 antibody at 0.5ug/ml. Predicted molecular weight: ~51kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ehd2-antibody-bha17106461</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3a579a86-7099-4d15-8ffa-39da20adcf68.jpg?v=1775785862</image:loc>
      <image:title>EHD2 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with EHD2 antibody at 0.1ug/ml. Predicted molecular weight: ~61 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/efhd2-antibody-bha17106369</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_356b7444-6b03-44d0-98aa-9e4cab6f6e3a.jpg?v=1775785850</image:loc>
      <image:title>EFHD2 Antibody</image:title>
      <image:caption>Western blot testing of human 1) thymus, 2) lymph node and 3) tonsil lysates with EFHD2 antibody at 0.5ug/ml. Predicted molecular weight: ~27 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/edf1-antibody-bha17107642</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_09cde42b-73f2-4231-8ed7-c289e224a818.jpg?v=1775785994</image:loc>
      <image:title>EDF1 Antibody</image:title>
      <image:caption>Western blot testing of A549 lysate with EDF1 antibody at 0.3ug/ml. Predicted molecular weight: ~16kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/egfr-antibody-n-terminal-region-bha17106105</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c8540130-5fd0-4160-9312-97538da721e9.jpg?v=1775785810</image:loc>
      <image:title>EGFR Antibody (N-Terminal Region)</image:title>
      <image:caption>Western blot testing of human A431 cell lysate with EGFR antibody at 0.5ug/ml. Expected molecular weight: ~134 kDa (unmodified), ~170 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/eif3m-antibody-bha17107585</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_88216bd8-f33e-435f-b7b6-1c54e4d05cd7.jpg?v=1775785990</image:loc>
      <image:title>EIF3M Antibody</image:title>
      <image:caption>Western blot testing of A549 lysate with EIF3M antibody at 0.1ug/ml. Predicted molecular weight: ~42kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/eif3e-antibody-eif-3-p48-bha17107386</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8ad0b3d8-2ee3-4e34-8baa-25fa5cd5826a.jpg?v=1775785966</image:loc>
      <image:title>EIF3E Antibody / eIF-3 p48</image:title>
      <image:caption>Western blot testing of Daudi lysate with EIF3E antibody at 0.03ug/ml. Predicted/observed molecular weight: ~52/48-52kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/eif4a2-antibody-bha17105559</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1cb4a533-d419-4306-bbc1-c8b72a2c73c5.jpg?v=1775785713</image:loc>
      <image:title>EIF4A2 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with EIF4A2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/eif4enif1-antibody-bha17106318</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a3923805-fda3-4223-9657-e25455076b1e.jpg?v=1775785842</image:loc>
      <image:title>EIF4ENIF1 Antibody</image:title>
      <image:caption>IHC staining of FFPE human pancreas with EIF4ENIF1 antibody with 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/elmo2-antibody-bha17107785</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_33be60ac-8e8d-4777-a1b3-a8b55007302c.jpg?v=1775786010</image:loc>
      <image:title>ELMO2 Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with ELMO2 antibody at 2ug/ml. Predicted molecular weight: ~82kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/emerin-antibody-bha17105908</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2382e4bf-1449-471e-a268-10fb96ccc4b2.jpg?v=1775785779</image:loc>
      <image:title>Emerin Antibody</image:title>
      <image:caption>Western blot testing of 1) rat skeletal muscle, 2) mouse heart and 3) human HeLa lysate with Emerin antibody at 0.5ug/ml. Predicted molecular weight 29 kDa but routinely observed at ~34 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/eif3e-antibody-eif-3-p48-bha17106044</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f66b8b93-9246-4d7e-a4c2-8d04ef0f3928.jpg?v=1775785799</image:loc>
      <image:title>EIF3e Antibody / eIF-3 p48</image:title>
      <image:caption>Western blot testing of 1) rat thymus, 2) mouse thymus, 3) mouse spleen, 4) human COLO320 and 5) human HeLa lysate with EIF3e antibody at 0.5ug/ml. Expected molecular weight: 48-52 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/elf1-antibody-bha17106323</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_25a69407-149d-4015-9a14-a876b3808a7f.jpg?v=1775785844</image:loc>
      <image:title>ELF1 Antibody</image:title>
      <image:caption>Western blot testing of human tonsil lysate with ELF1 antibody at 0.3ug/ml. Expected molecular weight: ~68 kDa (unmodified) up to ~80 kDa (phosphorylated/glycosylated cytoplasmic form) and up to ~98 kDa (phosphorylated/glycosylated nuclear form).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/elafin-antibody-pi3-bha17105698</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5767b8c0-9c65-406c-94c3-f276b090b1f7.jpg?v=1775785736</image:loc>
      <image:title>Elafin Antibody / PI3</image:title>
      <image:caption>Western blot testing of human placenta lysate with Elafin antibody. Predicted molecular weight ~12 kDa (pre-form), observed here at ~25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/elmo1-antibody-bha17107784</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d3e49fbc-c223-4192-a891-71ff64ce16ed.jpg?v=1775786010</image:loc>
      <image:title>ELMO1 Antibody</image:title>
      <image:caption>Western blot testing of human frontal cortex [A], mouse [B] and rat [C] brain lysate with ELMO1 antibody at 0.3ug/ml. Predicted molecular weight: ~84kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/eme1-antibody-bha17105630</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_66baa01f-d5a7-46d4-93dd-1612b6fb021c.jpg?v=1775785724</image:loc>
      <image:title>EME1 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) Jurkat and 3) HUT lysate with EME1 antibody. Expected molecular weight ~63 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/engrailed-2-antibody-bha17107620</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b180e3d8-4a20-4feb-8919-c5b30b349c79.jpg?v=1775785992</image:loc>
      <image:title>Engrailed-2 Antibody</image:title>
      <image:caption>Western blot testing of rat brain lysate with Engrailed-2 antibody at 0.1ug/ml. Predicted molecular weight: ~34kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/enpp1-antibody-pc-1-bha17107497</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9aa7ca97-bddd-4cde-8368-bce90758074b.jpg?v=1775785981</image:loc>
      <image:title>ENPP1 Antibody / PC-1</image:title>
      <image:caption>IHC staining of FFPE human thyroid gland tissue with ENPP1 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/epcam-antibody-bha17105845</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_30f4b0ea-a6fd-4674-a288-16e5c6a7b769.jpg?v=1775785766</image:loc>
      <image:title>EpCAM Antibody</image:title>
      <image:caption>Immunofluorescent staining of human rectal cancer tissue with EpCAM antibody (red) and DAPI (blue). HIER: steam sections in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/eph-receptor-a5-antibody-epha5-bha17105481</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_91bdb55d-5b74-41be-98ea-58168ca72144.jpg?v=1775785694</image:loc>
      <image:title>Eph Receptor A5 Antibody / EphA5</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse brain with Eph Receptor A5 antibody. Expected/observed molecular weight ~114 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/epcr-antibody-cd201-bha17105678</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ca4ebad9-4bc2-428a-b49b-a648d5888e7f.jpg?v=1775785734</image:loc>
      <image:title>EPCR Antibody / CD201</image:title>
      <image:caption>Western blot testing of human A549 cell lysate with EPCR antibody. Expected molecular weight ~24/36-46 kDa (unmodified/glycosylated). The ~52 kDa band may represent a further modification of the protein.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/epb41l3-antibody-bha17107145</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5aa4c763-df91-4b0a-b72c-50c8d5a00b67.jpg?v=1775785941</image:loc>
      <image:title>EPB41L3 Antibody</image:title>
      <image:caption>Western blot testing of human brain (cerebellum) lysate with EPB41L3 antibody at 0.3ug/ml. Predicted molecular weight: ~121 kDa, observed here at ~150 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/epb41l5-antibody-bha17106891</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7820906c-ea4e-4613-9dd3-f2bd66419af8.jpg?v=1775785913</image:loc>
      <image:title>EPB41L5 Antibody</image:title>
      <image:caption>Western blot testing of human hippocampus lysate with EPB41L5 antibody at 1ug/ml. The expected ~80 kDa band and the additional ~140 kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/endoglin-antibody-cd105-bha17106001</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ca1084dd-8e63-4fe5-8214-4523c8245603.jpg?v=1775785791</image:loc>
      <image:title>Endoglin Antibody / CD105</image:title>
      <image:caption>Flow cytometry testing of human U-87 MG cells with Endoglin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Endoglin antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/epb41l2-antibody-bha17106729</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1b9fa1e6-6343-4c47-b600-15d0d31a2f96.jpg?v=1775785895</image:loc>
      <image:title>EPB41L2 Antibody</image:title>
      <image:caption>IHC testing of FFPE human uterus with EPB41L2 at 2ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ephx2-antibody-bha17105927</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2047465c-9073-48bf-856e-aecb0f8b0b02.jpg?v=1775785779</image:loc>
      <image:title>EPHX2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat lung, 2) mouse lung and 3) HepG2 lysate with EPHX2 antibody at 0.5ug/ml. Predicted molecular weight: ~63/57 kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/epigen-antibody-epgn-bha17106273</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6de86256-fef6-4b81-b308-8d27328fd1ac.jpg?v=1775785834</image:loc>
      <image:title>Epigen Antibody / EPGN</image:title>
      <image:caption>Western blot testing of 1) human A431 and 2) rat PC-12 cell lysate with Epigen antibody at 0.5ug/ml. Predicted molecular weight ~17 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ephrin-a1-antibody-bha17107520</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a85ee337-6fb2-40b3-969a-2a22adf9e3fe.jpg?v=1775785982</image:loc>
      <image:title>Ephrin A1 Antibody</image:title>
      <image:caption>Western blot testing of mouse thymus lysate with Ephrin A1 antibody at 0.01ug/ml. Predicted molecular weight: ~24kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ephrin-b2-antibody-bha17106440</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c821d776-9ebf-40ed-a147-ff6e858768d5.jpg?v=1775785861</image:loc>
      <image:title>Ephrin B2 Antibody</image:title>
      <image:caption>Western blot testing of rat lung lysate with Ephrin B2 antibody at 0.1ug/ml. Predicted molecular weight ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ep4-antibody-prostaglandin-e-receptor-4-ptger4-bha17107540</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3227ecb8-f3a9-4361-adbb-b34c11bfe86b.jpg?v=1775785983</image:loc>
      <image:title>EP4 Antibody / Prostaglandin E Receptor 4 / PTGER4</image:title>
      <image:caption>Western blot testing of human testis lysate with EP4 antibody at 0.1ug/ml. Predicted molecular weight: ~53kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/epigen-antibody-epgn-bha17106274</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_35dd7abb-e8a1-4314-99a1-532f5199e3a6.jpg?v=1775785839</image:loc>
      <image:title>Epigen Antibody / Epgn</image:title>
      <image:caption>IHC staining of FFPE rat testis tissue with Epigen antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/erab-antibody-hsd17b10-bha17106405</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_15a7f35d-df15-4f5f-8c5b-04d9a674dac5.jpg?v=1775785855</image:loc>
      <image:title>ERAB Antibody / HSD17B10</image:title>
      <image:caption>Western blot testing of human brain lysate with ERAB antibody at 0.3ug/ml. Predicted molecular weight: ~27kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ephb1-antibody-eph-receptor-b1-bha17105482</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_30978b64-dc03-4013-9ef2-25533d942ee6.jpg?v=1775785696</image:loc>
      <image:title>EPHB1 Antibody / Eph Receptor B1</image:title>
      <image:caption>IHC testing of FFPE human glioma tissue with EPHB1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/erlin2-antibody-bha17106767</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f08d0bee-74f4-495e-b0a2-8eebc4db834b.jpg?v=1775785898</image:loc>
      <image:title>ERLIN2 Antibody</image:title>
      <image:caption>Western blot testing of human breast lysate with ERLIN2 antibody at 1ug/ml. Predicted molecular weight: ~38 kDa, routinely observed at ~43 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/erlin1-antibody-bha17106749</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2d1f6df9-f30b-4f3c-a4f0-c78a7b6448fb.jpg?v=1775785897</image:loc>
      <image:title>ERLIN1 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with ERLIN1 antibody at 0.5ug/ml. Predicted molecular weight: ~39kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/erk2-antibody-mapk1-bha17106370</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_94377671-4e20-4965-9d30-db903fed04e3.jpg?v=1775785853</image:loc>
      <image:title>ERK2 Antibody / MAPK1</image:title>
      <image:caption>Western blot testing of HepG2 lysate with ERK2 antibody at 0.5ug/ml. Predicted molecular weight ~41kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ercc1-antibody-bha17106641</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cc657a86-513d-4fe5-9e2d-95efc28e7e01.jpg?v=1775785886</image:loc>
      <image:title>ERCC1 Antibody</image:title>
      <image:caption>Western blot testing of A431 lysate with ERCC1 antibody at 0.3ug/ml. Predicted molecular weight ~36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/erv3-antibody-erv3-1-bha17105561</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4a55283b-a580-44d6-a2dd-74926782e77a.jpg?v=1775785711</image:loc>
      <image:title>ERV3 Antibody / ERV3-1</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) 22RV1, 3) HepG2, 4) SKOV, 5) A431 and 6) HT1080 cell lysate with ERV3 antibody. Predicted molecular weight ~68 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/erp29-antibody-bha17106846</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8938f827-02b7-4d5e-84da-5d07f8bed5d1.jpg?v=1775785909</image:loc>
      <image:title>ERP29 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with ERP29 antibody at 0.1ug/ml. Predicted molecular weight: ~29kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/esr2-antibody-estrogen-receptor-beta-bha17106157</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_84824c43-36a8-4b76-be38-511f23b172f2.jpg?v=1775785817</image:loc>
      <image:title>ESR2 Antibody / Estrogen Receptor beta</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) rat ovary, 3) mouse testis, 4) rat ovary, 5) human HeLa, 6) human MCF7, 7) human MDA-MB-231, 8) human MDA-MB-453 and 9) human SK-OV-3 lysate with ESR2 antibody at 0.5ug/ml. Predicted molecular weight: 53~59 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/erp57-antibody-pdia3-protein-disulfide-isomerase-a3-bha17106780</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f4bffc9e-726b-4246-9a7f-6450562b6b22.jpg?v=1775785902</image:loc>
      <image:title>ERp57 Antibody / PDIA3 / Protein disulfide-isomerase A3</image:title>
      <image:caption>Western blot testing of HepG2 lysate with ERp57 antibody at 1ug/ml. Predicted molecular weight: ~57-60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/esrrg-antibody-bha17106462</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9d7297d1-1c70-4a3e-b6e1-bb54355b0950.jpg?v=1775785864</image:loc>
      <image:title>ESRRG Antibody</image:title>
      <image:caption>Western blot testing of human breast lysate with ESRRG antibody at 0.2ug/ml. Predicted molecular weight: ~51 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/erk1-antibody-mapk3-bha17107046</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3b83d4e9-f7da-4a63-9545-768ce1d83c30.jpg?v=1775785929</image:loc>
      <image:title>ERK1 Antibody [MAPK3]</image:title>
      <image:caption>Western blot testing of 293 lysate with ERK1 antibody at 0.3ug/ml. Predicted molecular weight ~43kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ets1-antibody-bha17105996</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fe696594-a4db-4b89-831a-ec6a641bb7d8.jpg?v=1775785790</image:loc>
      <image:title>ETS1 Antibody</image:title>
      <image:caption>Western blot testing of 1) mouse NIH3T3 and 2) human A375 lysate with ETS1 antibody at 0.5ug/ml. Predicted molecular weight ~51 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/exoc7-antibody-bha17106632</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_71eb0202-fb51-43e3-bb06-74c04c889619.jpg?v=1775785884</image:loc>
      <image:title>EXOC7 Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with EXOC7 antibody at 0.5ug/ml. Predicted molecular weight: ~75kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/exportin-5-antibody-n-terminal-region-bha17106223</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_dd91011d-dbe3-4f48-b95e-93da64705d35.jpg?v=1775785827</image:loc>
      <image:title>Exportin-5 Antibody (N-Terminal Region)</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) mouse testis and 3) human HeLa lysate with Exportin-5 antibody at 0.5ug/ml. Predicted molecular weight ~136 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/etfdh-antibody-bha17106811</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_da255cbe-d829-4107-b2ac-ce19bc993407.jpg?v=1775785904</image:loc>
      <image:title>ETFDH Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with ETFDH antibody at 1ug/ml. Predicted molecular weight: ~69kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/etea-antibody-bha17107212</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e909bb86-ac2a-4ad8-96e7-0957fb00c778.jpg?v=1775785949</image:loc>
      <image:title>ETEA Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with ETEA antibody at 0.3ug/ml. Predicted molecular weight: ~53kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/eukaryotic-translation-initiation-factor-6-eif6-bha17105489</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_07e74955-4496-478c-bf17-6d6bd301a3fa.jpg?v=1775785697</image:loc>
      <image:title>Eukaryotic Translation Initiation Factor 6 / EIF6</image:title>
      <image:caption>Western blot testing of 1) rat heart, 2) rat liver, 3) mouse liver, 4) human placenta, 5) COLO320 and 6) HeLa lysate with Eukaryotic Translation Initiation Factor 6 antibody. Expected molecular weight ~27 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/etfa-antibody-bha17107484</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_326eea49-dbcd-4a54-bdd3-cef7706b0dc6.jpg?v=1775785979</image:loc>
      <image:title>ETFA Antibody</image:title>
      <image:caption>Western blot testing of human colon lysate with ETFA antibody at 0.1ug/ml. Predicted molecular weight: ~35/30kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/exo1-antibody-bha17107188</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a796a18c-bb0f-4bb3-9a1c-2830a740ad5c.jpg?v=1775785945</image:loc>
      <image:title>EXO1 Antibody</image:title>
      <image:caption>Western blot testing of A549 cell lysate with EXO1 antibody at 0.2ug/ml. The expected 94-115 kDa band and the additional ~38 kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/evc2-antibody-bha17107554</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bcf16471-e21e-4f18-ba74-6cd76929357f.jpg?v=1775785987</image:loc>
      <image:title>EVC2 Antibody</image:title>
      <image:caption>IHC testing of FFPE human placenta with EVC2 antibody at 2 ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/exog-antibody-endogl1-endonuclease-g-like-1-bha17107253</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1778881b-f488-4d31-9342-374522ac86bc.jpg?v=1775785953</image:loc>
      <image:title>EXOG Antibody / ENDOGL1 / Endonuclease G-like 1</image:title>
      <image:caption>Western blot testing of HepG2 [A] and Jurkat [B] lysates with EXOG antibody at 0.2ug/ml. Predicted molecular weight: ~41kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fabp2-antibody-intestinal-bha17106041</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9af1372e-4048-415f-82df-ba25799481b7.jpg?v=1775785800</image:loc>
      <image:title>FABP2 Antibody (intestinal)</image:title>
      <image:caption>IHC testing of FFPE human intestinal cancer tissue with FABP2 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/etv4-antibody-pea3-bha17105445</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1b30a89f-5f2f-48e8-b6d5-2f042c3f25c9.jpg?v=1775785690</image:loc>
      <image:title>ETV4 Antibody / PEA3</image:title>
      <image:caption>Western blot testing of 1) rat lung, human 2) HeLa, 3) A549 and 4) SW620 lysate with ETV4 antibody. Expected molecular weight: 54-61 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ewsr1-antibody-ews-bha17105518</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_40145587-d191-42e9-98d7-219a8810ba42.jpg?v=1775785704</image:loc>
      <image:title>EWSR1 Antibody / EWS</image:title>
      <image:caption>ICC staining of FFPE human SMMC-7721 cells with EWSR1 antibody at 1ug/ml. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fabp3-antibody-hfabp-bha17106197</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_008cad9d-2d8b-4d53-bc16-e67d3165e0ea.jpg?v=1775785822</image:loc>
      <image:title>Fabp3 Antibody / hFabp</image:title>
      <image:caption>Western blot testing of 1) rat heart and 2) mouse heart lysate with Fabp3 antibody at 0.5ug/ml. Predicted molecular weight ~15 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fabp2-antibody-bha17106808</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e94c1229-d3cd-4331-9bc0-2f7c8d55f627.jpg?v=1775785904</image:loc>
      <image:title>FABP2 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing FABP2 with FABP2 antibody [mock transfection in lane 1]. Predicted molecular weight: ~15 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ezh1-antibody-bha17106821</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f578b5a5-6cbc-4d2d-8571-5abf8067310b.jpg?v=1775785905</image:loc>
      <image:title>EZH1 Antibody</image:title>
      <image:caption>Western blot testing of MOLT4 lysate with EZH1 antibody at 2ug/ml. Predicted molecular weight ~85kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fabp2-antibody-bha17105700</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4622ad1d-2e90-4194-840d-bd4baea5b357.jpg?v=1775785740</image:loc>
      <image:title>FABP2 Antibody</image:title>
      <image:caption>Western blot testing of human SW620 cell lysate with FABP2 antibody. Expected/observed molecular weight ~15 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/factor-xiiia-antibody-bha17107187</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_44de4135-25c2-47d5-ba73-f92b7918d3b3.jpg?v=1775785944</image:loc>
      <image:title>Factor XIIIa Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with Factor XIIIa antibody at 0.1ug/ml. Predicted molecular weight: ~83 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/factor-i-antibody-cfi-bha17105721</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_69044a82-f1ba-4a48-8465-939edeafec39.jpg?v=1775785739</image:loc>
      <image:title>Factor I Antibody / CFI</image:title>
      <image:caption>Western blot testing of 1) rat liver and 2) human HeLa lysate with Factor I antibody. Expected molecular weight: 66 kDa (unmodified), 88 kDa (fully glycosylated), 50/38 kDa (fully glycosylated heavy/light chain).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fabp4-antibody-bha17105319</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_34e116e0-9d7d-4b03-a5b4-9d44a24e7dde.jpg?v=1775785678</image:loc>
      <image:title>FABP4 Antibody</image:title>
      <image:caption>IHC testing of FFPE mouse intestine with FABP4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fabp4-antibody-bha17106194</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6675efa1-06f5-449c-a3e0-62dbdd760253.jpg?v=1775785821</image:loc>
      <image:title>Fabp4 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat heart and 2) mouse heart lysate with Fabp4 antibody at 0.5ug/ml. Predicted molecular weight ~15 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/evi1-antibody-prdm3-bha17106587</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2d889589-9494-411c-983d-fb75beca05c5.jpg?v=1775785880</image:loc>
      <image:title>EVI1 Antibody / PRDM3</image:title>
      <image:caption>Western blot testing of A549 lysate with EVI1 antibody at 2ug/ml. Expected molecular weight: ~145/170-200kDa (EVI1/EVI1-MDS1 fusion protein).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/faim1-antibody-bha17107371</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_78ccc0b2-ba4f-4c63-b44a-363d7e65fee8.jpg?v=1775785965</image:loc>
      <image:title>FAIM1 Antibody</image:title>
      <image:caption>Western blot testing of human lymph node lysate with FAIM1 antibody at 0.5ug/ml. Predicted/observed molecular weight: ~25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fance-antibody-bha17106814</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_26f900fd-7732-4b03-9528-18f857349afc.jpg?v=1775785903</image:loc>
      <image:title>FANCE Antibody</image:title>
      <image:caption>IHC testing of FFPE human placenta with FANCE antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fak-antibody-focal-adhesion-kinase-ptk2-bha17105527</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2fc2d1db-4dbc-41f1-bc24-df94ad53bf9e.jpg?v=1775785706</image:loc>
      <image:title>FAK Antibody / Focal Adhesion Kinase / PTK2</image:title>
      <image:caption>IHC staining of FFPE human breast cancer tissue with FAK antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fancg-antibody-bha17107539</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_407bd318-96f1-4d94-b61a-8278408d032c.jpg?v=1775785986</image:loc>
      <image:title>FANCG Antibody</image:title>
      <image:caption>Western blot testing of HeLa cell lysate with FANCG antibody at 0.5ug/ml. Predicted molecular weight: ~69 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fasn-antibody-fatty-acid-synthase-bha17105456</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_33f16414-b185-4a4c-8f04-ae3d2d169bcc.jpg?v=1775785691</image:loc>
      <image:title>FASN Antibody / Fatty acid synthase</image:title>
      <image:caption>Immunofluorescent staining of FFPE human ovarian cancer tissue with FASN antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fapp2-antibody-bha17106577</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8d6ea6fc-942d-4b10-a24c-f5fe1a74a6d7.jpg?v=1775785878</image:loc>
      <image:title>FAPP2 Antibody</image:title>
      <image:caption>IHC testing of FFPE human placenta with FAPP2 antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fascin-antibody-bha17105582</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d9890747-9108-4182-95ec-f53d29da226c.jpg?v=1775785715</image:loc>
      <image:title>Fascin Antibody</image:title>
      <image:caption>Western blot testing of 1) human SH-SY5Y, 2) human HeLa, 3) human K562, 4) human A549, 5) human HepG2, 6) human PC-3, 7) rat brain, 8) mouse brain and 9) mouse NIH 3T3 cell lysate with Fascin antibody. Predicted molecular weight ~55 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fas-antibody-cd95-bha17107492</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4cb4724b-6039-4782-bf1a-04ad61699a58.jpg?v=1775785977</image:loc>
      <image:title>Fas Antibody / CD95</image:title>
      <image:caption>Western blot testing of MOLT4 lysate with Fas antibody at 0.1ug/ml. Predicted molecular weight: ~38 kDa (unmodified), 40-55 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fbxl3-antibody-bha17107458</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9f8c1346-2775-43fa-839d-0be3289c7cd8.jpg?v=1775785975</image:loc>
      <image:title>FBXL3 Antibody</image:title>
      <image:caption>Western blot testing of human adipose lysate with FBXL3 antibody at 1ug/ml. Predicted molecular weight: ~49 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fbxo44-antibody-bha17106290</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_78bcf24d-f4e2-4c36-a962-61cf8cfd069d.jpg?v=1775785841</image:loc>
      <image:title>FBXO44 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with FBXO44 antibody at 1.5ug/ml. Predicted molecular weight: ~26kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fbxw2-antibody-bha17107460</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4eab386b-e449-4623-8a0f-b11330bebf3c.jpg?v=1775785975</image:loc>
      <image:title>FBXW2 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with FBXW2 antibody at 0.3ug/ml. Predicted molecular weight: ~51kDa. Both observed bands were blocked by addition of the immunzing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fe65-antibody-bha17107080</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8c1ca89f-57cd-492a-8038-0a1ea6e27eb6.jpg?v=1775785936</image:loc>
      <image:title>FE65 Antibody</image:title>
      <image:caption>Western blot testing of NIH3T3 lysate with FE65 antibody at 0.1ug/ml. Predicted molecular weight: ~77kDa; the 97kDa isoform can be cleaved to yield a 65kDa C-terminal form.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fcrl2-antibody-bha17106599</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5b81a8ad-49bb-48d5-96e9-4ef09a3f065a.jpg?v=1775785882</image:loc>
      <image:title>FCRL2 Antibody</image:title>
      <image:caption>Western blot testing of human tonsil [A] and Daudi [B] lysates with FCRL2 antibody at 1ug/ml. Predicted molecular weight: ~56kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fbxo43-antibody-bha17107768</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ff8d2533-3614-41b1-802c-53570b9bd2ed.jpg?v=1775786009</image:loc>
      <image:title>FBXO43 Antibody</image:title>
      <image:caption>FBXO43 Antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fbxo32-antibody-bha17107692</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a2a30521-29c4-4fda-bc49-882ad19cf023.jpg?v=1775785999</image:loc>
      <image:title>FBXO32 Antibody</image:title>
      <image:caption>Western blot testing of human skeletal muscle lysate with FBXO32 antibody at 1ug/ml. Predicted molecular weight: ~42kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fcgrt-antibody-fcrn-bha17105594</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_87eebe07-82c0-43fd-a48a-6ce70726da36.jpg?v=1775785717</image:loc>
      <image:title>FCGRT Antibody / FcRn</image:title>
      <image:caption>Western blot testing of mouse liver lysate with FCGRT antibody. Expected molecular weight ~51 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fcgrt-antibody-fcrn-bha17105488</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cfb0b3a7-1299-4bd7-984e-e839c183b1fa.jpg?v=1775785697</image:loc>
      <image:title>FCGRT Antibody / FcRn</image:title>
      <image:caption>Western blot testing of human A549 cell lysate with FCGRT antibody. Expected/observed molecular weight ~51 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fem1c-antibody-bha17107137</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e15e256a-6c0e-4f67-a216-eb62b8c8d8f3.jpg?v=1775785942</image:loc>
      <image:title>FEM1C Antibody</image:title>
      <image:caption>Western blot testing of rat kidney lysate with FEM1C antibody at 0.5ug/ml. Predicted molecular weight: ~69kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fbp17-antibody-bha17107441</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c917afa3-4173-4c5f-b515-7db8bf81977d.jpg?v=1775785972</image:loc>
      <image:title>FBP17 Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with FBP17 antibody at 0.25ug/ml. Predicted molecular weight: ~71 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgf19-antibody-bha17105847</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c363d8c0-ce33-430b-a464-a88ba71cd315.jpg?v=1775785766</image:loc>
      <image:title>FGF19 Antibody</image:title>
      <image:caption>Western blot testing of human HeLa lysate with FGF19 antibody at 0.5ug/ml. Predicted/observed molecular weight: ~24 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fem1a-antibody-bha17107043</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fd1bd260-d132-4555-b01a-3876023bf8cc.jpg?v=1775785931</image:loc>
      <image:title>FEM1A Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with FEM1A antibody at 1ug/ml. Predicted molecular weight: ~74kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgf23-antibody-bha17105648</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3b8844c8-b6a0-40c4-a2f1-d27405a79944.jpg?v=1775785727</image:loc>
      <image:title>FGF23 Antibody</image:title>
      <image:caption>Western blot testing of mouse testis lysate with FGF23 antibody. Predicted molecular weight 28~32 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgf-1-antibody-bha17105716</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_006c9e08-c7eb-4d02-9781-77a031382ef2.jpg?v=1775785741</image:loc>
      <image:title>FGF-1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human placenta with FGF-1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgf19-antibody-bha17105848</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_af22034d-43f2-4593-bed2-b9e836275ab3.jpg?v=1775785764</image:loc>
      <image:title>Fgf19 Antibody</image:title>
      <image:caption>IHC staining of FFPE rat colon tissue with Fgf19 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgfr1-antibody-bha17106422</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_861dc2a3-0101-4129-9a09-349c63bab3c2.jpg?v=1775785860</image:loc>
      <image:title>FGFR1 Antibody</image:title>
      <image:caption>Western blot testing of human breast lysate with FGFR1 antibody at 0.3ug/ml. Predicted molecular weight of isoforms 1-4: 80~90 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgf13-antibody-bha17107325</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0c5c119d-8c23-4dc6-b1c6-836ad41fa938.jpg?v=1775785960</image:loc>
      <image:title>FGF13 Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with FGF13 antibody at 0.5ug/ml. Predicted molecular weight: ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgf5-antibody-bha17107805</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c8c8d75c-722c-40f5-81a7-4f7337340ca9.jpg?v=1775786012</image:loc>
      <image:title>FGF5 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with FGF5 antibody at 0.1ug/ml. Predicted molecular weight: ~30kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgf8-antibody-bha17106162</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d7d24824-25ca-4b5b-bc25-c7e140a11efd.jpg?v=1775785817</image:loc>
      <image:title>FGF8 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat ovary, 2) human HeLa and 3) human placenta lysate with FGF8 antibody at 0.5ug/ml. Predicted molecular weight ~25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgf2-antibody-bha17105270</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ec9c30a8-7d2a-4171-be24-a5ae2e62e022.jpg?v=1775785679</image:loc>
      <image:title>FGF2 Antibody</image:title>
      <image:caption>Western blot testing of 1) human HeLa, 2) human SK-O-V3 and 3) rat lung tissue lysate with FGF2 antibody. Predicted molecular weight ~31/23/17/21 kDa (isoforms 1/2/3/4).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgf23-antibody-bha17106887</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9d9e2991-cef0-4151-af85-50d4bd6715e4.jpg?v=1775785911</image:loc>
      <image:title>Fgf23 Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with Fgf23 antibody at 0.5ug/ml. Predicted molecular weight 28~32kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fdcsp-antibody-bha17106074</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ecd9ce53-f0a9-4833-bdf8-a978e68595c6.jpg?v=1775785803</image:loc>
      <image:title>FDCSP Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human tonsil tissue with FDCSP antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgf21-antibody-bha17105849</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6bf3d8e6-bde3-462c-8123-12c43dbf75d0.jpg?v=1775785765</image:loc>
      <image:title>FGF21 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with CSB antibody at 0.5ug/ml. Predicted molecular weight: ~21 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgf8-antibody-bha17107220</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4acc0d66-8872-4870-800c-9bdbad39eeeb.jpg?v=1775785949</image:loc>
      <image:title>FGF8 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with FGF8 antibody at 2ug/ml. Predicted molecular weight: ~25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fhl3-antibody-slim2-bha17105850</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8f5b3cf7-9bb6-4cda-9e1d-724a382c2d9f.jpg?v=1775785764</image:loc>
      <image:title>FHL3 Antibody / SLIM2</image:title>
      <image:caption>Western blot testing of 1) human K562 and 2) rat heart lysate with FHL3 antibody at 0.5ug/ml. Predicted molecular weight: ~31 kDa, can also be observed at 33-34 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgf21-antibody-bha17106451</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e41e9ee7-268f-4d6e-9a95-6a830e7d27e1.jpg?v=1775785861</image:loc>
      <image:title>FGF21 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with FGF21 antibody at 1ug/ml. Predicted molecular weight ~21kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fh-antibody-fumarate-hydratase-bha17107171</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_58de3ea0-af89-4b3f-acc9-fe00317c7706.jpg?v=1775785946</image:loc>
      <image:title>FH Antibody / Fumarate hydratase</image:title>
      <image:caption>Western blot testing of human kidney lysate with FH antibody at 0.01ug/ml. Predicted molecular weight: ~55/50 kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgf7-antibody-kgf-bha17106205</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_888a9dad-b11f-44b2-abae-25281fc40da4.jpg?v=1775785824</image:loc>
      <image:title>FGF7 Antibody / KGF</image:title>
      <image:caption>Western blot testing of 1) mouse brain and 2) rat RH35 lysate with FGF7 antibody at 0.5ug/ml. Predicted molecular weight ~22 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgl1-antibody-bha17106992</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_438badcb-9cf0-4de6-8774-b27fb3c5c4bb.jpg?v=1775785923</image:loc>
      <image:title>FGL1 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with FGL1 antibody at 0.1ug/ml. Predicted molecular weight: ~36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fibrinogen-beta-chain-antibody-bha17105917</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1b0b4703-f0b6-458a-a049-77cff0bf5fc8.jpg?v=1775785778</image:loc>
      <image:title>Fibrinogen beta chain Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A549 cells with Fibrinogen beta chain antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fhl3-antibody-bha17106672</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_24c9c425-84ec-49da-8b36-f46bbf1eb5ac.jpg?v=1775785889</image:loc>
      <image:title>FHL3 Antibody</image:title>
      <image:caption>Western blot testing of human skeletal muscle lysate with FHL3 antibody at 1ug/ml. Predicted molecular weight: ~31 kDa, can also be observed at 33-34 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgfr2-antibody-bha17107073</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b2dc007a-8859-45be-8afe-b92958d4ef0f.jpg?v=1775785933</image:loc>
      <image:title>FGFR2 Antibody</image:title>
      <image:caption>Western blot testing of A549 lysate with FGFR2 antibody at 0.3ug/ml. Predicted molecular weight of multiple isoforms: 80-120 kDa. The observed size may be larger due to glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fibrillarin-antibody-bha17107477</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2ea3ed58-44dc-4f68-82f3-d63acc6599f7.jpg?v=1775785976</image:loc>
      <image:title>Fibrillarin Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate with Fibrillarin antibody at 1ug/ml. Predicted molecular weight ~34kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fibrinogen-beta-chain-antibody-bha17106839</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_af0c0cce-b833-4310-b83a-4f43e1592644.jpg?v=1775785907</image:loc>
      <image:title>Fibrinogen beta chain Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with Fibrinogen beta chain antibody at 0.01ug/ml. Predicted molecular weight ~56kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fibrinogen-gamma-chain-antibody-fgg-bha17105909</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cb9d0020-8322-4b95-be01-7134e6be99e0.jpg?v=1775785777</image:loc>
      <image:title>Fibrinogen gamma chain Antibody / FGG</image:title>
      <image:caption>IHC testing of FFPE human liver cancer tissue with Fibrinogen gamma chain antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fibrinogen-alpha-chain-antibody-fga-bha17105910</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2591caf7-a1c5-4adb-8bde-41414fab3a02.jpg?v=1775785775</image:loc>
      <image:title>Fibrinogen alpha chain Antibody / FGA</image:title>
      <image:caption>Western blot testing of 1) rat skeletal muscle and 2) human HepG2 cell lysate with Fibrinogen alpha chain antibody at 0.5ug/ml. Predicted molecular weight ~95 kDa (alpha-E isoform).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fibrinogen-gamma-chain-antibody-bha17107283</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2a2885be-435f-4634-98c5-a6cb822b6d46.jpg?v=1775785957</image:loc>
      <image:title>Fibrinogen gamma chain Antibody</image:title>
      <image:caption>Western blot testing of human platelet lysate with Fibrinogen gamma chain antibody at 0.01ug/ml. Predicted molecular weight ~50kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fhl1-antibody-fhl1b-slimmer-bha17106485</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_98ea4434-1c43-40cd-80c9-acde7ae40fdc.jpg?v=1775785866</image:loc>
      <image:title>FHL1 Antibody [FHL1B/SLIMMER]</image:title>
      <image:caption>Western blot testing of human heart lysate with FHL1 antibody at 0.01ug/ml. Predicted/observed molecular weight: ~36/30-36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fibrillarin-antibody-bha17106456</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_19e6a648-b0d5-4e2f-8eab-cb140a3d447f.jpg?v=1775785864</image:loc>
      <image:title>Fibrillarin Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate with Fibrillarin antibody at 0.1ug/ml. Predicted molecular weight ~34kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/filamin-a-antibody-bha17106578</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1f39972e-a4fd-4d37-b652-56c5bcc8cdd6.jpg?v=1775785879</image:loc>
      <image:title>Filamin A Antibody</image:title>
      <image:caption>Western blot testing of human uterus lysate with Filamin A antibody at 0.1ug/ml. Predicted molecular weight ~281kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fgfr1-antibody-fibroblast-growth-factor-receptor-1-bha17105894</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2be70d3a-2051-44f3-af13-2c0b15adc1f5.jpg?v=1775785776</image:loc>
      <image:title>FGFR1 Antibody / Fibroblast growth factor receptor 1</image:title>
      <image:caption>Western blot testing of human HepG2 cell lysate with FGFR1 antibody at 0.5ug/ml. Predicted molecular weight: 75-160 kDa depending on glycosylation level</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fh-antibody-fumarate-hydratase-bha17106211</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b57e7203-688f-4f44-9c30-57041854e400.jpg?v=1775785827</image:loc>
      <image:title>FH Antibody / Fumarate Hydratase</image:title>
      <image:caption>Western blot testing of 1) rat lymph, 2) rat small intestine, 3) rat stomach, 4) mouse kidney, 5) mouse testis, 6) mouse stomach, 7) human K562, 8) human U937 and 9) human HL60 lysate with FH antibody at 0.5ug/ml. Predicted molecular weight: ~55/50kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fkbp52-antibody-bha17106568</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cf4d504b-8651-4af5-9837-4f5ffd5af756.jpg?v=1775785879</image:loc>
      <image:title>FKBP52 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with FKBP52 antibody at 0.01ug/ml. Predicted/observed molecular weight: ~52/52-59 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/flap-antibody-bha17107149</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b3f94748-479a-4177-8bbc-862cf57a15a0.jpg?v=1775785942</image:loc>
      <image:title>FLAP Antibody</image:title>
      <image:caption>Western blot testing of human U937 cell lysate with FLAP antibody at 0.1ug/ml. Predicted molecular weight: ~18kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fizz1-antibody-bha17106706</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_da919c19-5a7e-4b67-bce5-22d1ee538e8e.jpg?v=1775785893</image:loc>
      <image:title>FIZZ1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human colon with FIZZ1 antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/flvcr-antibody-bha17107509</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e7d9b6fc-662b-4017-9eb1-440b4e65fd0a.jpg?v=1775785979</image:loc>
      <image:title>FLVCR Antibody</image:title>
      <image:caption>Western blot testing of human bone marrow lysate with FLVCR antibody at 0.1ug/ml. The expected ~55kDa band and the additional ~26kDa band are blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/filaggrin-antibody-bha17105354</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_17714f58-f04d-4031-8d9d-0ce187d1c64e.jpg?v=1775785675</image:loc>
      <image:title>Filaggrin Antibody</image:title>
      <image:caption>Western blot testing of human 22RV1 cell lysate with Filaggrin antibody. Predicted molecular weight ~434 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fmo1-antibody-flavin-containing-monooxygenase-1-bha17105517</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4369e906-200b-4697-9b33-c4a70322fab4.jpg?v=1775785701</image:loc>
      <image:title>FMO1 Antibody / Flavin-containing monooxygenase 1</image:title>
      <image:caption>Western blot testing of 1) human HCCT, 2) human HepG2, 3) human HUH7, 4) rat liver and 5) mouse liver tissue lysate with FMO1 antibody. Predicted molecular weight ~60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/flt3-antibody-cd135-bha17106118</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_48ab955d-6fa0-4854-ba90-f091924b8416.jpg?v=1775785810</image:loc>
      <image:title>Flt3 Antibody / CD135</image:title>
      <image:caption>Western blot testing of mouse brain lysate with Flt3 antibody at 0.5ug/ml. Predicted molecular weight: ~113 kDa (unmodified), ~130/160 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/flotillin-2-antibody-bha17105560</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cf6f403a-ff5f-4044-9b7d-816fcb271fcf.jpg?v=1775785714</image:loc>
      <image:title>Flotillin 2 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with Flotillin 2 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/flt3-ligand-antibody-bha17106250</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7ac16094-d589-4a13-a976-ac0f49baf0a3.jpg?v=1775785832</image:loc>
      <image:title>Flt3 ligand Antibody</image:title>
      <image:caption>Western blot testing of mouse kidney tissue lysate with Flt3 ligand antibody at 0.5ug/ml. Predicted molecular weight ~26 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/flt3-ligand-antibody-bha17105459</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_57e3d373-6442-4f26-835e-1584800ca1b3.jpg?v=1775785689</image:loc>
      <image:title>Flt3 ligand Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat spleen, 3) rat kidney and 4) human SMMC lysate with Flt3 ligand antibody. Predicted/observed molecular weight ~26 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fmo2-antibody-flavin-containing-monooxygenase-2-bha17105640</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_31aabac7-2643-4cfc-91e6-70ad44aa8b06.jpg?v=1775785725</image:loc>
      <image:title>FMO2 Antibody / Flavin-containing monooxygenase 2</image:title>
      <image:caption>Western blot testing of 1) rat lung and 2) mouse lung tissue lysate with FMO2 antibody. Predicted molecular weight ~54 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fmo3-antibody-bha17105409</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f269b108-3c45-445f-b448-611a97ee9b80.jpg?v=1775785680</image:loc>
      <image:title>FMO3 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse liver and 3) human SMMC lysate with FMO3 antibody. Predicted/observed molecular weight ~60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fmrp-antibody-fmr1-bha17105531</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_85556ded-b608-4474-a786-36ec6fecc427.jpg?v=1775785704</image:loc>
      <image:title>FMRP Antibody / FMR1</image:title>
      <image:caption>IHC staining of FFPE human testicular seminoma tissue with FMRP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/follistatin-antibody-fst-bha17106168</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_96e2b391-4f6d-4ead-9c5d-75ad31f7e590.jpg?v=1775785816</image:loc>
      <image:title>Follistatin Antibody / FST</image:title>
      <image:caption>Western blot testing of 1) mouse kidney and 2) human MCF7 cell lysate with Follistatin antibody at 0.5ug/ml. Predicted molecular weight ~38 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fos-b-antibody-bha17105475</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ba7e5d73-48fc-4b7b-b41a-9dad1f0f9f17.jpg?v=1775785695</image:loc>
      <image:title>Fos B Antibody</image:title>
      <image:caption>IHC testing of FFPE human pancreatic cancer tissue with Fos B antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/formin-antibody-fmn1-bha17106263</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_950eb264-7566-4bbb-b77b-40406fb99a93.jpg?v=1775785835</image:loc>
      <image:title>Formin Antibody / FMN1</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse brain lysate with Formin antibody at 0.5ug/ml. Predicted molecular weight: ~158 kDa (isoform 1) and ~132 kDa (isoform 5).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/foxe1-antibody-bha17106368</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_679de096-6ab9-4a38-aaf0-ecafa892b412.jpg?v=1775785852</image:loc>
      <image:title>FOXE1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human thyroid gland with FOXE1 antibody at 2ug/ml. HIER: steamed with pH9 Tris/EDTA buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/flt3-ligand-antibody-bha17106251</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_91ec63ea-e1e0-41f6-8ba8-a9ec66de22b0.jpg?v=1775785831</image:loc>
      <image:title>Flt3 ligand Antibody</image:title>
      <image:caption>Western blot testing of 1) mouse kidney, 2) mouse spleen and 3) rat skeletal muscle tissue lysate with Flt3 ligand antibody at 0.5ug/ml. Predicted molecular weight ~26 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/foxl2-antibody-bha17106695</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e7e8e8cc-9a65-4d6a-b234-0f2cd108ebed.jpg?v=1775785892</image:loc>
      <image:title>FOXL2 Antibody</image:title>
      <image:caption>Western blot testing of human ovary lysate with FOXL2 antibody at 1ug/ml. Predicted molecular weight ~38 kDa, but can be observed at 45-50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/foxo4-antibody-bha17106740</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_be829edd-fb75-482c-b694-64fcb8637f0a.jpg?v=1775785897</image:loc>
      <image:title>FOXO4 Antibody</image:title>
      <image:caption>Western blot testing of K562 cell lysate with FOXO4 antibody at 1ug/ml. Predicted/observed molecular weight: ~54/60-65kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/foxa3-antibody-bha17105486</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_39f82363-ef14-479f-8621-ef46592d0f0c.jpg?v=1775785697</image:loc>
      <image:title>FOXA3 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with FOXA3 antibody (green) and Beta Tubulin mAb (red). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/foxa2-antibody-biotin-conjugate-bha17107095</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_20698ec7-5d26-4c46-8929-5f0e6d544fc5.jpg?v=1775785934</image:loc>
      <image:title>FOXA2 Antibody [Biotin Conjugate]</image:title>
      <image:caption>Western blot testing of rat lung lysate with biotinylated FOXA2 antibody at 1.5ug/ml. An NAP blocker was used in place of non-fat milk as blocking solution and diluent. (1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/foxp2-antibody-bha17106187</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e344ee8a-2710-4784-b94a-e4802ce1ef2e.jpg?v=1775785822</image:loc>
      <image:title>FOXP2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain and 3) human SK-OV-3 lysate with FOXP2 antibody at 0.5ug/ml. Predicted molecular weight ~80 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/foxa2-antibody-bha17107094</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c59564ca-6ab0-494a-9f65-ab7770583aae.jpg?v=1775785938</image:loc>
      <image:title>FOXA2 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with FOXA2 antibody at 1ug/ml</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/foxo3a-antibody-bha17107026</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_26b2d75f-6cbb-4529-9375-c02a059081e7.jpg?v=1775785927</image:loc>
      <image:title>FOXO3A Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with FOXO3A antibody at 0.1ug/ml. Expected molecular weight: 71-90 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fmrp-antibody-fmr1-bha17107664</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_27a926cd-9919-4e93-b409-95743fae70fa.jpg?v=1775785999</image:loc>
      <image:title>FMRP Antibody / FMR1</image:title>
      <image:caption>Western blot testing of KELLY lysate with FMR1 antibody at 0.3ug/ml. Predicted/observed molecular weight: ~71/67-90 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/foxq1-antibody-bha17107379</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_08316acf-48b5-4033-9101-5a33af83f9fc.jpg?v=1775785966</image:loc>
      <image:title>FOXQ1 Antibody</image:title>
      <image:caption>Western blot testing of H460 lysate with FOXQ1 antibody at 1ug/ml. Predicted molecular weight: ~46kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/foxp2-antibody-bha17106541</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8aab8ea3-0b34-4c8b-8a3c-28722d138f2b.jpg?v=1775785874</image:loc>
      <image:title>FOXP2 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with FOXP2 antibody at 0.3ug/ml. Predicted molecular weight: 80~83 kDa. Both bands block with immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/frat2-antibody-bha17107070</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_38f12bc9-ca57-4f98-afd2-a249536c4bd4.jpg?v=1775785933</image:loc>
      <image:title>FRAT2 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with FRAT2 antibody at 2ug/ml. Predicted molecular weight ~25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fra2-antibody-bha17105323</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d87b1570-af22-4264-a21d-a4cee1d0480c.jpg?v=1775785677</image:loc>
      <image:title>FRA2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat lung, 2) human HepG2, 3) A549 and 4) SW620 lysate with FRA2 antibody. Theoretical molecular weight ~35 kDa but observed at ~46 kDa (likely a highly phosphorylated form-see Ref 1).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/foxc1-antibody-bha17106509</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4b6aff16-591a-4217-b9d6-80ca3db960a7.jpg?v=1775785869</image:loc>
      <image:title>FOXC1 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate with FOXC1 antibody at 2ug/ml. Predicted molecular weight: ~57 kDa, routinely observed at up to 75 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fsd1-antibody-bha17107513</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7ec54ea4-e7be-4c20-b56a-4b4a5ef9a71f.jpg?v=1775785979</image:loc>
      <image:title>FSD1 Antibody</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with FSD1 antibody at 2ug/ml. Predicted molecular weight: ~55kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/foxg1-antibody-bha17107177</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_31e7359c-11ea-46a2-bc8d-b6dd87aecd8d.jpg?v=1775785943</image:loc>
      <image:title>FOXG1 Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with FOXG1 antibody at 0.3ug/ml. Predicted molecular weight ~50/52 kDa (FOXG1A/FOXG1B). Both observed bands are blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/foxf1-antibody-bha17107178</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_197a788a-1865-4baa-bc59-d4f5b38155d3.jpg?v=1775785944</image:loc>
      <image:title>FOXF1 Antibody</image:title>
      <image:caption>Western blot testing of mouse lung lysate with FOXF1 antibody at 1ug/ml. Predicted molecular weight: ~40kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fsh-receptor-antibody-fshr-bha17105851</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e596cf35-e6f5-4e9a-994c-d1ae8abd48e1.jpg?v=1775785765</image:loc>
      <image:title>FSH Receptor Antibody / FSHR</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) rat ovary, 3) mouse testis, 4) mouse ovary and 5) human HeLa lysate with FSH Receptor antibody at 0.5ug/ml. Predicted/observed molecular weight: ~78 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/frizzled-4-antibody-bha17106524</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f40d08f7-0fc1-4891-8956-324d2739abe0.jpg?v=1775785871</image:loc>
      <image:title>Frizzled 4 Antibody</image:title>
      <image:caption>Western blot testing of small intestine (Ileum) cell lysate with Frizzled 4 antibody at 1ug/ml</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fut1-antibody-galactoside-2-alpha-l-fucosyltransferase-1-bha17105345</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f615eda8-9d23-4b15-baa7-d364ca156f3c.jpg?v=1775785678</image:loc>
      <image:title>FUT1 Antibody / Galactoside 2-alpha-L-fucosyltransferase 1</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) human SW620 and 3) A549 lysate with FUT1 antibody. Predicted/observed molecular weight ~50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fzd4-antibody-bha17107356</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3e9efbda-3a2e-4f80-852c-31e1c11f136c.jpg?v=1775785964</image:loc>
      <image:title>FZD4 Antibody</image:title>
      <image:caption>IHC testing of FFPE human kidney with FZD4 antibody at 2ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/g-csf-antibody-granulocyte-colony-stimulating-factor-bha17105277</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ee11132a-a8ef-4b49-9ca0-b542bad8c476.jpg?v=1775785676</image:loc>
      <image:title>G-CSF Antibody / Granulocyte-colony stimulating factor</image:title>
      <image:caption>IHC staining of FFPE human rectum adenocarcinoma tissue with G-CSF antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fut2-antibody-bha17107231</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_28f6e23f-c5c7-41d3-8bf6-2a866bcf3e44.jpg?v=1775785950</image:loc>
      <image:title>FUT2 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with FUT2 antibody at 1ug/ml. Predicted molecular weight: ~39kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fractalkine-antibody-bha17107508</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2595e68e-be9e-4ef0-a097-e8bb77cae160.jpg?v=1775785979</image:loc>
      <image:title>Fractalkine Antibody</image:title>
      <image:caption>Western blot testing of human colorectal cancer lysate with Fractalkine antibody at 0.3ug/ml. Predicted molecular weight: ~42kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ftl-antibody-ferritin-light-chain-bha17107041</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_17a427d3-9738-4fab-9a9f-1bc2493fb4a3.jpg?v=1775785929</image:loc>
      <image:title>FTL Antibody / Ferritin light chain</image:title>
      <image:caption>Western blot testing of human 1) cerebellum, 2) liver, 3) placenta, 4) mouse brain and 5) rat brain lysate with FTL antibody at 0.1ug/ml. Predicted molecular weight: ~20 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fth1-antibody-bha17106591</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a068cf2e-92d4-4fa1-934b-5d2721b158da.jpg?v=1775785881</image:loc>
      <image:title>FTH1 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with FTH1 antibody at 1ug/ml. Predicted molecular weight: ~21 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fubp1-antibody-bha17106666</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6028c65e-5fe8-4d19-9e5c-b4367fde21dc.jpg?v=1775785887</image:loc>
      <image:title>Fubp1 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with Fubp1 antibody at 0.03ug/ml. Predicted molecular weight: ~68kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/frzb-antibody-bha17105624</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_aed08c20-180e-4b92-a480-c4c154a7a20a.jpg?v=1775785722</image:loc>
      <image:title>FRZB Antibody</image:title>
      <image:caption>Western blot testing of human 1) PANC and 2) U87 cell lysate with FRZB antibody. Expected/observed molecular weight ~36 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gaa-antibody-glucosidase-alpha-acid-bha17105922</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5b10e398-68d2-43af-8626-71f601479122.jpg?v=1775785778</image:loc>
      <image:title>GAA Antibody / Glucosidase alpha acid</image:title>
      <image:caption>Western blot testing of human 1) A549, 2) HepG2, 3) HEK293 and 4) PC-3 cell lysate with GAA antibody at 0.5ug/ml. Expected molecular weight ~110 kDa (precursor), ~95 kDa (intermediate), ~76 and 70 kDa (lysosomal forms).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fzd1-antibody-frizzled-1-bha17105679</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_876ed688-7496-496d-b61b-daf1dfcf44bb.jpg?v=1775785733</image:loc>
      <image:title>FZD1 Antibody / Frizzled 1</image:title>
      <image:caption>Western blot testing of human 1) 22RV1 and 2) 293 cell lysate with FZD1 antibody. Predicted/observed molecular weight ~71 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fxr-antibody-farnesoid-x-receptor-bha17107479</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_eb55693e-d231-447e-8a0b-8b6a6abb16c8.jpg?v=1775785978</image:loc>
      <image:title>FXR Antibody [Farnesoid X Receptor]</image:title>
      <image:caption>IF/ICC staining of fixed and permeabilized human U-2 OS cells with FXR antibody (green) at 10ug/ml, phalloidin (red) and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gabrb3-antibody-bha17105390</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_342c9e3b-998a-4b7e-a93e-37d2cea868f5.jpg?v=1775785675</image:loc>
      <image:title>GABRB3 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse brain lysate with GABRB3 antibody. Predicted/observed molecular weight ~54 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gab1-antibody-bha17105926</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b475e627-a39a-4252-b273-26e63f9b91b8.jpg?v=1775785777</image:loc>
      <image:title>GAB1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat testis and 2) human K562 lysate with GAB1 antibody at 0.5ug/ml. Predicted molecular weight ~76 kDa, also observed at 100-110 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gaba-b-receptor-1-antibody-bha17106089</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_acc705c9-7a8b-4a0d-a112-f334c174de89.jpg?v=1775785805</image:loc>
      <image:title>GABA B Receptor 1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse brain lysate using GABA B Receptor 1 antibody at 0.5ug/ml. Predicted molecular weight: 108-130 kDa (multiple isoforms).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gad65-antibody-bha17106060</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bd7ce4bc-e8b6-4d6c-9414-e4e96d680dae.jpg?v=1775785805</image:loc>
      <image:title>GAD65 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse brain lysate with GAD65 antibody at 0.5ug/ml. Predicted molecular weight ~65 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gabra4-antibody-bha17106826</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5ade9b13-1b00-481b-a04c-3740b0d13d86.jpg?v=1775785906</image:loc>
      <image:title>GABRA4 Antibody</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with GABRA4 antibody at 0.1ug/ml. Predicted molecular weight: ~62kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gad67-antibody-bha17107742</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_caaf6035-b4f7-43d3-8d02-8b3f5f3a55ce.jpg?v=1775786006</image:loc>
      <image:title>GAD67 Antibody</image:title>
      <image:caption>Western blot testing of human brain (cerebral cortex) lysate with GAD67 antibody at 0.5ug/ml. Predicted molecular weight ~67 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/galanin-antibody-bha17107193</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_942ba49c-e6be-44e3-8847-d2a523546ed0.jpg?v=1775785948</image:loc>
      <image:title>Galanin Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with Galanin antibody at 1ug/ml. Predicted molecular weight ~14kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/g6pd-antibody-bha17107416</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_15c1c219-de03-45ff-9de1-67ad6057cbda.jpg?v=1775785971</image:loc>
      <image:title>G6PD Antibody</image:title>
      <image:caption>Western blot testing of peripheral blood mononucleocyte lysate with G6PD antibody at 1ug/ml. Predicted molecular weight ~59kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gabrb3-antibody-bha17106854</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_19c8fcae-0850-4268-bd60-c5efdecd0782.jpg?v=1775785909</image:loc>
      <image:title>GABRB3 Antibody</image:title>
      <image:caption>IHC testing of FFPE human cortex with GABRB3 antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gabrg2-antibody-bha17107657</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8efea67a-3bae-4e81-8afb-2971870124ea.jpg?v=1775785997</image:loc>
      <image:title>GABRG2 Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with GABRG2 antibody at 2ug/ml. Predicted molecular weight: ~55kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/galectin-1-antibody-bha17106134</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_71f18178-43c0-4e29-9c90-41b7e2318bd6.jpg?v=1775785815</image:loc>
      <image:title>Galectin 1 Antibody</image:title>
      <image:caption>Western blot testing of 1) mouse thymus, 2) mouse kidney, 3) mouse testis, 4) mouse ovary, 5) rat heart, 6) rat skeletal muscle, 7) rat stomach and 8) rat testis tissue lysate with Galectin 1 antibody at 0.5ug/ml. Predicted molecular weight: ~15 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gadd45a-antibody-bha17105748</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_65d92f2a-b235-4392-a7c7-c07407b01781.jpg?v=1775785745</image:loc>
      <image:title>GADD45A Antibody</image:title>
      <image:caption>Western blot testing of human MCF7 cell lysate with GADD45A antibody. Expected molecular weight: 14-18 kDa (monomer) and 28-36 kDa (dimer).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gamma-catenin-antibody-biotin-conjugate-bha17107060</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e756fc64-8447-4831-89c0-e963f9ec34eb.jpg?v=1775785932</image:loc>
      <image:title>Gamma Catenin Antibody [Biotin Conjugate]</image:title>
      <image:caption>Western blot testing of A431 cell lysate with Gamma Catenin antibody at 2ug/ml. Predicted molecular weight ~82kDa. An NAP blocker was used in place of non-fat milk as blocking solution and diluent. (1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/galectin-1-antibody-bha17106135</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_dd195bd9-3dc0-481c-9b58-ef4df9ecf888.jpg?v=1775785815</image:loc>
      <image:title>Galectin 1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat stomach, 2) rat ovary, 3) rat testis, 4) mouse kidney and 5) human HeLa lysate with Galectin 1 antibody at 0.5ug/ml. Predicted molecular weight ~15 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fshr-antibody-bha17106011</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fd7b0c6b-40ad-49a1-bdf6-76d17a910f65.jpg?v=1775785793</image:loc>
      <image:title>FSHR Antibody</image:title>
      <image:caption>Western blot testing of 1) mouse ovary and 2) human HeLa lysate with FSHR antibody at 0.5ug/ml. Predicted molecular weight ~78 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/galectin-1-antibody-bha17107422</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_73929a9d-668f-43c2-81d0-1a89c28ee13f.jpg?v=1775785972</image:loc>
      <image:title>Galectin 1 Antibody</image:title>
      <image:caption>Western blot testing of mouse [A] and rat [B] pancreas lysates and NIH3T3 [C] lysate with Galectin 1 antibody at 0.1ug/ml. Predicted/observed molecular weight: ~15kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/galectin-3-antibody-bha17106437</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3d6e7f6a-aaa9-4fda-a93b-daa845390053.jpg?v=1775785860</image:loc>
      <image:title>Galectin 3 Antibody</image:title>
      <image:caption>Western blot testing of human [A] and mouse [B] colon lysates with Galectin 3 antibody at 0.3ug/ml. Predicted molecular weight ~26kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gapdh-loading-control-antibody-bha17107181</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_495186a8-621f-4aac-888f-9af6e436274c.jpg?v=1775785949</image:loc>
      <image:title>GAPDH Loading Control Antibody</image:title>
      <image:caption>Western blot testing of human 1) HEK293 and 2) HeLa cell lysate with GAPDH loading control antibody at 0.1ug/ml. Predicted molecular weight ~36 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gadd34-antibody-bha17106287</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ede16204-d838-46e9-be77-4c11456738db.jpg?v=1775785841</image:loc>
      <image:title>GADD34 Antibody</image:title>
      <image:caption>Western blot testing of 1) HEPG2 cell lysate and 2) KLY negative control cell lysate with GADD34 antibody at 0.1ug/ml. Predicted molecular weight ~73 kDa, can be observed at up to ~110 kDa..</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/galectin-1-antibody-bha17105273</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e1b28226-94ab-4873-88a9-08fc6fd170a3.jpg?v=1775785679</image:loc>
      <image:title>Galectin 1 Antibody</image:title>
      <image:caption>IF/ICC staining of FFPE human U-2 OS cells with Galectin 1 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/fus-antibody-tls-bha17106156</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2f5c7ca4-b3f7-449c-b3c0-a5dfc3b2a1bc.jpg?v=1775785817</image:loc>
      <image:title>FUS Antibody / TLS</image:title>
      <image:caption>Western blot testing of 1) human HepG2, 2) human K562 and 3) mouse NIH3T3 cell lysate with FUS antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa but routinely observed at up to ~75 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gamma-catenin-antibody-plakoglobin-bha17107059</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5b742a95-c3a3-4130-819f-842034a9090a.jpg?v=1775785931</image:loc>
      <image:title>Gamma Catenin Antibody / Plakoglobin</image:title>
      <image:caption>Western blot testing of human A431 [A] and mouse NIH3T3 [B] cell lysates with Gamma Catenin antibody at 0.3ug/ml. Predicted molecular weight ~82 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/galectin-1-antibody-bha17107388</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e357fc8b-d455-4034-99f5-e59559ea4906.jpg?v=1775785967</image:loc>
      <image:title>Galectin 1 Antibody</image:title>
      <image:caption>Western blot testing of rat pancreas lysate with Galectin 1 antibody at 0.5ug/ml. Predicted/observed molecular weight: ~15kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gas6-antibody-growth-arrest-specific-6-bha17106065</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_42b52d12-79a2-400e-915a-6cfbc6160e6e.jpg?v=1775785806</image:loc>
      <image:title>GAS6 Antibody / Growth arrest-specific 6</image:title>
      <image:caption>Western blot testing of 1) mouse brain and 2) rat brain lysate with GAS6 antibody at 0.5ug/ml. Predicted molecular weight ~80 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gal4-antibody-galectin-4-bha17105709</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c6ac67c9-da2e-48fa-8665-dd42e6a6c4a4.jpg?v=1775785737</image:loc>
      <image:title>GAL4 Antibody / Galectin-4</image:title>
      <image:caption>Western blot testing of human 1) SW620 and 2) COLO320 cell lysate with GAL4 antibody. Expected molecular weight ~36 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/galectin-3-antibody-bha17107580</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_48c8c506-5fef-4c82-98f6-0abac9bc3b9c.jpg?v=1775785986</image:loc>
      <image:title>Galectin-3 Antibody</image:title>
      <image:caption>Western blot testing of mouse heart lysate with Galectin-3 antibody at 0.5ug/ml. Predicted molecular weight ~26kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gata3-antibody-bha17107004</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6a9c1a4e-8039-47d7-aef7-9f67e8acecb0.jpg?v=1775785924</image:loc>
      <image:title>GATA3 Antibody</image:title>
      <image:caption>Western blot testing of human tonsil lysate with GATA3 antibody at 0.3ug/ml. Predicted molecular weight ~50 kDa. Both bands are blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gapdh-antibody-bha17105974</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1ac207a1-39d7-4954-bb57-ed6dae955231.jpg?v=1775785788</image:loc>
      <image:title>GAPDH Antibody</image:title>
      <image:caption>IHC staining of FFPE human ovarian serous cancer tissue with GAPDH antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gapdh-antibody-bha17107092</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_000884e4-7f60-4889-9635-47302892c9f7.jpg?v=1775785935</image:loc>
      <image:title>GAPDH Antibody</image:title>
      <image:caption>Western blot testing of 1) human HeLa and 2) mouse NIH3T3 lysate with GAPDH antibody at 0.03ug/ml. Predicted molecular weight ~36 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gat-1-antibody-gaba-transporter-1-slc6a1-n-terminal-region-bha17106253</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d6419d5d-0979-4740-abb1-45d332c6c34f.jpg?v=1775785834</image:loc>
      <image:title>GAT-1 Antibody / GABA Transporter 1 / SLC6A1 (N-Terminal Region)</image:title>
      <image:caption>IHC staining of mouse cerebellum tissue with GAT-1 antibody, HRP-secondary and DAB substrate. Strong membrane associated brown labeling is observed along the periphery of the granular layer and in scattered neuronal processes, consistent with the expected distribution of the GABA transporter GAT-1. Hematoxylin counterstain shows nuclei in blue.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gata1-antibody-bha17106495</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c83dc963-11b2-4d02-9c8a-39c58af391ad.jpg?v=1775785867</image:loc>
      <image:title>GATA1 Antibody</image:title>
      <image:caption>Western blot testing of human PBMC lysate with GATA1 antibody at 0.3ug/ml. Predicted molecular weight ~43 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gata5-antibody-bha17106858</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3e4a4fe7-c928-40a6-aa85-84108d99c843.jpg?v=1775785910</image:loc>
      <image:title>GATA5 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 cell lysate with GATA5 antibody at 0.3ug/ml. Predicted molecular weight ~41kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/galr1-antibody-bha17107161</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ce4119a0-a226-4c5d-a4aa-ed93b5317a8e.jpg?v=1775785941</image:loc>
      <image:title>GALR1 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with GALR1 antibody at 0.1ug/ml. The expected ~40kDa band and the additional ~150kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gcdfp-15-antibody-pip-bha17107027</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1e7cebe5-4f5e-4969-867a-821c9c96a083.jpg?v=1775785928</image:loc>
      <image:title>GCDFP-15 Antibody / PIP</image:title>
      <image:caption>IHC staining of FFPE human breast with GCDFP-15 antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gch1-antibody-bha17107057</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d62d3a01-cdfd-4e75-9f3f-df80d55955db.jpg?v=1775785930</image:loc>
      <image:title>GCH1 Antibody</image:title>
      <image:caption>Western blot testing of human tonsil lysate with GCH1 antibody at 0.5ug/ml. Predicted molecular weight ~28kDa, observed here at ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gcn5-antibody-kat2a-bha17105625</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_da4ebd06-fbca-435a-bb08-b9c7c18061ce.jpg?v=1775785725</image:loc>
      <image:title>GCN5 Antibody / KAT2A</image:title>
      <image:caption>Western blot testing of human 1) A431, 2) 22RV1 and 3) COLO320 lysate with GCN5 antibody. Expected/observed molecular weight ~94 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gcsf-antibody-bha17105278</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_98aca968-1b1e-4f9c-b7b8-1d48a8bc6617.jpg?v=1775785669</image:loc>
      <image:title>GCSF Antibody</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate with GCSF antibody. Expected/observed molecular weight ~22 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gdh-antibody-bha17106962</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_403361f0-1945-4512-8776-0170d31ebed0.jpg?v=1775785920</image:loc>
      <image:title>GDH Antibody</image:title>
      <image:caption>Western blot testing of human [A] and mouse [B] brain lysate with GDH antibody at 0.03ug/ml. Predicted molecular weight ~61kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gcnt3-antibody-bha17107634</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b6948519-a344-418f-94a5-307a66429a65.jpg?v=1775785996</image:loc>
      <image:title>GCNT3 Antibody</image:title>
      <image:caption>Western blot testing of human duodenum lysate with GCNT3 antibody at 0.1ug/ml. Predicted molecular weight ~51kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gdf15-antibody-bha17106082</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a103ac20-228c-40ca-a2b3-47d565485a01.jpg?v=1775785804</image:loc>
      <image:title>GDF15 Antibody</image:title>
      <image:caption>Western blot testing of human 1) 22RV1 and 2) placenta lysate with GDF15 antibody at 0.5ug/ml. Predicted molecular weight ~34 kDa (pro-form) and ~25 kDa (mature form).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gef5-antibody-rho-guanine-nucleotide-exchange-factor-5-bha17106584</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_138f3dc6-314c-4a8f-a28a-f60bc9488623.jpg?v=1775785880</image:loc>
      <image:title>GEF5 Antibody / Rho guanine nucleotide exchange factor 5</image:title>
      <image:caption>Western blot testing of HeLa lysate with GEF5 antibody at 0.1ug/ml. Predicted molecular weight: ~177 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gckr-antibody-bha17107457</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_49aaebd8-082d-4da3-8f84-e38652f3c3a3.jpg?v=1775785974</image:loc>
      <image:title>GCKR Antibody</image:title>
      <image:caption>Western blot testing of rat liver lysate with GCKR antibody at 0.1ug/ml. Predicted molecular weight ~69kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gfap-antibody-bha17106555</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3ad8d731-3b2c-4c08-b7d8-670d3b70ab26.jpg?v=1775785877</image:loc>
      <image:title>GFAP Antibody</image:title>
      <image:caption>Western blot testing of 1) human cerebellum, 2) mouse brain and 3) rat brain lysate with GFAP antibody at 0.003ug/ml (human/rat) and 0.1ug/ml (mouse). Predicted molecular weight ~50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gip-antibody-gastric-inhibitory-polypeptide-bha17105753</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d6366610-6841-4dc5-b886-8db27f07e837.jpg?v=1775785744</image:loc>
      <image:title>GIP Antibody / Gastric inhibitory polypeptide</image:title>
      <image:caption>IHC staining of FFPE human colorectal adenocarcinoma tissue with GIP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gip-antibody-gastric-inhibitory-polypeptide-bha17105750</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e99cce50-1779-45f8-8b92-15da96e47281.jpg?v=1775785745</image:loc>
      <image:title>Gip Antibody / Gastric inhibitory polypeptide</image:title>
      <image:caption>IHC staining of FFPE mouse colon tissue with Gip antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ggt1-antibody-bha17107645</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_deebffb4-723f-4899-b740-23b152a7da42.jpg?v=1775785995</image:loc>
      <image:title>GGT1 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with GGT1 antibody at 0.1ug/ml. Predicted molecular weight ~61kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/glast-antibody-eaat1-slc1a3-bha17105742</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_222fa6d8-e5b1-41c2-88f3-b3504ef8f940.jpg?v=1775785742</image:loc>
      <image:title>GLAST Antibody / EAAT1 / SLC1A3</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse brain lysate with GLAST antibody. Predicted molecular weight: 55-60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/glast-antibody-eaat1-bha17106630</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_71390f1f-709e-4ad3-8b23-3eecec55fa73.jpg?v=1775785883</image:loc>
      <image:title>GLAST Antibody / EAAT1</image:title>
      <image:caption>Western blot testing of human hippocampus lysate with GLAST antibody at 2ug/ml. Predicted molecular weight: 55-60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gla-antibody-galactosidase-alpha-bha17105916</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0231ebb3-b176-42d1-bf9d-69993cc3684a.jpg?v=1775785778</image:loc>
      <image:title>Gla Antibody / Galactosidase alpha</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat brain, 3) rat C6, 4) mouse liver, 5) mouse brain and 6) mouse NIH 3T3 cell lysate with Gla antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gipc3-antibody-bha17106798</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6b911c6a-53dd-43d6-a91d-8ccdadf9f9fa.jpg?v=1775785903</image:loc>
      <image:title>GIPC3 Antibody</image:title>
      <image:caption>Western blot testing of human lymph node lysate with GIPC3 antibody at 0.5ug/ml. Predicted molecular weight ~36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gitr-antibody-tnfrsf18-bha17106227</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b01a299a-c1e7-487e-a5cb-c30e3a93fd4f.jpg?v=1775785829</image:loc>
      <image:title>GITR Antibody / TNFRSF18</image:title>
      <image:caption>Western blot testing of 1) rat kidney and 2) mouse kidney using GITR antibody at 0.5ug/ml. Predicted molecular weight ~26 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gjc2-antibody-bha17105590</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a729c46f-004c-4fb9-98ae-9694ecf6b69f.jpg?v=1775785716</image:loc>
      <image:title>GJC2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain, 3) human U20S and 4) human HeLa lysate with GJC2 antibody. Expected/observed molecular weight ~47 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/glp-antibody-bha17106620</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_085aff89-8eb3-4e18-906f-beace559c151.jpg?v=1775785882</image:loc>
      <image:title>GLP Antibody</image:title>
      <image:caption>IHC testing of FFPE human cerebral cortex with GLP antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gjc1-antibody-connexin-45-bha17106024</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e688ffad-edff-4f25-a012-768d738700cd.jpg?v=1775785796</image:loc>
      <image:title>GJC1 Antibody / Connexin 45</image:title>
      <image:caption>IHC testing of FFPE human intestinal cancer tissue with GJC1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/glucose-6-phosphate-isomerase-antibody-gpi-bha17105855</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_62399ab6-9a64-4fa5-9aee-174b6634dbe3.jpg?v=1775785767</image:loc>
      <image:title>Glucose-6-phosphate isomerase Antibody / GPI</image:title>
      <image:caption>Western blot testing of mouse thymus lysate with GPI antibody at 0.5ug/ml. Predicted/observed molecular weight: ~64 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/glur1-antibody-bha17107351</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_16924acf-f42a-4228-9401-eec8b6b1f4cf.jpg?v=1775785963</image:loc>
      <image:title>GLUR1 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with GLUR1 antibody at 0.1ug/ml. Predicted/observed molecular weight ~102 kDa</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/glut9-antibody-glucose-transporter-9-slc2a9-bha17105663</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_717f6d11-5412-4882-98b3-0fa385cf45d5.jpg?v=1775785731</image:loc>
      <image:title>GLUT9 Antibody / Glucose Transporter 9 / SLC2A9</image:title>
      <image:caption>Western blot testing of human 1) HepG2 and 2) A549 cell lysate with GLUT9 antibody. Expected molecular weight: 59/56 kDa (L/S forms).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gnaq-antibody-bha17107590</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4b774db4-e4ca-4f1b-9d13-a5e411e4b47b.jpg?v=1775785989</image:loc>
      <image:title>GNAQ Antibody</image:title>
      <image:caption>Western blot testing of mouse [A] and rat [B] testis lysates with GNAQ antibody at 0.1ug/ml. Predicted molecular weight ~42kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gnaq-antibody-bha17105461</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_09115522-3dfa-4957-8e27-a3b981903f09.jpg?v=1775785692</image:loc>
      <image:title>GNAQ Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with GNAQ antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gnb1-antibody-guanine-nucleotide-binding-protein-beta-1-subunit-bha17105853</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0d988bf3-1fad-4e21-9e05-d19fed5b8cc5.jpg?v=1775785766</image:loc>
      <image:title>GNB1 Antibody / Guanine nucleotide binding protein beta 1 subunit</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse heart and 3) human HeLa lysate with GNB1 antibody at 0.5ug/ml. Predicted/observed molecular weight: ~37 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gm2a-antibody-bha17107465</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_093ede4f-6133-4b38-994b-bbe08e07facb.jpg?v=1775785976</image:loc>
      <image:title>GM2A Antibody</image:title>
      <image:caption>Western blot of HEK293 lysate overexpressing human GM2A-FLAG probed with GMA2 antibody (1ug/ml) in Lane A and anti-FLAG (1/30000) in lane C. Mock-transfected HEK293 probed with GMA2 antibody (1ug/ml) in Lane B. Predicted molecular weight ~22kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/glycine-receptor-antibody-bha17106423</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_76bbacdd-9cca-4e27-94c7-2262d2d905ae.jpg?v=1775785858</image:loc>
      <image:title>Glycine receptor Antibody</image:title>
      <image:caption>Western blot testing of mouse testis lysate with Glycine receptor antibody at 0.3ug/ml. Predicted molecular weight ~48/60kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gnat3-antibody-bha17107412</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7a63edff-041d-4829-ada9-aacd768da0fd.jpg?v=1775785969</image:loc>
      <image:title>GNAT3 Antibody</image:title>
      <image:caption>IHC testing of FFPE human small intestine with GNAT3 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining. Staining of endocrine cells amongst the enterocytes is seen.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/golga3-antibody-bha17107205</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_aba1a089-8868-41ec-a815-8fe6663c8bb1.jpg?v=1775785948</image:loc>
      <image:title>GOLGA3 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with GOLGA3 antibody at 0.1ug/ml. Predicted/observed molecular weight 160~170kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gnl3-antibody-bha17106847</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3f7f1c4e-43c3-4251-8d36-02ddc0c6b8df.jpg?v=1775785908</image:loc>
      <image:title>GNL3 Antibody</image:title>
      <image:caption>Western blot testing of A) HeLa, B) HepG2, and C) K562 nuclear lysates with GNL3 antibody at 2ug/ml. Predicted molecular weight: ~62/60kDa (isoforms 1/2). The observed ~75kDa band likely represents the acetylated form of the protein.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/got2-antibody-bha17106408</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0e87a2f8-2b9e-4c54-80fd-7030007245f3.jpg?v=1775785858</image:loc>
      <image:title>GOT2 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with GOT2 antibody at 0.03ug/ml. Predicted molecular weight ~47kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gnb2l1-antibody-bha17107709</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9e4ca34a-047f-4bfd-818f-0831a12a9969.jpg?v=1775786003</image:loc>
      <image:title>GNB2L1 Antibody</image:title>
      <image:caption>Western blot testing of human lymph node [A], mouse spleen [B] and rat spleen [C] lysates with GNB2L1 antibody at 0.1ug/ml. Predicted molecular weight: ~35kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/golph3-antibody-bha17106603</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8677a074-ee3b-47aa-9ce3-b7d832af6538.jpg?v=1775785882</image:loc>
      <image:title>GOLPH3 Antibody</image:title>
      <image:caption>Western blot testing of human platelet lysate with GOLPH3 antibody at 0.3ug/ml. Predicted molecular weight ~34 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gnb3-antibody-bha17106510</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_172286da-2236-4eb1-916b-8b9cf753c998.jpg?v=1775785870</image:loc>
      <image:title>GNB3 Antibody</image:title>
      <image:caption>Western blot testing of human brain [frontal cortex] lysate with GNB3 antibody at 1ug/ml. Predicted molecular weight ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gna12-antibody-bha17107362</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_091d3338-5cf8-4d29-b98c-33df4697c80e.jpg?v=1775785965</image:loc>
      <image:title>GNA12 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with GNA12 antibody at 1ug/ml. Predicted/observed molecular weight: ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/golph2-antibody-golm1-bha17107652</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6621f88f-9785-480c-9e47-0078da3632b5.jpg?v=1775785999</image:loc>
      <image:title>GOLPH2 Antibody / GOLM1</image:title>
      <image:caption>IHC staining of FFPE human prostate with GOLPH2 antibody at 3.75ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gp78-antibody-amfr-bha17105825</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_26dcdb47-52fc-44da-94b3-8711e4b9b480.jpg?v=1775785762</image:loc>
      <image:title>GP78 Antibody / AMFR</image:title>
      <image:caption>Immunofluorescent staining of FFPE human T-47D cells with GP78 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gpr125-antibody-bha17106482</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e6b44aab-802b-4fd4-986d-3d3da2ec5a7b.jpg?v=1775785865</image:loc>
      <image:title>GPR125 Antibody</image:title>
      <image:caption>Western blot testing of human ovay lysate with GPR125 antibody at 0.5ug/ml. The expected ~140 kDa band and the additional ~33 kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gpr3-antibody-bha17107559</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d1f08bd2-08ef-41d8-ae83-a276e7170e23.jpg?v=1775785984</image:loc>
      <image:title>GPR3 Antibody</image:title>
      <image:caption>Western blot testing of human brain frontal cortex lysate with GPR3 antibody at 0.3ug/ml. The expected ~35kDa band and the additional ~30kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gpi-antibody-glucose-6-phosphate-isomerase-bha17105854</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e62068fe-cc08-45b8-bf8f-a144f35bcdea.jpg?v=1775785765</image:loc>
      <image:title>GPI Antibody / Glucose-6-phosphate isomerase</image:title>
      <image:caption>Flow cytometry testing of fixed and permeabilized human K562 cells with GPI antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= GPI antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gpr17-antibody-bha17106802</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2286d898-18db-4992-978e-fd01025fb40e.jpg?v=1775785903</image:loc>
      <image:title>GPR17 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with GPR17 antibody at 0.1ug/ml. Predicted molecular weight (human): ~41 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gpr39-antibody-bha17107100</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d65e786f-906a-454a-8fab-82eb42af99d1.jpg?v=1775785936</image:loc>
      <image:title>GPR39 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with GPR39 antibody at 0.3ug/ml. Predicted molecular weight: ~51kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/graf-antibody-bha17107496</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_887878dc-58e8-4274-9449-ba0eff086644.jpg?v=1775785979</image:loc>
      <image:title>GRAF Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with GRAF antibody at 0.3ug/ml with [B] and without [A] blocking/immunizing peptide. Predicted molecular weight: ~92 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gpx1-antibody-bha17106736</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8bb1bc45-204f-47da-8306-09ae1c44bb5d.jpg?v=1775785895</image:loc>
      <image:title>Gpx1 Antibody</image:title>
      <image:caption>Western blot testing of rat liver lysate with Gpx1 antibody at 0.1g/ml. Predicted molecular weight ~22kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gpr40-antibody-bha17106371</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c85ee9c8-484d-4eb6-bdef-b47b12dc813d.jpg?v=1775785850</image:loc>
      <image:title>GPR40 Antibody</image:title>
      <image:caption>Western blot testing of human breast lysate with GPR40 antibody at 0.01ug/ml. Predicted molecular weight ~31 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gpx3-antibody-bha17107674</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_db3424e5-196a-4fbd-a9ea-665c298c7f18.jpg?v=1775786000</image:loc>
      <image:title>GPX3 Antibody</image:title>
      <image:caption>Western blot testing of mouse heart lysate with GPX3 antibody at 1ug/ml. Expected molecular weight: 23-26 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grb10-antibody-bha17106333</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_25979a8b-5dbf-42f0-988c-8469ece56847.jpg?v=1775785846</image:loc>
      <image:title>GRB10 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with GRB10 antibody at 1ug/ml. Expected molecular weight: 58-70 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gpx7-antibody-center-region-bha17106436</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_33e200f9-b4a3-4ac7-a897-350ff3956e3a.jpg?v=1775785861</image:loc>
      <image:title>GPX7 Antibody (Center Region)</image:title>
      <image:caption>Western blot testing of human prostate lysate with GPX7 antibody at 0.3ug/ml with [B] and without [A] blocking/immunizing peptide. The expected ~20 kDa band and the additional ~40 kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gria4-antibody-bha17107366</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7c552d4d-28a6-4247-9107-fb4c20460a53.jpg?v=1775785965</image:loc>
      <image:title>GRIA4 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with GRIA4 antibody at 0.3ug/ml. Predicted molecular weight: ~101kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grap-antibody-bha17107042</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6201cf07-94a6-43bd-b687-3b27bdb8a677.jpg?v=1775785929</image:loc>
      <image:title>GRAP Antibody</image:title>
      <image:caption>Western blot testing of human thymus lysate with GRAP antibody at 0.3ug/ml. Predicted molecular weight: ~25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grin3b-antibody-bha17106752</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5e387cd2-7ab5-4e77-821f-839d7275458e.jpg?v=1775785897</image:loc>
      <image:title>GRIN3B Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with GRIN3B antibody at 0.5ug/ml. Predicted molecular weight: ~113kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grb7-antibody-bha17106860</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_50e7564b-101a-45dc-8476-53f596668514.jpg?v=1775785911</image:loc>
      <image:title>GRB7 Antibody</image:title>
      <image:caption>Western blot testing of A431 lysate with GRB7 antibody at 2ug/ml. Predicted molecular weight: ~60kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grk6-antibody-bha17105444</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4c687d8e-f3c8-423b-ade2-221c5bd10e6d.jpg?v=1775785688</image:loc>
      <image:title>GRK6 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat lung, human 2) HeLa, 3) K562 and 4) Jurkat lysate with GRK6 antibody. Expected/observed molecular weight ~66 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gnai2-antibody-guanine-nucleotide-binding-protein-g-i-subunit-alpha-2-bha17107764</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b3020050-77d9-4eaa-b414-800638c206ed.jpg?v=1775786008</image:loc>
      <image:title>GNAI2 Antibody / Guanine nucleotide-binding protein G(i) subunit alpha-2</image:title>
      <image:caption>Western blot testing of human peripheral blood lymphocyte lysate with GNAI2 antibody at 2ug/ml. Predicted molecular weight: ~40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grap2-antibody-bha17107058</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_837a0beb-49da-462c-8bef-b8c70f1156c4.jpg?v=1775785930</image:loc>
      <image:title>GRAP2 Antibody</image:title>
      <image:caption>Western blot of HEK293 lysate overexpressing GRAP2 probed with GRAP2 antibody (mock transfection in lane 1). Predicted molecular weight: ~38 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gpsm2-antibody-bha17107687</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_89534eff-5ff8-4c34-a08a-952f8251ffbb.jpg?v=1775785999</image:loc>
      <image:title>GPSM2 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with GPSM2 antibody at 0.01ug/ml. Predicted molecular weight: ~76 kDa. Both observed bands are blocked by addition of the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gpx4-antibody-isoforms-a-and-c-bha17106785</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1a37da7a-5878-4a39-8255-38e863e19d86.jpg?v=1775785901</image:loc>
      <image:title>GPX4 Antibody (isoforms a and c)</image:title>
      <image:caption>Western blot testing of human testis lysate with GPX4 antibody at 0.1ug/ml. Predicted molecular weight: ~22kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grk3-antibody-adrbk2-bha17105422</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1e4fa143-969e-41ff-a94e-6a13a2396331.jpg?v=1775785685</image:loc>
      <image:title>GRK3 Antibody / ADRBK2</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with GRK3 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gro-gamma-antibody-cxcl3-bha17105743</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_95799281-2f9c-4d7e-8ed3-f080ab8243f4.jpg?v=1775785742</image:loc>
      <image:title>Gro gamma Antibody / Cxcl3</image:title>
      <image:caption>Western blot testing of 1) mouse lung and 2) mouse spleen lysate with Gro gamma antibody. Predicted molecular weight ~11 kDa, observed here at ~25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grp78-antibody-bip-hspa5-bha17105288</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3180631a-c548-4f93-b1f3-6cc5229e96fa.jpg?v=1775785674</image:loc>
      <image:title>GRP78 Antibody / BiP / HSPA5</image:title>
      <image:caption>IHC staining of FFPE mouse brain tissue with GRP78 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grp94-antibody-hsp90b1-bha17105316</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_87f94e57-0ca6-4968-a23d-71f51c64e91f.jpg?v=1775785682</image:loc>
      <image:title>GRP94 Antibody / HSP90B1</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with GRP94 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grm2-antibody-metabotropic-glutamate-receptor-2-mglur2-bha17107310</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1cc3aacb-adde-4539-9985-23445b0d7d6e.jpg?v=1775785959</image:loc>
      <image:title>GRM2 Antibody / Metabotropic Glutamate Receptor 2 / mGluR2</image:title>
      <image:caption>Western blot testing of human hippocampus lysate with GRM2 antibody at 1ug/ml. Predicted molecular weight: ~28 kDa (isoform 2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grik3-antibody-bha17107355</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_255a113b-3aeb-42c8-81e9-c16a64f9206b.jpg?v=1775785963</image:loc>
      <image:title>GRIK3 Antibody</image:title>
      <image:caption>Western blot testing of rat brain lysate with GRIK3 antibody at 0.3ug/ml. The expected ~110kDa band and additional ~39kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grp94-antibody-hsp90b1-bha17107294</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ff4412bd-85bb-40ee-baf1-af48da99db8f.jpg?v=1775785959</image:loc>
      <image:title>GRP94 Antibody / HSP90B1</image:title>
      <image:caption>Western blot testing of mouse NIH3T3 lysate with GPR94 antibody at 0.03ug/ml. Predicted molecular weight: ~94 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grm7-antibody-bha17107587</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_92619f5a-250e-4308-a144-f951769d03af.jpg?v=1775785988</image:loc>
      <image:title>GRM7 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with GRM7 antibody at 0.5ug/ml. Predicted molecular weight: ~102kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grp75-antibody-hspa9-bha17105429</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f5135342-ab7b-4300-b4d4-d4837fe3b416.jpg?v=1775785687</image:loc>
      <image:title>GRP75 Antibody / HSPA9</image:title>
      <image:caption>Immunofluorescent staining of FFPE human HeLa cells with GRP75 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gsta3-antibody-bha17106861</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_37adcb7f-0aac-4d95-b2a9-16fbb10ba854.jpg?v=1775785908</image:loc>
      <image:title>Gsta3 Antibody</image:title>
      <image:caption>Western blot testing of rat liver lysate with Gsta3 antibody at 0.1ug/ml. Predicted molecular weight: ~25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gsta-antibody-alpha-1-5-bha17106193</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_058ff71a-227c-41e3-9ff5-859a2ed58f65.jpg?v=1775785822</image:loc>
      <image:title>GSTA Antibody (alpha 1-5)</image:title>
      <image:caption>Western blot testing of 1) rat liver and 2) mouse liver lysate with GSTA antibody at 0.5ug/ml. Predicted molecular weight ~25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/grk5-antibody-bha17105416</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e7885f36-67eb-4484-8b1c-5edffcb67538.jpg?v=1775785677</image:loc>
      <image:title>GRK5 Antibody</image:title>
      <image:caption>Western blot testing of 1) human HepG2, 2) human HeLa, 3) human A549, 4) rat heart and 5) mouse heart tissue lysate with GRK5 antibody. Expected molecular weight ~68 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gsto1-antibody-bha17107290</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_dab00533-cebe-4806-b24e-4fffd859bb86.jpg?v=1775785956</image:loc>
      <image:title>GSTO1 Antibody</image:title>
      <image:caption>Western blot testing of human liver [A] and peripheral blood lymphocyte [B] lysates with GSTO1 antibody at 0.5ug/ml. Predicted molecular weight: ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gstm1-antibody-bha17106487</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_294d2fcb-e87a-4105-9bd0-dea983d13747.jpg?v=1775785866</image:loc>
      <image:title>GSTM1 Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with GSTM1 antibody at 0.3ug/ml. Predicted molecular weight: ~26kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gsta5-antibody-bha17106880</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_895fd6f5-2048-42c1-910a-173f6fee9b33.jpg?v=1775785913</image:loc>
      <image:title>Gsta5 Antibody</image:title>
      <image:caption>Western blot testing of rat liver lysate with Gsta5 antibody at 0.3ug/ml. Predicted molecular weight: ~25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gstt1-antibody-bha17106173</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d0936fd0-cf45-472a-be13-b62f301441a1.jpg?v=1775785817</image:loc>
      <image:title>GSTT1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat lung, 3) mouse liver and 4) mouse lung with GSTT1 antibody at 0.5ug/ml. Predicted molecular weight ~27 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gstp1-antibody-gsp-pi-bha17106127</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_821558a0-cc81-4939-926e-940a71d83567.jpg?v=1775785813</image:loc>
      <image:title>GSTP1 Antibody / GSP pi</image:title>
      <image:caption>Immunofluorescent staining of FFPE NRK cells (normal rat kidney epithelial cells) with GSTP1 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gstp1-antibody-gst-pi-bha17107531</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3aadbf11-1781-42ce-87a3-06c4c2d0aad0.jpg?v=1775785983</image:loc>
      <image:title>GSTP1 Antibody / GST pi</image:title>
      <image:caption>Western blot testing of human kidney lysate with GSTP1 antibody at 0.01ug/ml. Predicted molecular weight ~23 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gst-pi-antibody-gstp1-bha17106126</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_daa0776d-14a6-4a31-bb3e-3a49bf68c318.jpg?v=1775785812</image:loc>
      <image:title>GST pi Antibody / GSTP1</image:title>
      <image:caption>IHC testing of FFPE mouse kidney tissue with GST pi antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hao2-antibody-hydroxyacid-oxidase-2-bha17106724</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9c14a321-7f8e-4903-92b3-2b6f35a97f7b.jpg?v=1775785898</image:loc>
      <image:title>HAO2 Antibody / Hydroxyacid oxidase 2</image:title>
      <image:caption>Western blot testing of human kidney lysate with HAO2 antibody at 0.3ug/ml. Predicted molecular weight: ~39 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hbd-antibody-hemoglobin-subunit-delta-bha17106172</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fb354a12-bbf4-4838-951f-b07c89a02e8f.jpg?v=1775785820</image:loc>
      <image:title>HBD Antibody / Hemoglobin subunit delta</image:title>
      <image:caption>Western blot testing of 1) human placenta, 2) rat spleen and 3) mouse spleen lysate with HBD antibody at 0.5ug/ml. Predicted molecular weight ~16 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/gulp1-antibody-ced6-bha17106807</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_16cb3aaf-29b1-45d3-94c7-d32938e152a5.jpg?v=1775785904</image:loc>
      <image:title>GULP1 Antibody / CED6</image:title>
      <image:caption>IHC staining of FFPE human kidney with GULP1 antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hdac1-antibody-bha17107417</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4c3888a4-24d5-4abf-aaeb-b283e5ca0949.jpg?v=1775785972</image:loc>
      <image:title>HDAC1 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with HDAC1 antibody at 0.5ug/ml. Predicted molecular weight 55~60 kDa. Larger size likely due to sumoylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hdac6-antibody-bha17105670</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b45e8a90-ae48-475a-90d2-20524f5d3e53.jpg?v=1775785732</image:loc>
      <image:title>HDAC6 Antibody</image:title>
      <image:caption>Flow cytometry testing of fixed and permeabilized human K562 cells with HDAC6 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HDAC6 antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hcn2-antibody-bha17106097</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_30b8ba30-a300-40e0-a276-6edd797ee48c.jpg?v=1775785808</image:loc>
      <image:title>HCN2 Antibody</image:title>
      <image:caption>IHC testing of FFPE rat brain tissue with HCN2 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hcp1-antibody-bha17107548</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_188f2f83-4522-44ef-86c2-fedf8b756090.jpg?v=1775785984</image:loc>
      <image:title>HCP1 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with HCP1 antibody at 0.3ug/ml. Predicted molecular weight: ~50kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hdac11-antibody-bha17105636</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d667c518-961d-4b0f-bafa-74adde813f59.jpg?v=1775785725</image:loc>
      <image:title>HDAC11 Antibody</image:title>
      <image:caption>Western blot testing of rat 1) skeletal muscle, 2) kidney, 3) heart, 4) NRK, and human 5) 293, 6) HeLa and 7) MCF7 lysate with HDAC11 antibody. Expected/observed molecular weight ~39 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hdac4-antibody-bha17106042</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f19ce449-0f64-486e-b01f-e1b0d5d6fe1b.jpg?v=1775785799</image:loc>
      <image:title>HDAC4 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat lung, 3) rat testis, 4) mouse lung, 5) mouse brain, 6) mouse testis and 7) human HepG2 lysate with HDAC4 antibody at 0.5ug/ml. Expected molecular weight: ~140 kDa (full length), ~95 kDa (truncated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hdac1-antibody-bha17107746</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_183c588c-57a4-41ae-81ef-0dd10c530dd8.jpg?v=1775786007</image:loc>
      <image:title>Hdac1 Antibody</image:title>
      <image:caption>Western blot testing of NIH3T3 lysate with Hdac1 antibody at 0.3ug/ml. Predicted molecular weight 55~60kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/he4-antibody-wfdc2-bha17105711</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8c7f2893-3b5e-4221-b79b-4b2de9f13960.jpg?v=1775785739</image:loc>
      <image:title>HE4 Antibody / WFDC2</image:title>
      <image:caption>Western blot testing of human 22RV1 cell lysate with HE4 antibody. Expected molecular weight: 13-25 kDa, depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hdgf-antibody-bha17105915</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5f5626c3-f235-4334-a8c7-9916f8d4a351.jpg?v=1775785779</image:loc>
      <image:title>HDGF Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver and 2) human 22RV1 (prostate carcinoma) lysate with HDGF antibody at 0.5ug/ml. Predicted molecular weight ~26 kDa but routinely observed at ~38 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hepatitis-b-virus-antibody-hbv-large-s-protein-bha17105946</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_da5921bf-683e-4e44-ab78-32885759b9c9.jpg?v=1775785785</image:loc>
      <image:title>Hepatitis B Virus Antibody / HBV (Large S Protein)</image:title>
      <image:caption>IHC testing of FFPE human liver cancer tissue with Hepatitis B Virus antibody at 0.5ug/ml. HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hdac7-antibody-bha17105617</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e8af92a8-a67b-4eff-ac6f-2d0dcfa8062b.jpg?v=1775785721</image:loc>
      <image:title>HDAC7 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat spleen, 2) rat thymus, 3) human placenta and 4) HeLa lysate with HDAC7 antibody. Expected/observed molecular weight ~103 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hdac6-antibody-bha17106312</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_699fa412-3e0c-4eb1-9c4d-6b0def402b88.jpg?v=1775785841</image:loc>
      <image:title>HDAC6 Antibody</image:title>
      <image:caption>Western blot testing of HeLa nuclear lysate with HDAC6 antibody at 1ug/ml. Expected molecular weight 130~160kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/her2-antibody-bha17105975</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9ccfb582-d577-4a69-95a6-5a75a68ce25a.jpg?v=1775785788</image:loc>
      <image:title>HER2 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) MCF7 cell lysate with HER2 antibody. Predicted molecular weight ~138 kDa (unmodified), ~185 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/heparanase-antibody-bha17106071</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2b1141b1-f151-4ad0-b827-aeb8fe139f1d.jpg?v=1775785802</image:loc>
      <image:title>Heparanase Antibody</image:title>
      <image:caption>Western blot testing of mouse spleen lysate with Heparanase antibody at 0.5ug/ml. Predicted molecular weight: 61 kDa (isoform 1), ~53 kDa (isoform 2/3), ~43 kDa (isoform 4).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hdgfrp3-antibody-bha17106893</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_eecbe970-f204-445a-9e4a-f1158169fc59.jpg?v=1775785914</image:loc>
      <image:title>HDGFRP3 Antibody</image:title>
      <image:caption>Western blot testing of human amygdala lysate with HDGFRP3 antibody at 0.3ug/ml. Predicted molecular weight: ~23kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hdac3-antibody-bha17107614</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_720671a5-8d36-406f-ade7-1a01bf8dd4d7.jpg?v=1775785991</image:loc>
      <image:title>HDAC3 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat nuclear lysate with HDAC3 antibody at 0.1ug/ml. Predicted molecular weight ~49kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hemoglobin-antibody-subunit-alpha-bha17106050</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9423bae5-278c-4453-9d9d-9716abf6f327.jpg?v=1775785801</image:loc>
      <image:title>Hemoglobin Antibody (Subunit alpha)</image:title>
      <image:caption>IHC testing of FFPE human placental tissue with Hemoglobin antibody. Required HIER: steam section in pH8 EDTA buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/heparanase-1-antibody-bha17105682</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3d26990e-cceb-4886-8246-652244deda6e.jpg?v=1775785735</image:loc>
      <image:title>Heparanase 1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) human placenta, 3) A549 lysate with Heparanase 1 antibody. Predicted molecular weight: 61 kDa (isoform 1), ~53 kDa (isoform 2/3), ~43 kDa (isoform 4).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hic1-antibody-bha17107153</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_019701e0-eeef-4ab1-8f4c-848aee97368e.jpg?v=1775785942</image:loc>
      <image:title>HIC1 Antibody</image:title>
      <image:caption>Western blot of HEK293 lysate overexpressing human HIC1 tested with HIC1 antibody at (0.5ug/ml). Mock transfection lanes also shown. Predicted molecular weight: ~77kDa but can be observed at ~100kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hic1-antibody-bha17107706</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e612a3c8-f8b7-4158-babb-aa7f969a577e.jpg?v=1775786002</image:loc>
      <image:title>HIC1 Antibody</image:title>
      <image:caption>Western blot of HEK293 lysate overexpressing human HIC1 tested with HIC1 antibody at (0.5ug/ml). Mock transfection lanes also shown. Predicted molecular weight: ~77kDa but can be observed at ~100kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hexim1-antibody-bha17107189</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e36c548a-706b-4e3f-a993-8cd17a231fdd.jpg?v=1775785946</image:loc>
      <image:title>HEXIM1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of fixed and permeabilized human A431 cells with HEXIM1 antibody (green) at 10ug/ml and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hfe-antibody-hereditary-hemochromatosis-protein-bha17106068</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_307186ec-eb5a-424f-aef9-2fd663e13c97.jpg?v=1775785803</image:loc>
      <image:title>HFE Antibody (Hereditary hemochromatosis protein)</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) HepG2 and 3) A431 cell lysate with HFE antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/her3-antibody-bha17107206</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_10ab37e0-1564-4b23-9490-1ba704e4904f.jpg?v=1775785948</image:loc>
      <image:title>HER3 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with HER3 antibody at 0.1ug/ml with [B] and without [A] immunizing peptide. Predicted molecular weight ~148 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hhex-antibody-hex-hematopoietically-expressed-homeobox-protein-bha17105523</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_531a8992-ffd5-41d8-a4f6-8cc4ad684593.jpg?v=1775785701</image:loc>
      <image:title>HHEX Antibody / HEX / Hematopoietically expressed homeobox protein</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse liver and 3) human HepG2 lysate with HHEX antibody. Routinely observed at 35~37 kDa (Ref 1), observed here at ~47 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hexokinase-ii-antibody-bha17105919</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_00558b4c-e587-49ff-89b2-c69591bb6fab.jpg?v=1775785780</image:loc>
      <image:title>Hexokinase II Antibody</image:title>
      <image:caption>Western blot testing of human 1) U-87 MG, 2) HEL, 3) HepG2 and 4) RT4 cell lysate with Hexokinase II antibody at 0.5ug/ml. Predicted molecular weight ~102 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hint1-antibody-bha17105460</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8233b7d2-171b-42aa-90e0-944f948cbb5d.jpg?v=1775785691</image:loc>
      <image:title>HINT1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with HINT1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hippi-antibody-bha17106923</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c8f39914-16cf-41ea-94eb-79c0cd538d25.jpg?v=1775785918</image:loc>
      <image:title>HIPPI Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with HIPPI antibody at 1ug/ml. Predicted molecular weight: ~49 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hkdc1-antibody-bha17105587</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_612b4a6b-7cd9-4f01-baa1-6b0c8f409211.jpg?v=1775785717</image:loc>
      <image:title>HKDC1 Antibody</image:title>
      <image:caption>Western blot testing of human 1) 293, 2) SW620, 3) COLO320 and 4) HeLa cell lysate with HKDC1 antibody. Expected molecular weight: ~103 kDa, observed here at ~170 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hmbs-antibody-bha17107152</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0531d635-b99a-4503-957b-2269429191be.jpg?v=1775785940</image:loc>
      <image:title>HMBS Antibody</image:title>
      <image:caption>Western blot testing of K562 lysate with HMBS antibody at 0.1ug/ml. Predicted molecular weight: ~39 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hmg4-antibody-hmgb3-bha17107313</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_61216e5c-e47d-4fa0-809b-64f4ee222a06.jpg?v=1775785958</image:loc>
      <image:title>HMG4 Antibody / HMGB3</image:title>
      <image:caption>Western blot testing of human lung lysate with HMG4 antibody at 0.01ug/ml. Predicted molecular weight: ~23kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hla-b-antibody-bha17106682</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_79bec09a-cfa7-423d-8a1e-57370932c3af.jpg?v=1775785892</image:loc>
      <image:title>HLA-B Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with HLA-B antibody at 0.1ug/ml. Predicted molecular weight: ~40/45kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hla-c-antibody-bha17105691</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ee798372-5f61-442b-b187-28bdd365621e.jpg?v=1775785736</image:loc>
      <image:title>HLA-C Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human lung cancer with HLA-C antibody (green) at 1ug/ml and DAPI nuclear stain. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hmgb1-antibody-bha17105987</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9b607645-4d1f-429e-9917-aa8c84272dd1.jpg?v=1775785790</image:loc>
      <image:title>HMGB1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse ovary, 3) human 22RV1 and 4) human HeLa lysate with HMGB1 antibody at 0.5ug/ml. Predicted molecular weight ~25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hla-dpb1-antibody-bha17105904</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_948aed54-c233-44a9-a9a5-91d5b1440055.jpg?v=1775785775</image:loc>
      <image:title>HLA-DPB1 Antibody</image:title>
      <image:caption>Western blot testing of human Jurkat lysate with HLA-DPB1 antibody at 0.5ug/ml. Predicted molecular weight ~29 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hltf-antibody-bha17107434</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1d532b4c-664c-46ba-a5fe-48fafd6d95d2.jpg?v=1775785972</image:loc>
      <image:title>HLTF Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with HLTF antibody at 0.5ug/ml. Predicted molecular weight: ~114kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hmg20a-antibody-bha17106359</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b3dea806-2430-4950-9d97-b79516ba3d06.jpg?v=1775785849</image:loc>
      <image:title>HMG20A Antibody</image:title>
      <image:caption>IHC testing of FFPE human spleen (nucleoli staining) with HMG20A antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hmox2-antibody-bha17106657</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9d8b59d8-ef26-432e-a0f6-4ee5cc388ef2.jpg?v=1775785887</image:loc>
      <image:title>HMOX2 Antibody</image:title>
      <image:caption>Western blot testing of K562 cell lysate with HMOX2 antibody at 0.3ug/ml. Predicted molecular weight: ~36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hnf1-beta-antibody-hnf1b-bha17105423</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8b0c8bb8-b6c2-474f-9efd-fbe3032a36da.jpg?v=1775785684</image:loc>
      <image:title>HNF1 beta Antibody / HNF1B</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat kidney, 3) human SW620 lysate with HNF1 beta antibody. Predicted/observed molecular weight ~61 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/homer3-antibody-bha17106267</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2e018701-35bb-4999-aebd-2e9ba7ba310b.jpg?v=1775785834</image:loc>
      <image:title>HOMER3 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain, 3) human U-87MG (glioma), 4) human Jurkat and 5) human HeLa cell lysate with HOMER3 antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa, can be observed at 45-47 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hnrnp-a1-antibody-bha17105921</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d6efbbcf-e613-41ea-ace1-3fcb88d82eb4.jpg?v=1775785784</image:loc>
      <image:title>hnRNP A1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human rectal cancer with hnRNP A1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hnrnp-f-antibody-bha17105939</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bd087d8a-1047-4fb6-ab25-92115ae674cc.jpg?v=1775785782</image:loc>
      <image:title>hnRNP F Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse spleen and 3) human HeLa cell lysate with hnRNP F antibody at 0.5ug/ml. Predicted molecular weight ~46 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hnrnp-l-antibody-bha17105933</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_af7d2b7c-0ea6-457e-a1a4-b2c7eb0ea026.jpg?v=1775785782</image:loc>
      <image:title>hnRNP L Antibody</image:title>
      <image:caption>IHC staining of FFPE human laryngeal squamous cell carcinoma tissue with hnRNP L antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hltf-antibody-smarca3-bha17105856</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0771e31d-3052-476b-bd70-02a660823f30.jpg?v=1775785766</image:loc>
      <image:title>HLTF Antibody / SMARCA3</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A549 cells with HLTF antibody (red) and Alpha Tubulin mAb (green). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hmga1-antibody-bha17107534</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3d371f9c-294e-4f0d-a1b6-842900604d74.jpg?v=1775785988</image:loc>
      <image:title>HMGA1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human placenta with HMGA1 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hoxb1-antibody-c-terminal-region-bha17106247</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_66e4eba2-97b6-43c7-9484-1963639a9db5.jpg?v=1775785830</image:loc>
      <image:title>HOXB1 Antibody (C-Terminal Region)</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) mouse testis and 3) human MCF7 lysate with HOXB1 antibody at 0.5ug/ml. Predicted molecular weight ~32 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hmga2-antibody-bha17107249</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cac59321-4f4c-4ea5-9b1c-124b68541ee5.jpg?v=1775785951</image:loc>
      <image:title>HMGA2 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with HMGA2 antibody at 1ug/ml. Predicted molecular weight ~12kDa but routinely observed at ~18kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hoxb6-antibody-bha17106912</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8a8539bc-c22a-4b60-9824-c9a7948eb5da.jpg?v=1775785915</image:loc>
      <image:title>HOXB6 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate with HOXB6 antibody at 1ug/ml. Predicted molecular weight: ~25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hmgb2-antibody-bha17105758</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a3f0a16d-42f4-44fa-a9d3-11d592be4c41.jpg?v=1775785746</image:loc>
      <image:title>HMGB2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver and 2) human placenta lysate with HMGB2 antibody at 0.5ug/ml. Expected molecular weight ~24 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hoxa5-antibody-bha17106913</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b660ff91-fe92-4c57-94a9-a00b5c30349c.jpg?v=1775785915</image:loc>
      <image:title>HOXA5 Antibody</image:title>
      <image:caption>Western blot testing of human [A], mouse [B] and rat [C] kidney lysates with HOXA5 antibody at 1ug/ml. Predicted molecular weight: ~29 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hoxb13-antibody-bha17107370</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1d357744-9109-46d2-825b-2b20bb4e9249.jpg?v=1775785964</image:loc>
      <image:title>HOXB13 Antibody</image:title>
      <image:caption>Western blot testing of HeLa cell lysate with HOXB13 antibody at 0.1ug/ml. Predicted molecular weight: ~31kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hoxb9-antibody-bha17106380</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_075845b9-39a3-4904-b314-24260aaea109.jpg?v=1775785851</image:loc>
      <image:title>HOXB9 Antibody</image:title>
      <image:caption>Western blot testing of mouse spinal cord lysate with HOXB9 antibody at 0.3ug/ml. Predicted molecular weight: ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hp1-gamma-antibody-cbx3-bha17106744</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d6486a08-e66b-4f6b-8957-110447c82df4.jpg?v=1775785897</image:loc>
      <image:title>HP1 gamma Antibody / CBX3</image:title>
      <image:caption>Western blot testing of A431 lysate with HP1 gamma antibody at 0.3ug/ml. Predicted molecular weight ~21 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hp1-gamma-antibody-cbx3-biotin-conjugate-bha17106745</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_da4d57e8-3bf7-4cbd-8a80-fba8c74c11e5.jpg?v=1775785897</image:loc>
      <image:title>HP1 gamma Antibody / CBX3 (Biotin Conjugate)</image:title>
      <image:caption>Western blot testing of mouse NIH3T3 lysate with biotinylated HP1 gamma antibody at 0.3ug/ml. Predicted molecular weight ~21 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hnrnp-h-antibody-bha17105944</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fa8ba4b3-4962-40dc-af7b-6a3bff74b657.jpg?v=1775785787</image:loc>
      <image:title>hnRNP H Antibody</image:title>
      <image:caption>IHC staining of FFPE human colorectal adenocarcinoma tissue with hnRNP H antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hoxc10-antibody-bha17106926</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3f119331-7e35-4525-9c88-53394f028ed7.jpg?v=1775785916</image:loc>
      <image:title>HOXC10 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 lysate with HOXC10 antibody at 1ug/ml. Expected molecular weight: 38-50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hnrnpa2b1-antibody-bha17106711</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_01e55326-c072-4231-a36a-0dfe2f08d27e.jpg?v=1775785894</image:loc>
      <image:title>HNRNPA2B1 Antibody</image:title>
      <image:caption>Western blot testing of MCF7 lysate with HNRNPA2B1 antibody at 0.3ug/ml. Predicted molecular weight: ~36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hoxd13-antibody-bha17107487</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6d80de25-a3a9-4600-bbf0-f443341185fc.jpg?v=1775785979</image:loc>
      <image:title>HOXD13 Antibody</image:title>
      <image:caption>IHC testing of FFPE human prostate with HOXD13 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hp1-antibody-hp1a-biotin-conjugate-bha17107644</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ce25f0e2-f965-43a1-8ee2-5527f3a20b39.jpg?v=1775785996</image:loc>
      <image:title>HP1 Antibody / HP1A [Biotin Conjugate]</image:title>
      <image:caption>Western blot testing of HeLa lysate with biotinylated HP1 antibody at 0.1ug/ml. Predicted molecular weight ~22kDa. An NAP blocker was used in place of non-fat milk as blocking solution and diluent. (1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hp1-antibody-hp1a-bha17107643</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_48e0b4c5-5b22-479f-8c6e-3edb5898a210.jpg?v=1775785995</image:loc>
      <image:title>HP1 Antibody / HP1A</image:title>
      <image:caption>Western blot testing of HeLa lysate with HP1 antibody at 0.03ug/ml. Predicted molecular weight ~22kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hras-antibody-bha17105968</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_57b3bdc3-374e-4928-8ea9-78bc6dc99bb8.jpg?v=1775785786</image:loc>
      <image:title>HRAS Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain and 3) human A549 lysate with HRAS antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hsd11b2-antibody-hsd11k-bha17105509</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8f6f1d6f-b4f2-49b0-9dda-e567fdc9c63b.jpg?v=1775785704</image:loc>
      <image:title>HSD11B2 Antibody / HSD11K</image:title>
      <image:caption>Western blot testing of 1) rat kidney and 2) human placenta lysate with HSD11B2 antibody. Expected/observed molecular weight ~44 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hrpt2-antibody-bha17105598</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3dd3685e-7882-4df7-8106-64c49ba8bcf7.jpg?v=1775785716</image:loc>
      <image:title>HRPT2 Antibody</image:title>
      <image:caption>Western blot testing of 1) human placenta, 2) HepG2, 3) 293 and 4) HeLa lysate with HRPT2 antibody. Predicted/observed molecular weight ~61 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hprt-antibody-bha17105857</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2e01c358-9889-4afb-8218-caeaac41aa9a.jpg?v=1775785768</image:loc>
      <image:title>HPRT Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain and 3) human HeLa lysate with HPRT antibody at 0.5ug/ml. Predicted/observed molecular weight: ~24 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hsd3b1-antibody-bha17106678</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5e76a883-d734-4f2f-a819-1fece246d01e.jpg?v=1775785889</image:loc>
      <image:title>HSD3B1 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with HSD3B1 antibody at 0.01ug/ml. Predicted molecular weight: ~42 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hps6-antibody-bha17107562</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e057a933-4be8-49d9-a0e6-4ca7c999f354.jpg?v=1775785986</image:loc>
      <image:title>HPS6 Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with HPS6 antibody at 1ug/ml. Predicted molecular weight: ~83kDa, observed here at ~95kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hsp20-antibody-bha17106264</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_decc5d33-d3dd-436b-9944-62f530783f06.jpg?v=1775785836</image:loc>
      <image:title>HSP20 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with HSP20 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hoxa9-antibody-bha17107734</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7ce7b97b-99b9-49bc-9c00-e31dce7345c9.jpg?v=1775786004</image:loc>
      <image:title>HOXA9 Antibody</image:title>
      <image:caption>Western blot testing of mouse spleen lysate with HOXA9 antibody at 2ug/ml. Predicted molecular weight ~30kDa, both bands are blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hsp22-antibody-bha17107597</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_497d35d1-4851-48e3-ac9d-5c4cce357d79.jpg?v=1775785990</image:loc>
      <image:title>HSP22 Antibody</image:title>
      <image:caption>Western blot testing of human muscle lysate with HSP22 antibody at 1ug/ml. Observed molecular weight: 22-27 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hsf4-antibody-bha17105676</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_01039292-2961-4fb7-bd88-1cd3500c6414.jpg?v=1775785731</image:loc>
      <image:title>HSF4 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) MCF7 lysate with HSF4 antibody. Predicted/observed molecular weight ~53 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hsc70-antibody-hspa8-bha17105289</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9ebee522-d3c9-435e-a0d4-e8048b407d71.jpg?v=1775785679</image:loc>
      <image:title>HSC70 Antibody / HSPA8</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with HSC70 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hrh1-antibody-bha17106432</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_99874710-9c00-4ba4-bfd1-c175d0aed373.jpg?v=1775785860</image:loc>
      <image:title>HRH1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human colon with HRH1 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hsd17b4-antibody-bha17106039</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8d0db986-a0b3-4aeb-ba34-31e24bb75fd8.jpg?v=1775785802</image:loc>
      <image:title>HSD17B4 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse liver, 3) mouse heart, 4) mouse testis, 5) human MCF7 and 6) human HeLa lysate at 0.5ug/ml. Predicted molecular weight ~80 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hsp31p-antibody-bha17106981</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_33dea213-6992-417e-bac8-015786a26762.jpg?v=1775785923</image:loc>
      <image:title>Hsp31p Antibody</image:title>
      <image:caption>Western blot testing of yeast lysate (wt) and the KO (delta) in the left panel and the Ponceau stain in the right panel. Hsp31p antibody was used at 0.05ug/ml.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hsp22-antibody-hspb8-bha17106092</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_88b73aaa-202e-43df-a129-44fe8303614e.jpg?v=1775785810</image:loc>
      <image:title>HSP22 Antibody / HSPB8</image:title>
      <image:caption>IHC testing of FFPE human lung cancer tissue with HSP22 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hs3st1-antibody-bha17107637</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_95048d44-63a6-4b55-a5a9-ed51639fae35.jpg?v=1775785996</image:loc>
      <image:title>HS3ST1 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with HS3ST1 antibody at 1ug/ml. Predicted molecular weight: ~36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hsd11b1-antibody-bha17106484</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_38c09024-3810-483b-b943-0b3adf522d98.jpg?v=1775785865</image:loc>
      <image:title>HSD11B1 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with HSD11B1 antibody at 0.3ug/ml. Predicted molecular weight: ~32kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hsp10-antibody-bha17107752</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b2a39f41-1fa2-4ee7-b094-72bf4b281e64.jpg?v=1775786007</image:loc>
      <image:title>HSP10 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 lysate with HSP10 antibody at 0.01ug/ml. Expected molecular weight: ~10kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hrs-antibody-bha17107689</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a5c5a613-2882-4314-8572-c2725941991a.jpg?v=1775786001</image:loc>
      <image:title>HRS Antibody</image:title>
      <image:caption>IHC testing of FFPE human testis with HRS antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hsh2d-antibody-bha17107200</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_67937369-80ac-4a35-9cd5-05e269d29db2.jpg?v=1775785948</image:loc>
      <image:title>HSH2D Antibody</image:title>
      <image:caption>Western blot testing of K562 lysate with HSH2D antibody at 0.3ug/ml. Predicted molecular weight: ~39kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hspe1-antibody-bha17107762</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b9d25a49-647e-46d4-8902-95ac15008d3f.jpg?v=1775786007</image:loc>
      <image:title>HSPE1 Antibody</image:title>
      <image:caption>Western blot testing of A) HeLa and B) HepG2 lysates with HSPE1 antibody at 0.3ug/ml. Expected molecular weight: ~10kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hspa2-antibody-bha17105480</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9743ea39-1cee-4d6e-85bc-8ed2f81add88.jpg?v=1775785696</image:loc>
      <image:title>HSPA2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat thymus, 3) rat testis, 4) mouse liver, 5) mouse kidney, 6) human HeLa, 7) human MCF7 and 8) human A375 and 9) mouse NIH3T3 lysate with HSPA2 antibody. Expected/observed molecular weight ~70 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hsp70-antibody-hspa1a-bha17105280</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_955bc48c-1eee-4282-a304-02ce8d8b8fd7.jpg?v=1775785683</image:loc>
      <image:title>HSP70 Antibody / HSPA1A</image:title>
      <image:caption>Immunofluorescent staining of FFPE human MCF7 cells with HSP70 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hspb2-antibody-bha17105572</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_72884963-0bdd-4ff7-9ae1-d2cf624dfa19.jpg?v=1775785713</image:loc>
      <image:title>HSPB2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat heart and 2) rat muscle lysate with HSPB2 antibody. Predicted/observed molecular weight ~20 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/htr1a-antibody-bha17106941</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9745596b-2013-4ddf-9d44-7af7e2edbf99.jpg?v=1775785918</image:loc>
      <image:title>Htr1a Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with Htr1a antibody at 1ug/ml. Predicted molecular weight: ~46 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hspa13-antibody-bha17106973</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_63700083-46aa-4045-80a7-a113ec05b424.jpg?v=1775785920</image:loc>
      <image:title>HSPA13 Antibody</image:title>
      <image:caption>Western blot testing of human uterus lysate with HSPA13 antibody at 0.1ug/ml. Predicted molecular weight: ~52kDa, routinely observed at ~70kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hspa8-antibody-hsc70-bha17106843</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_92fe47f7-6fd5-48e2-addb-bd580d6cad0e.jpg?v=1775785909</image:loc>
      <image:title>HSPA8 Antibody / HSC70</image:title>
      <image:caption>Western blot testing of A431 cell lysate with HSPA8 antibody at 2ug/ml. Predicted molecular weight: ~71 kDa, routinely observed at 70-73 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hvem-antibody-tnfrsf14-bha17105890</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3b031729-3013-493a-8e42-a5a15535d580.jpg?v=1775785771</image:loc>
      <image:title>HVEM Antibody / TNFRSF14</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) SW620 cell lysate with HVEM antibody at 0.5ug/ml. Expected molecular weight: 30-38 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ibsp-antibody-bha17106228</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2c6eab96-067e-4d71-b190-a52648162172.jpg?v=1775785828</image:loc>
      <image:title>IBSP Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain, 3) human HeLa and 4) human U-2 OS lysate with IBSP antibody at 0.5ug/ml. Expected molecular weight: 35~70 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/hud-antibody-elavl4-bha17105381</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9e4b1d28-8b57-4caa-9f15-221734cedc73.jpg?v=1775785677</image:loc>
      <image:title>HuD Antibody / ELAVL4</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain and 3) human U87 lysate with HuD antibody. Expected/observed molecular weight ~42 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ica1-antibody-islet-cell-autoantigen-1-bha17105526</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5913d4ac-45a2-424c-9c3f-ea592352365f.jpg?v=1775785702</image:loc>
      <image:title>ICA1 Antibody / Islet cell autoantigen 1</image:title>
      <image:caption>Western blot testing of 1) human SH-SY5Y, 2) human RT4, 3) human MCF7, 4) human K562, 5) rat pancreas, 6) rat brain, 7) mouse pancreas and 8) mouse brain tissue lysate with ICA1 antibody. Predicted molecular weight ~55 kDa but can also be observed at 64-69 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/htra3-antibody-bha17106052</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5b6f0dbd-b987-4ab4-8ee7-69071dc81c9b.jpg?v=1775785803</image:loc>
      <image:title>HtrA3 Antibody</image:title>
      <image:caption>Western blot testing of human 1) PANC1 and 2) HepG2 cell lysate with HtrA3 antibody at 0.5ug/ml. Predicted molecular weight ~49 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/iba1-antibody-aif-1-bha17106040</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bf0b897a-b019-46b7-8185-7934a9e5f885.jpg?v=1775785799</image:loc>
      <image:title>IBA1 Antibody / AIF-1</image:title>
      <image:caption>IHC testing of FFPE human spleen tissue with IBA1 antibody. Required HIER: steam section in pH8 EDTA buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/icam5-antibody-intercellular-adhesion-molecule-5-bha17106967</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5a729a13-25ca-47d7-8f0d-5699fb01ab2b.jpg?v=1775785920</image:loc>
      <image:title>ICAM5 Antibody / Intercellular adhesion molecule 5</image:title>
      <image:caption>IHC testing of FFPE human cerebral cortex with ICAM5 antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/idh1-antibody-bha17106902</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e7f9a3c9-7aa3-42c9-810f-421f9774dcfd.jpg?v=1775785913</image:loc>
      <image:title>IDH1 Antibody</image:title>
      <image:caption>Western blot testing of S. cerevisiae S288c lysate with IDH1 antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa. The blocking buffer contained non-animal derived protein.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/idh3a-antibody-bha17106553</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_512f3cc6-6476-4ba4-adbf-0290acd0f242.jpg?v=1775785876</image:loc>
      <image:title>IDH3A Antibody</image:title>
      <image:caption>Western blot of human (A), mouse (B) and rat (C) spleen lysates with IDH3A antibody at 0.1ug/ml. Predicted molecular weight: ~39kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/idh3b-antibody-bha17107096</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c5ae92dc-0779-4d36-9ca1-6dec52a852dd.jpg?v=1775785935</image:loc>
      <image:title>IDH3B Antibody</image:title>
      <image:caption>Western blot testing of human skeletal muscle lysate with IDH3B antibody at 0.3ug/ml. Predicted molecular weight: ~42kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/idh1-antibody-bha17106824</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_50670998-8942-4c64-8b1f-fe8370c2770e.jpg?v=1775785906</image:loc>
      <image:title>IDH1 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 lysate with IDH1 antibody at 0.3ug/ml. Predicted molecular weight ~46 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/idh2-antibody-bha17105455</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_84c2ae66-5b5a-4933-9790-ae264855199a.jpg?v=1775785691</image:loc>
      <image:title>IDH2 Antibody</image:title>
      <image:caption>IHC staining of FFPE mouse heart tissue with IDH2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ido-antibody-bha17106488</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_aad955e0-9b17-45a2-a96f-f407e3d88d1d.jpg?v=1775785866</image:loc>
      <image:title>IDO Antibody</image:title>
      <image:caption>Western blot testing of human lymph node (A), spleen (B) and placenta (C) lysates with IDO antibody at 0.5ug/ml. Predicted molecular weight ~46 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/id2-antibody-inhibitor-of-dna-binding-2-bha17106058</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4ade9aac-83c8-4e53-9dd6-d970893d919c.jpg?v=1775785803</image:loc>
      <image:title>ID2 Antibody / Inhibitor of DNA binding 2</image:title>
      <image:caption>Western blot testing of rat brain lysate with ID2 antibody at 0.5ug/ml. Predicted molecular weight ~15 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/idh1-antibody-bha17107363</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_04a9e4c1-b96a-418f-bfc0-ac44791ecd91.jpg?v=1775785965</image:loc>
      <image:title>IDH1 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 lysate with IDH1 antibody at 0.1ug/ml. Predicted molecular weight ~46 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/idh2-antibody-bha17106402</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_709102de-0530-4296-a6c8-e3c331cf412f.jpg?v=1775785858</image:loc>
      <image:title>IDH2 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with IDH2 antibody at 0.1ug/ml. Predicted molecular weight: 45-51 kDa (two isoforms).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ifnar1-antibody-bha17107791</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_288fcb71-fbe8-4bcf-a25f-e612997d227a.jpg?v=1775786010</image:loc>
      <image:title>IFNAR1 Antibody</image:title>
      <image:caption>Western blot testing of K562 lysate with IFNAR1 antibody at 0.3ug/ml. Expected molecular weight: 64-135 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ift74-antibody-cmg-1-bha17107501</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fa4ce681-3113-4d40-886a-d375cba559b1.jpg?v=1775785980</image:loc>
      <image:title>IFT74 Antibody / CMG-1</image:title>
      <image:caption>Western blot testing of 293 lysate with IFT74 antibody at 0.3ug/ml. Predicted molecular weight: ~69 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/iba1-antibody-isoform-3-bha17107641</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f082e550-c08e-4742-b963-5e6bf86d11f3.jpg?v=1775785996</image:loc>
      <image:title>IBA1 Antibody (isoform 3)</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with IBA1 antibody at 0.5ug/ml. Predicted molecular weight ~17kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ido1-antibody-bha17105318</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ca40a41a-e50c-4dfc-b731-3dad852d5e72.jpg?v=1775785674</image:loc>
      <image:title>IDO1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with IDO1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ids-antibody-bha17107336</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a37820ad-2fbf-4281-845e-0da183245bfa.jpg?v=1775785962</image:loc>
      <image:title>IDS Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with IDS antibody at 0.1ug/ml. Predicted molecular weight: ~62kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igf1r-antibody-igf1-receptor-bha17106110</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ab0d0397-988c-4d27-bd10-f0dbd33e353a.jpg?v=1775785809</image:loc>
      <image:title>IGF1R Antibody / IGF1 Receptor</image:title>
      <image:caption>Western blot testing of mouse liver lysate with IGF1R antibody at 0.5ug/ml. Expected molecular weight (glycosylated): ~200 kDa (pro-form), 130-135 kDa (alpha chain).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igf2-antibody-bha17106993</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3552983a-000c-4ac5-903b-1e9a6ff1f710.jpg?v=1775785923</image:loc>
      <image:title>IGF2 Antibody</image:title>
      <image:caption>IHC testing of FFPE human cerebellum with IGF2 antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/idh3g-antibody-bha17106566</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_be3dfdce-dc4f-4ad9-a44e-5879f1f9a5f8.jpg?v=1775785879</image:loc>
      <image:title>IDH3G Antibody</image:title>
      <image:caption>Western blot testing of MCF7 lysate with IDH3G antibody at 0.5ug/ml. Predicted molecular weight: ~41kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ifngr1-antibody-cd119-bha17105997</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d37274b7-1361-4f88-8014-b8ea50848c4e.jpg?v=1775785790</image:loc>
      <image:title>IFNGR1 Antibody / CD119</image:title>
      <image:caption>Western blot testing of human 1) HepG2 and 2) SKOV3 cell lysate with IFNGR1 antibody at 0.5ug/ml. Predicted molecular weight: ~54 kDa (unmodified), 80-100 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ifnar1-antibody-interferon-alpha-receptor-1-bha17106000</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5432328e-08f9-4534-b284-fff6414c5db6.jpg?v=1775785790</image:loc>
      <image:title>IFNAR1 Antibody / Interferon alpha receptor 1</image:title>
      <image:caption>Western blot testing of human 1) A431, 2) K562 and 3) HEL cell lysate with IFNAR1 antibody at 0.5ug/ml. Expected molecular weight: 64-135 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igf2bp2-antibody-bha17107444</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_04ff6972-591f-4b02-a2f5-c8d16520f55e.jpg?v=1775785976</image:loc>
      <image:title>IGF2BP2 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 cell lysate with IGF2BP2 antibody at 1ug/ml. Predicted molecular weight: ~66kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igfbp5-antibody-bha17105374</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_05b523a8-baaa-4bab-970b-5d4fd718e210.jpg?v=1775785673</image:loc>
      <image:title>IGFBP5 Antibody</image:title>
      <image:caption>Western blot testing of human 1) U20S and 2) HeLa lysate with IGFBP5 antibody. Expected molecular weight: 30 kDa (intact protein), 19-24 kDa (cleavage fragments), 22 kDa (major fragment).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igfbp5-antibody-bha17106206</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7c237599-fdcc-4292-9f38-cd944b6ef0dc.jpg?v=1775785826</image:loc>
      <image:title>IGFBP5 Antibody</image:title>
      <image:caption>Western blot testing of recombinant human protein with IGFBP5 antibody at 0.5ug/ml.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igfbp7-antibody-bha17106825</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a70c18df-57ea-4348-997b-f0d5cb920091.jpg?v=1775785905</image:loc>
      <image:title>IGFBP7 Antibody</image:title>
      <image:caption>Western blot testing of mouse kidney lysate with IGFBP7 antibody at 1ug/ml. Predicted molecular weight: ~29kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igfbp1-antibody-bha17106164</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0729d663-23f9-44c3-9822-39fd078d2d09.jpg?v=1775785818</image:loc>
      <image:title>IGFBP1 Antibody</image:title>
      <image:caption>IHC testing of FFPE mouse liver tissue with IGFBP1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igfbp3-antibody-bha17105339</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_db272329-b603-4167-bd28-2fded1783589.jpg?v=1775785678</image:loc>
      <image:title>IGFBP3 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat heart, 2) rat brain, 3) rat liver, 4) rat PC-12, 5) human U-87 MG, 6) mouse kidney, 7) mouse heart and 8) mouse brain lysate with IGFBP3 antibody. Expected molecular weight: 31-44 kDa depending on level of glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ift88-antibody-bha17107368</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e5f5f069-05cd-42a3-afc0-d79b54775fec.jpg?v=1775785966</image:loc>
      <image:title>IFT88 Antibody</image:title>
      <image:caption>Immunofluorescent staining of fixed and permeabilized human HepG2 cells with ITF88 antibody (green) at 10ug/ml and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igfbp1-antibody-bha17105450</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_564a5509-160c-4963-a92a-159ab771ffba.jpg?v=1775785689</image:loc>
      <image:title>IGFBP1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat kidney and 2) mouse kidney lysate with IGFBP1 antibody. Expected molecular weight: 28-35 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igfbp3-antibody-bha17106130</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_23ab59a8-31f8-4005-ac0d-5ee1507c98c5.jpg?v=1775785811</image:loc>
      <image:title>IGFBP3 Antibody</image:title>
      <image:caption>Western blot testing of rat heart lysate with IGFBP3 antibody at 0.5ug/ml. Expected molecular weight: ~31/40-44 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igfbp2-antibody-bha17105342</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ebdada9f-135e-4f44-b719-d9c2882b3d54.jpg?v=1775785672</image:loc>
      <image:title>IGFBP2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat liver, and 3) human placenta lysate with IGFBP2 antibody. Predicted/observed molecular weight ~35 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igfbp2-antibody-bha17106188</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_17e1f257-eafd-4c33-b433-30ab10524073.jpg?v=1775785823</image:loc>
      <image:title>IGFBP2 Antibody</image:title>
      <image:caption>Western blot testing of human HepG2 cell lysate with IGFBP2 antibody at 0.5ug/ml. Predicted molecular weight ~35 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igfbp1-antibody-bha17105985</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e807f304-3906-4ccb-bd57-14a6ce8da864.jpg?v=1775785789</image:loc>
      <image:title>IGFBP1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human placenta tissue with IGFBP1 antibody. Required HIER: steam section in pH8 EDTA buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igfbp4-antibody-bha17107323</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_473cb61d-8061-4443-a630-df7426afdbd1.jpg?v=1775785959</image:loc>
      <image:title>IGFBP4 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with IGFBP4 antibody at 1ug/ml. Predicted molecular weight: ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ikaros-antibody-ikzf1-bha17105550</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4b9868af-2a4f-4f40-a606-686e95d856fe.jpg?v=1775785711</image:loc>
      <image:title>IKAROS Antibody / IKZF1</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate with IKAROS antibody. Expected molecular weight: ~65/55 kDa (isoforms 1/2). (Ref 1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ikaros-antibody-bha17106616</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_dd876a21-bae3-410a-92d7-e77af835636c.jpg?v=1775785885</image:loc>
      <image:title>IKAROS Antibody</image:title>
      <image:caption>Western blot testing of MOLT4 lysate with IKAROS antibody at 0.03ug/ml. Expected molecular weight: ~65/55kDa (isoforms 1/2). (Ref 1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-17f-antibody-interleukin-17f-bha17106208</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ed832bd5-53d7-443d-aeee-655bd3a98fc5.jpg?v=1775785824</image:loc>
      <image:title>IL-17F Antibody / Interleukin 17F</image:title>
      <image:caption>Western blot testing of rat PC-12 cell lysate with IL-17F antibody at 0.5ug/ml. Predicted molecular weight: ~15 kDa (unmodified monomer), 15-20 kDa (glycosylated monomer), ~30 kDa (homodimer) and 30~40 kDa (glycosylated homodimer).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ikkg-antibody-nemo-bha17105911</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9c0e216b-6ab6-4957-b0c1-7d03d3383db7.jpg?v=1775785777</image:loc>
      <image:title>IKKG Antibody / NEMO</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with IKKG antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/igfbp3-antibody-bha17106129</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_951a8295-d156-4b80-9934-daf58b993ba9.jpg?v=1775785813</image:loc>
      <image:title>IGFBP3 Antibody</image:title>
      <image:caption>Western blot testing of recombinant human protein with IGFBP3 antibody at 0.5ug/ml. Expected molecular weight: ~31/40-44 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-16-antibody-bha17106196</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e4cbb88b-2d4a-4842-a19d-090e2c1b1a47.jpg?v=1775785824</image:loc>
      <image:title>Il-16 Antibody</image:title>
      <image:caption>Western blot testing of recombinant mouse partial protein with Il-16 antibody at 0.5ug/ml.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-17b-antibody-il-20-bha17106276</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3301a149-653a-40be-8db2-4af980fae1a8.jpg?v=1775785835</image:loc>
      <image:title>IL-17B Antibody / IL-20</image:title>
      <image:caption>Western blot testing of 1) rat stomach, 2) human COLO320, 3) human HeLa and 4) human SGC-7901 lysate with IL-17B antibody at 0.5ug/ml. Expected molecular weight: 17-20 kDa depending on glylcosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ikzf1-antibody-bha17106715</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_684cc71b-31bc-4b9c-8692-220c68c0657b.jpg?v=1775785895</image:loc>
      <image:title>IKZF1 Antibody</image:title>
      <image:caption>Western blot testing of MOLT4 lysate with IKZF1 antibody at 1ug/ml. Expected molecular weight: ~65/55kDa (isoforms 1/2). (Ref 1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-13-antibody-bha17106018</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2a7fea2e-11a0-4777-a207-6d52b7a77db7.jpg?v=1775785797</image:loc>
      <image:title>IL-13 Antibody</image:title>
      <image:caption>IHC testing of FFPE human tonsil tissue with IL-13 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-1-beta-antibody-bha17106111</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ede43f0c-536e-46f7-a66c-726a19053712.jpg?v=1775785808</image:loc>
      <image:title>IL-1 beta Antibody</image:title>
      <image:caption>Western blot testing of 1) human COLO320, 2) rat spleen and 3) mouse NIH3T3 lysate with IL-1 beta antibody at 0.5ug/ml. Predicted molecular weight ~31 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-18-antibody-bha17107665</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_89da3362-d078-4426-a50e-e1faa16ac6e9.jpg?v=1775785997</image:loc>
      <image:title>IL-18 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with IL-18 antibody at 0.1ug/ml. Predicted molecular weight ~23kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-25-antibody-il-17e-bha17107123</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_65fb676b-ed1d-4635-b5e0-4abfa694851c.jpg?v=1775785938</image:loc>
      <image:title>IL-25 Antibody / IL-17E</image:title>
      <image:caption>Western blot testing of human prostate lysate with IL-25 antibody at 0.5ug/ml. Predicted molecular weight: ~18 kDa (unmodified), 21-26 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il12-p40-antibody-il-12b-bha17106179</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_97998036-b8dd-40c3-8611-e4ff1b118dc0.jpg?v=1775785820</image:loc>
      <image:title>Il12 p40 Antibody / Il-12b</image:title>
      <image:caption>Western blot testing of rat kidney tissue with Il12 p40 antibody at 0.5ug/ml. Predicted molecular weight 37-40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il12rb1-antibody-cd212-bha17107232</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d1636c6f-3c95-4bf7-977e-cf851b626aa1.jpg?v=1775785950</image:loc>
      <image:title>IL12RB1 Antibody / CD212</image:title>
      <image:caption>Western blot testing of peripheral blood lymphocyte lysate with IL12RB1 antibody at 0.3ug/ml. Predicted molecular weight: ~73/100kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il15-antibody-bha17106508</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_25bf99b5-6fa7-47ea-b293-6ca91bffd925.jpg?v=1775785868</image:loc>
      <image:title>IL15 Antibody</image:title>
      <image:caption>Western blot testing of human bone marrow lysate with IL15 antibody at 1ug/ml. Predicted molecular weight: ~18/23kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il11-antibody-bha17106180</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_15eddad4-a2ce-43e9-8783-fd460474d9e8.jpg?v=1775785820</image:loc>
      <image:title>Il11 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver and 2) rat kidney lysate with Il11 antibody at 0.5ug/ml. Predicted molecular weight: 19-23 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-22-antibody-bha17107134</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_064d177d-7623-4c36-a684-c87758e4ce46.jpg?v=1775785939</image:loc>
      <image:title>IL-22 Antibody</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with IL-22 antibody at 1ug/ml. Observed molecular weight: 19~25 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-33-antibody-bha17106113</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2b19ba37-5bed-4ed6-8b9a-9725685f428a.jpg?v=1775785811</image:loc>
      <image:title>IL-33 Antibody</image:title>
      <image:caption>IHC testing of FFPE human tonsil tissue with IL-33 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-7-antibody-bha17105303</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7f8cee49-4049-4e7c-abd7-fcbf54295c29.jpg?v=1775785678</image:loc>
      <image:title>IL-7 Antibody</image:title>
      <image:caption>Western blot testing of K562 cell lysate with IL-7 antibody. Expected molecular weight: 19-30 kDa depending on glycosylation level, observed here at ~75 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-8-antibody-bha17105281</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b26a2e7f-1a8f-4e1a-92e7-1c85b7b626e5.jpg?v=1775785678</image:loc>
      <image:title>IL-8 Antibody</image:title>
      <image:caption>Western blot testing of HeLa cell lysate with IL-8 antibody. Expected molecular weight: ~8 kDa (monomer), ~16 kDa (dimer), ~32 kDa (oligomer).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il12b-antibody-bha17106754</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1391e8b3-e638-4713-8b59-95cec52157f8.jpg?v=1775785899</image:loc>
      <image:title>Il12b Antibody</image:title>
      <image:caption>Western blot testing of 1) mouse skin and 2) rat skin lysate with Il12b antibody at 0.5ug/ml. Predicted molecular weight: 37~40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-7-antibody-bha17105283</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2bd7887c-41f5-4e55-bc15-d725ee3306ac.jpg?v=1775785676</image:loc>
      <image:title>IL-7 Antibody</image:title>
      <image:caption>IHC staining of FFPE mouse lymph node with IL-7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-22-antibody-bha17106166</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_818d6788-2078-481b-8408-6329f8a6e5e4.jpg?v=1775785818</image:loc>
      <image:title>IL-22 Antibody</image:title>
      <image:caption>Western blot testing of 1) human HeLa, 2) human placenta, 3) rat thymus and 4) mouse thymus lysate with IL-22 antibody at 0.5ug/ml. Observed molecular weight: 19~25 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il13ra2-antibody-bha17106618</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e7cee849-8401-472c-88eb-83e131da8b9e.jpg?v=1775785881</image:loc>
      <image:title>IL13RA2 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with IL13RA2 antibody at 1ug/ml. Predicted molecular weight: ~44/60kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il12-p40-antibody-bha17106178</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1c812c62-2a0c-4742-bb95-e2b8162856cc.jpg?v=1775785820</image:loc>
      <image:title>Il12 p40 Antibody</image:title>
      <image:caption>Western blot testing of mouse kidney tissue with Il12 p40 antibody at 0.5ug/ml. Predicted molecular weight 37-40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-36-alpha-antibody-il-1f6-bha17106272</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c072e60f-b9e3-4f48-9036-9cd539f0e4b1.jpg?v=1775785836</image:loc>
      <image:title>IL-36 alpha Antibody / IL-1F6</image:title>
      <image:caption>Western blot testing of 1) human Jurkat, 2) human K562, 3) human Raji, 4) rat thymus and 5) mouse thymus lysate with IL-36 alpha antibody at 0.5ug/ml. Predicted molecular weight ~17 kDa, routinely observed at 18-22 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il17ra-antibody-bha17106661</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0a595ad6-c5b6-46fd-b362-e032cd364073.jpg?v=1775785886</image:loc>
      <image:title>IL17ra Antibody</image:title>
      <image:caption>Western blot testing of rat kidney lysate with IL17ra antibody at 1ug/ml. Predicted molecular weight ~97 kDa but can be observed at a larger size due to glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il22-antibody-bha17106830</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bd1eb067-6bd6-493a-82a5-d4fc7fc6ea90.jpg?v=1775785908</image:loc>
      <image:title>IL22 Antibody</image:title>
      <image:caption>Western blot testing of human adipose lysate with IL22 antibody at 0.3ug/ml. Observed molecular weight: 19~25kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il17ra-antibody-bha17106186</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9e375de1-b146-4fbf-95fe-b59ed8c745be.jpg?v=1775785821</image:loc>
      <image:title>IL17RA Antibody</image:title>
      <image:caption>Western blot testing of human 1) Jurkat and 2) MOLT4 cell lysate with IL17RA antibody at 0.5ug/ml. Predicted molecular weight ~97 kDa but can be observed at higher molecular weights due to glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il-33-antibody-bha17106114</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5825b9fa-b5f3-46b7-9fec-e583d17a6900.jpg?v=1775785811</image:loc>
      <image:title>IL-33 Antibody</image:title>
      <image:caption>Western blot testing of 1) mouse spleen and 2) rat NRK cell lysate with IL-33 antibody at 0.5ug/ml. Predicted molecular weight ~31 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il33-antibody-bha17106969</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cf1734ba-81b9-4c83-9f36-9647063b4ea6.jpg?v=1775785920</image:loc>
      <image:title>IL33 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with IL33 antibody at 1ug/ml. Predicted molecular weight: ~31/26/16kDa (isoforms a/b/c).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ilf2-antibody-interleukin-enhancer-binding-factor-2-bha17106829</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ab0662f8-8701-419a-afd4-f2c5f9724f17.jpg?v=1775785906</image:loc>
      <image:title>ILF2 Antibody / Interleukin enhancer-binding factor 2</image:title>
      <image:caption>Western blot testing of human tonsil lysate with ILF2 antibody at 0.03ug/ml. Expected molecular weight: 43-45 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il15ra-antibody-bha17106225</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d4622e0c-6a8a-4904-bfa3-4f37fc4575d2.jpg?v=1775785830</image:loc>
      <image:title>IL15RA Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human K562 cells with IL15RA antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il1b-antibody-bha17106112</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_756b1e2a-eb88-41b9-bc56-dc1b72ff3c72.jpg?v=1775785809</image:loc>
      <image:title>IL1B Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse spleen lysate with IL1B antibody at 0.5ug/ml. Predicted molecular weight ~31 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il17f-antibody-interleukin-17f-bha17106209</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_adb872c2-adb8-4616-ab63-2f3499d49ba5.jpg?v=1775785828</image:loc>
      <image:title>IL17F Antibody / Interleukin 17F</image:title>
      <image:caption>Western blot testing of mouse 1) spleen, 2) thymus, 3) NIH3T3 and 4) SP20 lysate with IL17F antibody at 0.5ug/ml. Predicted molecular weight: ~15 kDa (unmodified monomer), 15-20 kDa (glycosylated monomer), ~30 kDa (homodimer) and 30~40 kDa (glycosylated homodimer).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il1f10-antibody-il-38-bha17106269</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c9b2012e-f40b-43d6-ada6-33e7de1d9274.jpg?v=1775785837</image:loc>
      <image:title>IL1F10 Antibody / IL-38</image:title>
      <image:caption>Western blot testing of human 1) U-87 MG and 2) placenta lysate with IL1F10 antibody at 0.5ug/ml. Predicted molecular weight ~17 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il6r-antibody-c-terminal-region-bha17106192</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2b178450-d86f-434a-9a13-c513de459c5b.jpg?v=1775785822</image:loc>
      <image:title>IL6R Antibody (C-Terminal Region)</image:title>
      <image:caption>Western blot testing of human A549 cell lysate with IL6R antibody at 0.5ug/ml. Predicted molecular weight ~52 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il23r-antibody-il-23-receptor-bha17106140</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_047d53a7-8abf-4b8d-83c6-7f78b5a94f67.jpg?v=1775785814</image:loc>
      <image:title>Il23r Antibody / Il-23 receptor</image:title>
      <image:caption>Western blot testing of mouse 1) brain, 2) liver and 3) kidney lysate with Il23r antibody at 0.5ug/ml. Expected molecular weight ~72 kDa, observed here at ~58 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il7r-antibody-cd127-bha17105706</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a3acb433-8a7c-4a50-b0bf-3ca6c41904c4.jpg?v=1775785737</image:loc>
      <image:title>IL7R Antibody / CD127</image:title>
      <image:caption>Western blot testing of human 22RV1 cell lysate with IL7R antibody. Predicted molecular weight: ~51/60-90 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il2rb-antibody-bha17105329</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0ed8f06a-a2d0-4605-a420-d1174193ce54.jpg?v=1775785673</image:loc>
      <image:title>IL2RB Antibody</image:title>
      <image:caption>Western blot testing of mouse 1) lung, 2) spleen, 3) testis lysate with IL2RB antibody. Expected molecular weight ~61 kDa (unmodified), 70-75 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il33-antibody-bha17106284</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fa4ac4a0-a74f-4043-b1e2-846c442963cf.jpg?v=1775785839</image:loc>
      <image:title>Il33 Antibody</image:title>
      <image:caption>IHC testing of FFPE mouse spleen tissue with Il33 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ing1-antibody-bha17105675</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b642cb3c-2a83-48b9-a7da-4e93c221165a.jpg?v=1775785731</image:loc>
      <image:title>ING1 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) A549 cell lysate with ING1 antibody. Expected/observed molecular weight ~47 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il6-antibody-bha17106283</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5573ec25-95bd-4218-8c1e-c6a01aca7579.jpg?v=1775785838</image:loc>
      <image:title>Il6 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat heart and 2) mouse heart tissue lysate with Il6 antibody at 0.5ug/ml. Predicted molecular weight ~24 kDa but may be observed at higher molecular weights due to glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il7r-antibody-bha17106512</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_db422b3a-21c6-46ad-9d68-d09960283e53.jpg?v=1775785869</image:loc>
      <image:title>IL7R Antibody</image:title>
      <image:caption>Western blot testing of NIH3T3 lysate with IL7R antibody at 2ug/ml. Predicted molecular weight: ~51/60-90kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il22-antibody-bha17106165</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_786fcf5c-cc80-4698-a410-26fe571e9b58.jpg?v=1775785818</image:loc>
      <image:title>IL22 Antibody</image:title>
      <image:caption>IHC staining of FFPE human spleen tissue with IL22 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ing2-antibody-inhibitor-of-growth-protein-2-bha17106598</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_71b3fdda-dbec-4739-98b5-f977c3e7a0eb.jpg?v=1775785880</image:loc>
      <image:title>ING2 Antibody / Inhibitor of growth protein 2</image:title>
      <image:caption>Western blot testing of HepG2 lysate with ING2 antibody at 2ug/ml. Predicted molecular weight: ~33kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/inca-antibody-bha17107617</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f7bbef32-bbb7-407c-949b-2feda27f79d4.jpg?v=1775785993</image:loc>
      <image:title>INCA Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with INCA antibody at 0.5ug/ml. Predicted molecular weight: ~12kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/il1ra-antibody-interleukin-1-receptor-antagonist-il1rn-bha17106144</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3e6aa9f0-f3a1-4416-9527-c3f8fab43c00.jpg?v=1775785817</image:loc>
      <image:title>IL1RA Antibody / Interleukin-1 Receptor Antagonist / IL1RN</image:title>
      <image:caption>IHC staining of FFPE human esophageal squamous carcinoma tissue with IL1RA antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/impdh2-antibody-bha17107292</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3a8cf035-9cfa-492c-974b-aaca70fa1128.jpg?v=1775785957</image:loc>
      <image:title>IMPDH2 Antibody</image:title>
      <image:caption>Western blot testing of human skeletal muscle lysate with IMPDH2 antibody at 1ug/ml. Predicted molecular weight: ~56kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/inos-antibody-nos2-bha17106019</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_49fd608d-cff6-49bc-a038-fd37b6565ac6.jpg?v=1775785796</image:loc>
      <image:title>iNOS Antibody / NOS2</image:title>
      <image:caption>IHC staining of FFPE human brain tissue with iNOS antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/insulin-receptor-antibody-insr-bha17105858</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6d41350e-bbb1-4f28-8128-7794f6403fe0.jpg?v=1775785765</image:loc>
      <image:title>Insulin Receptor Antibody / INSR</image:title>
      <image:caption>Western blot testing of 1) rat kidney and 2) human HepG2 lysate with Insulin Receptor antibody at 0.5ug/ml. Predicted/observed molecular weight: ~156 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/integrin-alpha-4-antibody-itga4-bha17105309</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_226cd5d9-5924-4935-9fb8-0e85b37b0776.jpg?v=1775785674</image:loc>
      <image:title>Integrin alpha 4 Antibody / ITGA4</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat kidney, human 3) Jurkat, 4) 22RV1, 5) HepG2, 6) SMMC lysate with Integrin alpha 4 antibody. Predicted molecular weight ~115 kDa, routinely observed at ~150 kDa; observed here at ~220 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/integrin-alpha-1-antibody-bha17106590</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d2db1503-2670-4b09-88db-a5fb64fc4b5b.jpg?v=1775785881</image:loc>
      <image:title>Integrin alpha 1 Antibody</image:title>
      <image:caption>Western blot testing of HeLa [A] and HepG2 [B] lysates with Integrin alpha 1 antibody at 0.5ug/ml. Predicted molecular weight: ~131/150+ kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/integrin-linked-kinase-antibody-ilk-bha17105726</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9ab3dc62-80ae-48ee-9f35-3dd19056c55a.jpg?v=1775785739</image:loc>
      <image:title>Integrin linked kinase Antibody / ILK</image:title>
      <image:caption>Western blot testing of 1) rat lung, 2) mouse liver and 3) human HeLa lysate with Integrin linked kinase antibody. Expected molecular weight: 51-59 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/interleukin-17f-antibody-il-17f-bha17106210</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_709e8097-843c-4896-825c-6f45ebd91aa6.jpg?v=1775785825</image:loc>
      <image:title>Interleukin 17F Antibody / IL-17F</image:title>
      <image:caption>Western blot testing of rat spleen lysate with Interleukin 17F antibody at 0.5ug/ml. Predicted molecular weight: ~15 kDa (unmodified monomer), 15-20 kDa (glycosylated monomer), ~30 kDa (homodimer) and 30~40 kDa (glycosylated homodimer).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/iqgap1-antibody-bha17107473</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e79faf90-eb06-4ddd-b2c6-d40771ed6c2b.jpg?v=1775785977</image:loc>
      <image:title>IQGAP1 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with IQGAP1 antibody at 1ug/ml. Predicted molecular weight ~189 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ip10-antibody-cxcl10-bha17105336</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_19fbfc0e-297d-47d6-bc1f-23dc5b846742.jpg?v=1775785674</image:loc>
      <image:title>IP10 Antibody / CXCL10</image:title>
      <image:caption>IHC staining of FFPE mouse spleen tissue with IP10 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/interleukin-2-antibody-bha17106045</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4d952d69-4a57-406d-b45c-d9116a6aa0c3.jpg?v=1775785802</image:loc>
      <image:title>Interleukin-2 Antibody</image:title>
      <image:caption>IHC staining of FFPE human spleen tissue with Interleukin-2 antibody, HRP-labeled secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ip3kc-antibody-bha17106979</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7977537d-e80b-4736-9fb0-bfc5b6052a9d.jpg?v=1775785923</image:loc>
      <image:title>IP3KC Antibody</image:title>
      <image:caption>Western blot testing of human pancreas lysate with IP3KC antibody at 1ug/ml. Predicted/observed molecular weight: ~75kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ip6k3-antibody-ihpk3-bha17107308</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_68354677-7939-445d-9e4f-2b80a5c8c094.jpg?v=1775785961</image:loc>
      <image:title>IP6K3 Antibody / IHPK3</image:title>
      <image:caption>Western blot testing of human kidney lysate with IP6K3 antibody at 1ug/ml. Predicted/observed molecular weight: ~46kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/irf2-antibody-bha17107507</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f1b85018-67b9-4b7c-a187-78a93e61afa0.jpg?v=1775785980</image:loc>
      <image:title>IRF2 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with IRF2 antibody at 2ug/ml. Estimated molecular weight: ~39kDa but routinely observed at 39-50kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ire1-antibody-bha17107809</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c24ea9eb-1d93-4455-a434-9d151b74f4e3.jpg?v=1775786011</image:loc>
      <image:title>IRE1 Antibody</image:title>
      <image:caption>Western blot testing of human pancreas lysate with IRE1 antibody at 0.03ug/ml. Predicted molecular weight ~110kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/irak3-antibody-bha17107052</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7d443f63-2898-4938-aa09-f36e5b3ba164.jpg?v=1775785930</image:loc>
      <image:title>IRAK3 Antibody</image:title>
      <image:caption>Western blot testing of rat liver lysate with IRAK3 antibody at 0.05ug/ml. Predicted molecular weight: ~68kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/irf2-antibody-bha17105314</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5a9900ff-a08c-4785-b5cb-baa65f8c51c2.jpg?v=1775785680</image:loc>
      <image:title>IRF2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat intestine and human 2) SW620, 3) COLO320, 4) HeLa and 5) A549 lysate with IRF2 antibody. Estimated molecular weight: ~39 kDa but routinely observed at 39-50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/irf9-antibody-interferon-regulatory-factor-9-bha17105936</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9ceda986-842b-4445-a361-0d46b5b718ee.jpg?v=1775785783</image:loc>
      <image:title>IRF9 Antibody / Interferon regulatory factor 9</image:title>
      <image:caption>IHC staining of FFPE human breast cancer tissue with IRF9 antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/isg15-antibody-bha17105718</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_223cfd90-7ae8-4786-97ad-8b82dec81fd9.jpg?v=1775785738</image:loc>
      <image:title>ISG15 Antibody</image:title>
      <image:caption>Western blot testing of human 1) 22RV1 and 2) HeLa cell lysate with ISG15 antibody. Expected molecular weight: 15-17 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/itch-antibody-aif4-bha17105637</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b94a7be7-9c2e-4093-9309-6cd9918283a6.jpg?v=1775785726</image:loc>
      <image:title>ITCH Antibody / AIF4</image:title>
      <image:caption>Flow cytometry testing of fixed and permeabilized human SiHa cells with ITCH antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ITCH antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/isl1-antibody-islet-1-bha17106047</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ad1fd425-8802-483e-a66c-5cc2d825929e.jpg?v=1775785801</image:loc>
      <image:title>ISL1 Antibody / Islet 1</image:title>
      <image:caption>Western blot testing of 1) rat PC12 and 2) human MCF7 lysate with ISL1 antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/irs4-antibody-bha17106677</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_efdcaa21-12ff-45a7-bc4d-97f245fff8b8.jpg?v=1775785889</image:loc>
      <image:title>Irs4 Antibody</image:title>
      <image:caption>Western blot testing of mouse heart lysate with Irs4 antibody at 0.2ug/ml. The expected ~150kDa band and the additional ~39kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/irf4-antibody-bha17107141</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a13c0874-08db-4d7c-afcb-7225697da89b.jpg?v=1775785942</image:loc>
      <image:title>IRF4 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with IRF4 antibody at 0.5ug/ml. Predicted molecular weight: 51 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/isg15-antibody-bha17105696</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3cd66c94-0e39-465f-a771-a207f4d8fb19.jpg?v=1775785738</image:loc>
      <image:title>Isg15 Antibody</image:title>
      <image:caption>Western blot testing of mouse 1) intestine and 2) spleen lysate with Isg15 antibody. Expected molecular weight: 15-17 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/irf5-antibody-bha17105554</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_53c59b96-b966-4150-a9d8-8cf94da15841.jpg?v=1775785711</image:loc>
      <image:title>IRF5 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat intestine, 2) human HeLa, 3) human COLO320, 4) mouse NIH3T3 and 5) mouse HEPA1-6 lysate with IRF5 antibody. Expected/observed molecular weight ~57 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/jab1-antibody-jun-activation-domain-binding-protein-1-cops5-bha17105627</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e676fa11-f730-4a47-8045-49f1f9f1e28f.jpg?v=1775785726</image:loc>
      <image:title>JAB1 Antibody / Jun activation domain-binding protein 1 / COPS5</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with JAB1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/itk-antibody-il2-inducible-t-cell-kinase-bha17107304</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d1b69b70-a6f1-4b59-ac9f-a1f79e1c1521.jpg?v=1775785959</image:loc>
      <image:title>ITK Antibody / IL2-inducible T-cell kinase</image:title>
      <image:caption>Western blot testing of rat thymus lysate with ITK antibody at 0.3ug/ml. Predicted molecular weight: ~72kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/itch-antibody-bha17106819</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cf2d9e5d-c91f-437b-bbbc-8cd361cfaa54.jpg?v=1775785904</image:loc>
      <image:title>ITCH Antibody</image:title>
      <image:caption>Western blot testing of human brain (frontal cortex) lysate with ITCH antibody at 0.1ug/ml. Predicted molecular weight: ~99 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/itih4-antibody-bha17107420</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_68247b17-7aff-4ccf-8955-f237281aae84.jpg?v=1775785972</image:loc>
      <image:title>Itih4 Antibody</image:title>
      <image:caption>Western blot testing of rat liver lysate with Itih4 antibody at 0.03ug/ml. Predicted molecular weight: ~103/150kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/itpr3-antibody-bha17105562</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_643aa099-77ca-4eae-a346-9ea86b249cb4.jpg?v=1775785713</image:loc>
      <image:title>ITPR3 Antibody</image:title>
      <image:caption>Western blot testing of 1) human HeLa and 2) SW620 lysate with ITPR3 antibody. Predicted molecular weight ~300 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/jak1-antibody-bha17106010</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c6bbe85c-5f3f-4504-b612-5c317044a0bd.jpg?v=1775785792</image:loc>
      <image:title>JAK1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat kidney, 2) mouse kidney and 3) human HeLa lysate with JAK1 antibody at 0.5ug/ml. Predicted molecular weight ~133 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/irak4-antibody-bha17107638</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5c832d96-bca9-4dcf-a504-c438bb533f27.jpg?v=1775785996</image:loc>
      <image:title>IRAK4 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with IRAK4 antibody at 1ug/ml. Predicted molecular weight: ~52 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/itih4-antibody-bha17106942</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ccd32e2e-b43f-43c4-bca4-5398f6f829e1.jpg?v=1775785917</image:loc>
      <image:title>ITIH4 Antibody</image:title>
      <image:caption>IHC testing of FFPE human liver with ITIH4 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/jik-antibody-bha17106397</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c6926997-8f5e-4e5d-aa74-30259abdc385.jpg?v=1775785854</image:loc>
      <image:title>JIK Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with JIK antibody at 0.1ug/ml. Predicted molecular weight: ~105kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/jund-antibody-bha17106450</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_656562c3-d5a4-4768-8443-bd3f52ab26a7.jpg?v=1775785862</image:loc>
      <image:title>JUND Antibody</image:title>
      <image:caption>Western blot testing of NIH3T3 nuclear lysate with JUND antibody at 1ug/ml. Predicted molecular weight: ~39/34kDa (JUND-L/JUND-S). (2)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/itln1-antibody-intelectin-1-bha17105760</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_993bc8c3-96df-4647-aa04-952a0a31b61f.jpg?v=1775785746</image:loc>
      <image:title>ITLN1 Antibody / Intelectin-1</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with ITLN1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/jnk2-antibody-alpha-beta-bha17105447</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_25176fd0-0dfb-4680-b8d0-0ec883a1fbb2.jpg?v=1775785688</image:loc>
      <image:title>JNK2 Antibody (alpha/beta)</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) COLO320 cell lysate with JNK2 antibody. Expected/observed molecular weight ~48 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kallikrein-6-antibody-bha17107298</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a6c13996-b885-4e4d-9213-247b8e044e19.jpg?v=1775785957</image:loc>
      <image:title>Kallikrein 6 Antibody</image:title>
      <image:caption>Western blot testing of mouse liver lysate with Kallikrein 6 antibody at 2ug/ml with [B] and without [A] blocking/immunizing peptide. Predicted molecular weight: ~27kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/itm2b-antibody-bha17107109</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f6ee5f01-6809-43b7-aa32-815cb1de2b70.jpg?v=1775785937</image:loc>
      <image:title>ITM2B Antibody</image:title>
      <image:caption>Western blot testing of human hippocampus lysate with ITM2B antibody at 1ug/ml. Predicted molecular weight: ~30 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/jnk2-alpha-antibody-bha17106879</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a9c0f294-645a-4c90-b93a-d17df5b138ce.jpg?v=1775785912</image:loc>
      <image:title>JNK2 alpha Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with JNK2 alpha antibody at 0.03ug/ml. Predicted molecular weight: ~48kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/jip3-antibody-bha17107567</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0feccc90-ca88-48f3-b2ed-61bc12d0dd22.jpg?v=1775785986</image:loc>
      <image:title>JIP3 Antibody</image:title>
      <image:caption>IHC testing of FFPE mouse brain with JIP3 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kchip2-antibody-bha17105664</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1f33d132-2269-4b85-adf7-4633ec38ece0.jpg?v=1775785731</image:loc>
      <image:title>KChIP2 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human SH-SY5Y cells with KChIP2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kcna3-antibody-kv1-3-bha17105359</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_13c2c1fc-d764-4828-970a-90bf9f8b962d.jpg?v=1775785675</image:loc>
      <image:title>KCNA3 Antibody / Kv1.3</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain, human 3) K562, 4) HeLa and 5) 22RV1 lysate with KCNA3 antibody. Expected molecular weight ~64 kDa, observed here at ~55 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kcnc3-antibody-bha17107423</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7b1684db-e757-4a97-b292-765c5a766ca4.jpg?v=1775785973</image:loc>
      <image:title>KCNC3 Antibody</image:title>
      <image:caption>Western blot testing of human brain frontal cortex lysate with KCNC3 antibody at 0.3ug/ml. Predicted molecular weight: ~80kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/jnk2-beta-antibody-bha17106883</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5db164f1-e9b6-4c1f-90df-c44f9b74ed80.jpg?v=1775785912</image:loc>
      <image:title>JNK2 beta Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with JNK2 beta antibody at 0.5ug/ml. Predicted molecular weight: ~48kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kappa-opioid-receptor-antibody-bha17107731</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_32729f91-adf7-46ae-ada1-564634a6298c.jpg?v=1775786004</image:loc>
      <image:title>Kappa opioid receptor Antibody</image:title>
      <image:caption>Western blot testing of human cerebral cortex lysate with Kappa opioid receptor antibody at 1ug/ml. Predicted molecular weight: ~43kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kctd11-antibody-bha17107760</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a053ef87-a65c-4572-bb94-c5df011d1b37.jpg?v=1775786007</image:loc>
      <image:title>KCTD11 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing human KCTD11-FLAG with KCTD11 antibody (1ug/ml) in lane A and anti-FLAG (1/5000) in lane C. Mock-transfected HEK293 probed with KCTD11 Ab (1ug/ml) in lane B. Predicted molecular weight: ~26/30kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kcnj1-antibody-bha17106664</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7054f91b-dc0f-47d3-8a36-8c1171906be2.jpg?v=1775785887</image:loc>
      <image:title>KCNJ1 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with KCNJ1 antibody at 1ug/ml. Predicted molecular weight: ~45 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kcna5-antibody-kv1-5-bha17105366</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_83ebd32a-a13e-45a1-a5f4-77f4802f2c6f.jpg?v=1775785678</image:loc>
      <image:title>KCNA5 Antibody / Kv1.5</image:title>
      <image:caption>Western blot testing of human 1) 293, 2) A549 and 3) PANC cell lysate with KCNA5 antibody. Expected/observed molecular weight ~67 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kcnc3-antibody-bha17107140</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2cf12b32-ec43-4b46-b945-0f9bda3c9ec2.jpg?v=1775785939</image:loc>
      <image:title>KCNC3 Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with KCNC3 antibody at 0.3ug/ml. Predicted molecular weight: ~80kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kcnq1-antibody-bha17105899</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_622f6a18-6018-4455-be40-a3bfcc43f17b.jpg?v=1775785776</image:loc>
      <image:title>KCNQ1 Antibody</image:title>
      <image:caption>IHC staining of FFPE human lung cancer tissue with KCNQ1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kcnq1-antibody-bha17106921</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9caca3e0-253a-4297-b36c-9dc5a2f1a976.jpg?v=1775785918</image:loc>
      <image:title>KCNQ1 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with KCNQ1 antibody at 1ug/ml. Predicted molecular weight ~75/61 kDa (isoforms). Both observed bands are blocked by addition of the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kdm2b-antibody-bha17107018</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_610a5c9f-f773-48a0-894e-c312870c5c82.jpg?v=1775785926</image:loc>
      <image:title>KDM2B Antibody</image:title>
      <image:caption>IHC testing of FFPE human skin tissue with KDM2B antibody at 5ug/ml. HIER: steamed antigen retrieval with pH6 citrate buffer; AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kcnn2-antibody-bha17106974</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3c12b61b-6948-4b71-a3f3-8c332bf29075.jpg?v=1775785922</image:loc>
      <image:title>KCNN2 Antibody</image:title>
      <image:caption>IHC staining of FFPE human thyroid gland with KCNN2 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kdr-antibody-kinase-insert-domain-receptor-vegfr2-bha17105425</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1c339634-55b0-4460-9d3b-886892464541.jpg?v=1775785684</image:loc>
      <image:title>KDR Antibody / Kinase Insert Domain Receptor / VEGFR2</image:title>
      <image:caption>Western blot testing of human MCF7 cell lysate with KDR antibody. Predicted molecular weight: ~152 (immature), 180-200 kDa (intermediate) and 220-230 kDa (mature).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/keratin-19-antibody-bha17106805</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a84ea178-3fef-4693-aeb3-285c5d4b1b4d.jpg?v=1775785903</image:loc>
      <image:title>Keratin 19 Antibody</image:title>
      <image:caption>Western blot testing of human breast cancer lysate with Keratin 19 antibody at 0.1ug/ml. Predicted/observed molecular weight ~43/40-43kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/keap1-antibody-bha17105558</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_51d4ac76-fac9-4854-b0a9-15679f94bf7e.jpg?v=1775785711</image:loc>
      <image:title>KEAP1 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) MCF7 and 3) SW620 lysate wtih KEAP1 antibody. Expected/observed molecular weight ~70 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kap1-antibody-bha17107439</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f788163d-02f2-43cb-8128-9d6783c87cee.jpg?v=1775785973</image:loc>
      <image:title>KAP1 Antibody</image:title>
      <image:caption>Western blot testing HeLa nuclear lysate with KAP1 antibody at 1ug/ml. Observed molecular weight: 88~110kDa depending on sumoylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kcnq4-antibody-bha17106589</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_afe729c2-31f0-47b9-8ed1-ffa31b4600f8.jpg?v=1775785880</image:loc>
      <image:title>KCNQ4 Antibody</image:title>
      <image:caption>Western blot testing of cerebellum lysate with KCNQ4 antibody at 2ug/ml. Predicted molecular weight: ~71kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/keap1-antibody-bha17107005</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7299d377-fd36-4221-972d-a40cfb33d24a.jpg?v=1775785925</image:loc>
      <image:title>KEAP1 Antibody</image:title>
      <image:caption>Western blot testing of NIH3T3 lysate with KEAP1 antibody at 0.2ug/ml. Predicted molecular weight ~70 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kdm5b-antibody-jarid1b-bha17105859</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e36ea2cd-aa6c-427a-8680-df0552dbcc71.jpg?v=1775785769</image:loc>
      <image:title>KDM5B Antibody / Jarid1B</image:title>
      <image:caption>IHC staining of FFPE human breast cancer tissue with KDM5B antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kim1-antibody-havcr1-bha17105635</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_121e4166-dbb2-480c-b472-48398baea86d.jpg?v=1775785726</image:loc>
      <image:title>KIM1 Antibody / HAVCR1</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) PANC, 3) HepG2 and 4) A549 cell lysate with KIM1 antibody. Predicted molecular weight~39 kDa, routinely observed at ~55 kDa (Ref 1), and a heavily glycosylated mature form at ~100 kDa (Ref 2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/keratin-18-antibody-bha17106781</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5ddf5cfe-fcc1-4033-98fd-3f979aa468e0.jpg?v=1775785900</image:loc>
      <image:title>Keratin 18 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with Keratin 18 antibody at 0.1ug/ml. Predicted molecular weight: ~48kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kindlin-3-antibody-urp2-bha17106932</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_df2f7c03-fd84-4017-a011-2beb4477d222.jpg?v=1775785917</image:loc>
      <image:title>Kindlin-3 Antibody / URP2</image:title>
      <image:caption>Western blot testing of human peripheral blood mononucleocyte lysate with Kindlin-3 antibody at 1ug/ml. Predicted molecular weight: ~75kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kif3a-antibody-bha17105687</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_be1df685-4096-47f3-84c4-93321b73b999.jpg?v=1775785733</image:loc>
      <image:title>KIF3A Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat testis, 3) mouse brain, 4) mouse testis, 5) human MCF7 lysate with KIF3A antibody. Expected/observed molecular weight ~80 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/klf4-antibody-bha17106363</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4a1f9876-bb82-45c2-a1ff-91211b48b0cd.jpg?v=1775785850</image:loc>
      <image:title>KLF4 Antibody</image:title>
      <image:caption>Western blot testing of human duodenum lysate with KLF4 antibody at 0.1ug/ml. Predicted molecular weight: 50-60 kDa + possible ~75 kDa (phosphorylated form).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/klf3-antibody-bha17107553</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0be64977-f40f-4674-8d21-aaf2a4b26f89.jpg?v=1775785983</image:loc>
      <image:title>KLF3 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with KLF3 antibody at 1ug/ml. Predicted molecular weight: ~40kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/klf2-antibody-bha17106322</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1e9f53a9-bcd2-4537-82b3-7e6e17554bb2.jpg?v=1775785843</image:loc>
      <image:title>KLF2 Antibody</image:title>
      <image:caption>Western blot testing of human heart [A] and lung [B] lysates with KLF2 antibody at 1ug/ml. Predicted molecular weight ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/klf16-antibody-bha17107726</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_484759a4-c1cd-437c-8247-2d50ae669e1f.jpg?v=1775786005</image:loc>
      <image:title>KLF16 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with KLF16 antibody at 0.3ug/ml. Predicted molecular weight: ~25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kir6-2-antibody-bha17106298</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3f4f8094-b369-41c3-b976-8fbbeee405c6.jpg?v=1775785839</image:loc>
      <image:title>KIR6.2 Antibody</image:title>
      <image:caption>Western blot testing of human muscle lysate with KIR6.2 antibody at 0.1ug/ml. Predicted molecular weight: ~44kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kit-antibody-bha17107454</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_daaf23db-ad4c-4ed8-9c2a-23a3bfb51a3a.jpg?v=1775785974</image:loc>
      <image:title>KIT Antibody</image:title>
      <image:caption>Western blot testing of human hippocampus lysate with KIT antibody at 1ug/ml. Observed molecular weight: ~120/145kDa (precusor/mature). Both observed bands are blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/klk2-antibody-bha17107340</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7647281c-c353-413f-9501-7a27644468c7.jpg?v=1775785964</image:loc>
      <image:title>KLK2 Antibody</image:title>
      <image:caption>Western blot testing of human prostate lysate with KLK2 antibody at 0.1ug/ml. Predicted molecular weight: ~25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/klk5-antibody-bha17107252</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_431baa06-2a19-435d-9e09-202459373238.jpg?v=1775785952</image:loc>
      <image:title>KLK5 Antibody</image:title>
      <image:caption>Western blot testing of human prostate lysate with KLK5 antibody at 0.1ug/ml. Predicted molecular weight: ~32kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/klotho-antibody-bha17107453</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_21f64e11-9279-4723-a940-1b7f7d02d1b3.jpg?v=1775785974</image:loc>
      <image:title>Klotho Antibody</image:title>
      <image:caption>IHC testing of FFPE human breast with Klotho antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kpna4-antibody-bha17107700</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_abf702e1-c639-46e2-93f4-15d871eca10d.jpg?v=1775786000</image:loc>
      <image:title>KPNA4 Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with KPNA4 at 0.5ug/ml. Predicted molecular weight: ~58kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kpna2-antibody-n-terminal-region-bha17106202</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3313e6e0-bba1-4349-bcfb-037a5a1d22a8.jpg?v=1775785822</image:loc>
      <image:title>KPNA2 Antibody (N-Terminal Region)</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) HepG2 cell lysate with KPNA2 antibody at 0.5ug/ml. Predicted molecular weight: ~58 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kir6-2-antibody-bha17106948</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2109a38a-fb5e-483d-a9f4-04c541160012.jpg?v=1775785919</image:loc>
      <image:title>Kir6.2 Antibody</image:title>
      <image:caption>IHC staining of FFPE human pancreas with Kir6.2 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/klk6-antibody-bha17107491</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cbf41d07-2643-4681-a2fe-67a99117c855.jpg?v=1775785979</image:loc>
      <image:title>KLK6 Antibody</image:title>
      <image:caption>IHC testing of FFPE human kidney with KLK6 antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kpna3-antibody-biotin-conjugate-bha17106655</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_10451e99-2665-4b17-9208-423436da1119.jpg?v=1775785885</image:loc>
      <image:title>KPNA3 Antibody (Biotin Conjugate)</image:title>
      <image:caption>Western blot testing of rat testis lysate with biotinylated KPNA3 antibody at 1ug/ml. Predicted molecular weight ~58kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/krit1-antibody-ccm1-bha17105860</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bf5ca292-0217-4c4a-b4a4-d5b7ff7192a7.jpg?v=1775785766</image:loc>
      <image:title>KRIT1 Antibody / CCM1</image:title>
      <image:caption>Western blot testing of 1) rat heart, 2) mouse NIH 3T3 and 3) human HeLa lysate with KRIT1 antibody at 0.5ug/ml. Predicted/observed molecular weight: ~84 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/klk8-antibody-kallikrein-8-bha17105761</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ac8c7679-c262-49ea-ab87-ab334f5a8fb1.jpg?v=1775785744</image:loc>
      <image:title>KLK8 Antibody / Kallikrein 8</image:title>
      <image:caption>Western blot testing of human placenta lysate with KLK8 antibody at 0.5ug/ml. Expected molecular weight ~28 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/klk1-antibody-bha17107810</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c64396de-f24c-4a29-8331-2d93d1aaf457.jpg?v=1775786011</image:loc>
      <image:title>KLK1 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with KLK1 antibody at 0.5ug/ml. Predicted/observed molecular weight: ~29/45-50kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kv1-2-antibody-bha17105331</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b74e36cf-46f1-480d-b0b3-e0fd9c1b3b61.jpg?v=1775785681</image:loc>
      <image:title>Kv1.2 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with Kv1.2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kv1-4-antibody-bha17105365</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_dea4d47e-956d-47f7-8e81-79cd50445b4d.jpg?v=1775785676</image:loc>
      <image:title>Kv1.4 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) COLO320, 3) HT1080 and 4) PANC cell lysate with Kv1.4 antibody. Expected/observed molecular weight ~73 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/laforin-antibody-bha17106758</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_80429203-e97a-44ac-a1d5-d9153d04811d.jpg?v=1775785897</image:loc>
      <image:title>Laforin Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with Laforin antibody at 0.1ug/ml. Predicted molecular weight: ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lactate-dehydrogenase-b-antibody-bha17107582</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_eee160d5-2e76-4043-aaf3-66824f6d36a0.jpg?v=1775785989</image:loc>
      <image:title>Lactate Dehydrogenase B Antibody</image:title>
      <image:caption>Western blot testing of human [A], mouse [B] and rat [C] heart lysates with Lactate Dehydrogenase B antibody at 0.1ug/ml. Predicted molecular weight: ~36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ku70-antibody-xrcc6-bha17105301</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_889f03fa-353f-4b5e-a14f-55b37b7ef3ad.jpg?v=1775785682</image:loc>
      <image:title>Ku70 Antibody / XRCC6</image:title>
      <image:caption>IHC staining of FFPE human pancreas ductal adenocarcinoma tissue with Ku70 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/l-plastin-antibody-bha17107154</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f41c4c6d-056b-4e44-af76-a16acfda676e.jpg?v=1775785942</image:loc>
      <image:title>L-Plastin Antibody</image:title>
      <image:caption>Western blot testing of Daudi [A] and U937 [B] lysates with L-Plastin antibody at 0.5ug/ml. Predicted molecular weight: ~70 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lactoperoxidase-antibody-bha17107332</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_28d68029-6493-4a5d-b47e-1c5d38b1ec07.jpg?v=1775785963</image:loc>
      <image:title>Lactoperoxidase Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with Lactoperoxidase antibody at 0.01ug/ml. Predicted molecular weight: ~80kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lair1-antibody-bha17107594</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d8710a2b-d72f-49ea-b23f-5a41b0bc59bd.jpg?v=1775785989</image:loc>
      <image:title>LAIR1 Antibody</image:title>
      <image:caption>Western blot testing of human lymph node lysate with LAIR1 antibody at 2ug/ml. Predicted molecular weight: ~30kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lasp1-antibody-bha17107663</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1008a87a-c7f9-4030-8961-80c9b23a2fc8.jpg?v=1775785997</image:loc>
      <image:title>LASP1 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum [A], colon [B] and duodenum [C] lysate with LASP1 antibody at 1ug/ml. Predicted molecular weight: ~30/36kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ku80-antibody-xrcc5-bha17105302</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_98bff9b1-3310-4608-b85a-03f0d154d281.jpg?v=1775785676</image:loc>
      <image:title>Ku80 Antibody / XRCC5</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) rat thymus, 3) human HeLa and 4) mouse NIH3T3 lysate with Ku80 antibody. Expected molecular weight: 80~86 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lamin-b1-antibody-bha17107307</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_87c06ef8-eadf-4d16-9ad1-de7b0f22c5cf.jpg?v=1775785960</image:loc>
      <image:title>Lamin B1 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with Lamin B1 antibody at 0.2ug/ml. Predicted molecular weight ~66kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lasp1-antibody-bha17107755</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c7d851a5-2cda-41f1-8552-a8f1ce0d44df.jpg?v=1775786011</image:loc>
      <image:title>LASP1 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with LASP1 antibody at 0.1ug/ml. Predicted molecular weight: 30/36/23kDa (isoforms 1/2/3).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lbp-antibody-bha17106004</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0fb59229-7077-4c5e-bd3a-d6db3520b784.jpg?v=1775785791</image:loc>
      <image:title>LBP Antibody</image:title>
      <image:caption>Western blot testing of 1) rat thymus, 2) mouse thymus, 3) human HeLa and 4) human K562 lysate with LBP antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa (unmodified), 60-65 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lbp-antibody-bha17106159</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0530d257-a56f-4626-8b4a-beb4fff1501f.jpg?v=1775785816</image:loc>
      <image:title>LBP Antibody</image:title>
      <image:caption>Western blot testing of recombinant human protein with LBP antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa (unmodified), 60-65 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lat1-antibody-bha17107028</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6ed7af2e-f771-4979-ac99-f33198304805.jpg?v=1775785930</image:loc>
      <image:title>LAT1 Antibody</image:title>
      <image:caption>Western blot testing of peripheral blood mononucleocyte lysate with LAT1 antibody at 0.01ug/ml. Predicted molecular weight ~28kDa, routinley observed at ~36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lcat-antibody-bha17105330</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4a05fc7c-b717-4adc-b9c8-885c68edb58b.jpg?v=1775785677</image:loc>
      <image:title>LCAT Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse testis, 3) human HepG2 and 4) human HeLa lysate with LCAT antibody. Observed molecular weight: 50~75 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/kpna3-antibody-bha17106654</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_174d2737-1fbb-4406-82b9-db76b2ca4082.jpg?v=1775785885</image:loc>
      <image:title>KPNA3 Antibody</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate with KPNA3 antibody at 0.1ug/ml. Predicted molecular weight ~58 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/laminin-gamma-antibody-g1-3-bha17106233</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ab8d2924-99db-465d-b7fb-24c0e33b1901.jpg?v=1775785830</image:loc>
      <image:title>Laminin gamma Antibody (G1-3)</image:title>
      <image:caption>Western blot testing of 1) mouse lung, 2) rat heart, 3) rat lung and 4) human HeLa lysate with Laminin gamma antibody at 0.5ug/ml. Expected molecular weight: 172-200 kDa (G1 &amp; G3), 130-140 kDa (G2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lamin-b1-antibody-bha17106721</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_55ef65d4-be20-4ce8-a8d0-d3f03686559f.jpg?v=1775785895</image:loc>
      <image:title>Lamin B1 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) Jurkat nuclear fraction lysate with Lamin B1 antibody at 1ug/ml. Predicted molecular weight ~66 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lbp-antibody-bha17106160</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_45bc5722-f144-431a-8f3c-b9b2f383e9c0.jpg?v=1775785817</image:loc>
      <image:title>LBP Antibody</image:title>
      <image:caption>Western blot testing of 1) human HeLa, 2) human Jurkat, 3) human A549, 4) human Raji, 5) rat liver and 6) mouse liver lysate with LBP antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa (unmodified), 60-65 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lass1-antibody-bha17107275</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_696ca6f0-d6f2-4467-b082-d4222b636206.jpg?v=1775785954</image:loc>
      <image:title>LASS1 Antibody</image:title>
      <image:caption>Western blot testing of frontal cortex lysate with LASS1 antibody at 1ug/ml. The expected ~37kDa band and the additional ~85kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ldhc-antibody-bha17106688</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_16cf914d-a224-4936-95c7-2ece35795b69.jpg?v=1775785892</image:loc>
      <image:title>LDHC Antibody</image:title>
      <image:caption>Western blot testing of mouse testis lysate with LDHC antibody at 1ug/ml. Predicted molecular weight: 36 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lcn2-antibody-lipocalin-2-ngal-bha17105397</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b58c5aeb-4394-47ee-bb0d-e801c814c96a.jpg?v=1775785680</image:loc>
      <image:title>LCN2 Antibody / Lipocalin 2 / NGAL</image:title>
      <image:caption>Western blot testing of 1) mouse lung and 2) mouse intestine lysate with LCN2 antibody. Predicted/observed molecular weight: 22-25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ldb3-antibody-bha17107485</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0dda2d71-1171-4e79-ba08-b4e3121dd481.jpg?v=1775785978</image:loc>
      <image:title>LDB3 Antibody</image:title>
      <image:caption>Western blot testing of human skeletal muscle lysate with LDB3 antibody at 0.1ug/ml. Predicted molecular weight: 31-78 kDa (6 isoforms), observed here at ~90/35kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/leptin-antibody-bha17106136</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8408d3c9-9f38-4f83-8f5b-7be47d29dec3.jpg?v=1775785814</image:loc>
      <image:title>Leptin Antibody</image:title>
      <image:caption>Western blot testing of recombinant rat protein with Leptin antibody at 0.5ug/ml. Predicted molecular weight ~16 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ldha-antibody-lactate-dehydrogenase-a-bha17105861</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5abee94d-5191-4716-b8de-fe9fb23bf451.jpg?v=1775785768</image:loc>
      <image:title>LDHA Antibody / Lactate dehydrogenase A</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with LDHA antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ldhc-antibody-bha17107381</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b2d4dc91-5564-49a0-9d80-543e06f0937c.jpg?v=1775785966</image:loc>
      <image:title>LDHC Antibody</image:title>
      <image:caption>Western blot testing of mouse testis lysate with LDHC antibody at 0.03ug/ml. Predicted molecular weight: 36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lava-lamp-antibody-lva-bha17107210</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e9590530-8174-4310-bf9e-9001a1e58ee0.jpg?v=1775785948</image:loc>
      <image:title>Lava lamp Antibody / lva</image:title>
      <image:caption>Drosophila S2 cells stained with Lava lamp antibody (red, AlexaFluor 555) and costained with MG130 rabbit antibody (green, AlexaFluor 488). The yellow spots indicate co-localization of the two proteins.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ldhb-antibody-bha17106776</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8d573b56-bafd-4f83-b05c-d114234e8df0.jpg?v=1775785900</image:loc>
      <image:title>LDHB Antibody</image:title>
      <image:caption>Western blot testing of human heart [A] and human kidney [B] lysates with LDHB antibody at 0.3ug/ml. Predicted molecular weight: ~36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lfa-1-antibody-cd18-bha17106990</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_edc65c07-03bf-4b58-a232-7568435ee483.jpg?v=1775785923</image:loc>
      <image:title>LFA-1 Antibody / CD18</image:title>
      <image:caption>Western blot testing of human A) K562 and B) U937 cell lysates with LFA-1 antibody at 0.3ug/ml. Predicted/observed molecular weight: 85~95 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lhx2-antibody-bha17107649</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c4757aed-a9a9-4582-98eb-5d871cc804ab.jpg?v=1775785997</image:loc>
      <image:title>LHX2 Antibody</image:title>
      <image:caption>Western blot testing of Daudi lysate with LHX2 antibody at 1ug/ml. Predicted molecular weight ~44kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/leptin-antibody-lep-bha17105432</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d3cb2704-9e09-4891-bd86-2faa96f8e082.jpg?v=1775785685</image:loc>
      <image:title>Leptin Antibody / LEP</image:title>
      <image:caption>Western blot testing of mouse NIH3T3 cell lysate with Leptin antibody. Expected/observed molecular weight ~16 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lgp2-antibody-dhx58-bha17106548</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5623ab17-a2e3-4d21-8149-beed5b8c91f0.jpg?v=1775785874</image:loc>
      <image:title>LGP2 Antibody / DHX58</image:title>
      <image:caption>Western blot testing of human liver lysate with LGP2 antibody at 0.3ug/ml. Predicted molecular weight: 77kDa. Both observed bands are blocked by addition of the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ldhb-antibody-lactate-dehydrogenase-b-bha17105862</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2db91fe5-44d0-4969-a557-8578479c7715.jpg?v=1775785770</image:loc>
      <image:title>LDHB Antibody / Lactate dehydrogenase B</image:title>
      <image:caption>Immunofluorescent staining of human A431 cells with LDHB antibody (red) and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lime-antibody-bha17106898</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a4b30ada-9fac-4e41-a038-8a3d46b484b0.jpg?v=1775785915</image:loc>
      <image:title>Lime Antibody</image:title>
      <image:caption>Western blot testing of mouse heart lysate with Lime antibody at 1ug/ml. Predicted molecular weight: 31kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lipin-3-antibody-bha17107425</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_37e77fa6-7977-43aa-9ff1-f219329dd8aa.jpg?v=1775785971</image:loc>
      <image:title>Lipin 3 Antibody</image:title>
      <image:caption>IHC testing of FFPE human thyroid gland with Lipin 3 antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lipocalin-2-antibody-ngal-lcn2-bha17105295</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2a3f4ebd-4bf0-4f91-a6ef-32a842b9e5d5.jpg?v=1775785676</image:loc>
      <image:title>Lipocalin 2 Antibody (NGAL, LCN2)</image:title>
      <image:caption>Western blot testing of 1) rat spleen and 2) rat lung lysate with Lipocalin 2 antibody. Predicted/observed molecular weight: 22-25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/livin-antibody-birc7-bha17105634</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b0db0714-7256-4157-af1e-44069c468421.jpg?v=1775785726</image:loc>
      <image:title>Livin Antibody / BIRC7</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) A549 cell lysate with Livin antibody. Predicted molecular weight: 33/30 kDa (isoforms alpha/beta).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/limk2-antibody-lim-kinase-2-bha17105477</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ae438b9e-dd6d-4e13-8dee-42ab9ee754e5.jpg?v=1775785694</image:loc>
      <image:title>LIMK2 Antibody / LIM Kinase 2</image:title>
      <image:caption>Western blot testing of mouse 1) brain, 2) liver, 3) thymus, 4) testis, 5) human 293 and 6) HeLa lysate with LIMK2 antibody. Expected/observed molecular weight ~72 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/light-antibody-tnfsf14-bha17107118</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_11a4967e-dc20-438e-a680-f4fc88ce62d6.jpg?v=1775785938</image:loc>
      <image:title>LIGHT Antibody / TNFSF14</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with LIGHT antibody at 1ug/ml. Predicted molecular weight: ~26 kDa (isoform 1), ~22 kDa (isoform 2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lipocalin-2-antibody-bha17106314</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ea023c15-e4a9-498a-b786-ab1da4cc1473.jpg?v=1775785843</image:loc>
      <image:title>Lipocalin 2 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with Lipocalin 2 antibody at 0.03ug/ml. Predicted molecular weight: 22-25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/limk-antibody-lim-kinase-1-bha17105476</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cc8c394c-9c19-4130-9310-cb757c7f4a14.jpg?v=1775785692</image:loc>
      <image:title>LIMK Antibody / LIM Kinase 1</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse stomach, human 3) HeLa, 4) U87 and 5) SKOV lysate with LIMK antibody. Expeccted/observed molecular weight ~72 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lox-antibody-lysyl-oxidase-bha17105389</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f4660d6e-4980-4271-a25b-aabfb897c77c.jpg?v=1775785677</image:loc>
      <image:title>LOX Antibody / Lysyl Oxidase</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat lung and 3) mouse liver tissue lysate with LOX antibody. Expected molecular weight: ~47 kDa (unprocessed/unmodified), ~50 kDa (glycosylated), ~32 kDa (processed form).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lin7b-antibody-bha17106291</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9d090064-6395-417e-aa50-370cbeebf341.jpg?v=1775785839</image:loc>
      <image:title>LIN7B Antibody</image:title>
      <image:caption>Western blot testing of rat brain lysate with LIN7B antibody at 0.5ug/ml. Predicted molecular weight: 23kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lox-1-antibody-middle-region-bha17106154</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_49dfdb42-4430-40e9-8ebe-90d132ec0426.jpg?v=1775785816</image:loc>
      <image:title>LOX-1 Antibody (Middle Region)</image:title>
      <image:caption>Western blot testing of human placental tissue with LOX-1 antibody at 0.5ug/ml. Predicted molecular weight: pro-form 35-50 kDa, mature form ~31 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lmnb1-antibody-lamin-b1-bha17105352</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3d502cbc-5b7e-4e0e-8c3c-d75a25789ae6.jpg?v=1775785683</image:loc>
      <image:title>LMNB1 Antibody / Lamin B1</image:title>
      <image:caption>IHC staining of FFPE human stomach cancer tissue with LMNB1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lmo1-antibody-bha17106013</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bfd5d41e-e313-4a03-828d-fd527497bd6e.jpg?v=1775785793</image:loc>
      <image:title>LMO1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse NIH3T3 and 3) human HeLa lysate with LMO1 antibody at 0.5ug/ml. Predicted molecular weight ~18 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lox-1-antibody-olr1-bha17106614</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_46c8fed9-48db-490b-89b7-e3546007cb1d.jpg?v=1775785884</image:loc>
      <image:title>LOX-1 Antibody / OLR1</image:title>
      <image:caption>Western blot testing of human liver lysate with LOX-1 antibody at 0.1ug/ml. Predicted molecular weight: pro-form 35-50kDa, mature form ~31kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lmo6-antibody-bha17107173</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_40873769-d97a-40a9-8750-efd55e019dee.jpg?v=1775785944</image:loc>
      <image:title>LMO6 Antibody</image:title>
      <image:caption>Western blot testing of Daudi lysate with LMO6 antibody at 0.1ug/ml. Predicted molecular weight: ~69kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/loxl1-antibody-bha17105537</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ae539918-675a-491d-bcd8-b357ce809616.jpg?v=1775785705</image:loc>
      <image:title>LOXL1 Antibody</image:title>
      <image:caption>Western blot testing of human 1) A549 and 2) HeLa lysate with LOXL1 antibody. Expected/observed molecular weight ~63 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/loxl2-antibody-bha17105688</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_dcf2bbeb-a28d-404e-8045-50b642bfa959.jpg?v=1775785732</image:loc>
      <image:title>LOXL2 Antibody</image:title>
      <image:caption>Western blot testing of 1) human HeLa, 2) human MCF7, 3) human MDA-MB-453, 4) rat brain, 5) mouse brain and 6) mouse lung lysate with LOXL2 antibody. Predicted molecular weight ~87 kDa, commonly observed at 87-105 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lmp7-antibody-bha17106723</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d670290a-abd9-4ec8-abaf-745791a29e6e.jpg?v=1775785894</image:loc>
      <image:title>LMP7 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with LMP7 antibody at 0.01ug/ml. Predicted molecular weight: ~30kDa but can be observed at ~22kDa (PMID: 10878350).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lrp6-antibody-bha17106426</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_71b1b9fc-2be3-4229-8544-a85f715790a0.jpg?v=1775785860</image:loc>
      <image:title>LRP6 Antibody</image:title>
      <image:caption>IHC testing of FFPE human kidney with LRP6 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lifr-antibody-lif-receptor-bha17105440</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6d997fc5-3b90-4323-b260-3492e435fb5a.jpg?v=1775785687</image:loc>
      <image:title>LIFR Antibody / LIF Receptor</image:title>
      <image:caption>Western blot testing of human 1) SW620, 2) COLO320 and 3) HepG2 cell lysate with LIFR antibody. Expected/observed molecular weight ~124/190 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lnk-antibody-sh2b3-n-terminal-region-bha17107611</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8a47ef0a-28f4-41df-8e5b-2a45989b278c.jpg?v=1775785992</image:loc>
      <image:title>LNK Antibody / SH2B3 (N-Terminal Region)</image:title>
      <image:caption>Western blot testing of MOLT4 lysate with LNK antibody at 0.3ug/ml. Predicted molecular weight: ~63 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lsd1-antibody-bha17107343</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_89c71def-8af0-4c4c-b7df-e12820052fb9.jpg?v=1775785963</image:loc>
      <image:title>LSD1 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with LSD1 antibody at 0.5ug/ml. Expected molecular weight ~110kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lrrk2-antibody-bha17106382</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5db9fda1-b520-4b2f-9807-104a71a142a1.jpg?v=1775785853</image:loc>
      <image:title>LRRK2 Antibody</image:title>
      <image:caption>IF/ICC staining of fixed and permeabilized human A431 cells with LRRK2 antibody (green) at 10ug/ml and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lrp5-antibody-bha17106954</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1568eec8-feb3-4f5b-8ef4-21964f769aea.jpg?v=1775785920</image:loc>
      <image:title>LRP5 Antibody</image:title>
      <image:caption>IHC testing of FFPE human kidney with LRP5 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lsp1-antibody-bha17106351</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_621e8ce3-10bd-48b2-ae17-b8b124f3c1e8.jpg?v=1775785848</image:loc>
      <image:title>LSP1 Antibody</image:title>
      <image:caption>Western blot testing of peripheral blood lymphocyte lysate with LSP1 antibody at 1ug/ml. Predicted molecular weight: ~37kDa but is routinely observed at ~52kDa (PMID: 15684321).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lxra-b-antibody-bha17106460</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_72cb9841-236c-4de7-abac-65355c4f83a3.jpg?v=1775785862</image:loc>
      <image:title>LXRA/B Antibody</image:title>
      <image:caption>Western blot testing of human spleen lysate with LXRA/B antibody at 1ug/ml. Predicted molecular weight: ~50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ltf-antibody-bha17106899</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f2b522c3-cbb8-4194-bd54-92a0824a43a1.jpg?v=1775785913</image:loc>
      <image:title>LTF Antibody</image:title>
      <image:caption>Western blot testing of peripheral blood mononucleocyte lysate with LTF antibody at 0.05ug/ml. Predicted molecular weight: ~78/73kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lsm2-antibody-bha17106673</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fa629e38-ccb9-4ce2-9309-e01a882da94c.jpg?v=1775785892</image:loc>
      <image:title>LSM2 Antibody</image:title>
      <image:caption>Western blot testing of K562 lysate with LSM2 antibody at 1ug/ml. Predicted molecular weight: ~10kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lymphotactin-antibody-bha17105451</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bd970f42-2c12-476f-af63-da398a2b6c33.jpg?v=1775785689</image:loc>
      <image:title>Lymphotactin Antibody</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate with Lymphotactin antibody. Predicted molecular weight ~13 kDa, can be observed at 15-20 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lyplal1-antibody-bha17106676</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d896f9d2-c8d2-4e6b-a78e-64ef4b9a429f.jpg?v=1775785890</image:loc>
      <image:title>LYPLAL1 Antibody</image:title>
      <image:caption>Western blot testing of human adipose lysate with LYPLAL1 antibody at 0.3ug/ml. Predicted molecular weight: ~26kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lrig3-antibody-bha17105863</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_657f30d9-3d80-40d6-bd7b-eb6c6fb47230.jpg?v=1775785768</image:loc>
      <image:title>LRIG3 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat testis and 2) human HepG2 lysate with LRIG3 antibody at 0.5ug/ml. Observed molecular weight: ~123 kDa (precursor), 140-170 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lysozyme-antibody-lyz-bha17105496</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c94412a6-f44a-4134-9a32-248fde1e92f5.jpg?v=1775785698</image:loc>
      <image:title>Lysozyme Antibody / LYZ</image:title>
      <image:caption>Immunofluorescent staining of FFPE human colon with Lysozyme antibody (red) and DAPI (blue). HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/m6prbp1-antibody-bha17107676</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f695330f-f97e-4095-9378-29b6ffeb00d1.jpg?v=1775785998</image:loc>
      <image:title>M6prbp1 Antibody</image:title>
      <image:caption>Western blot testing of rat skin lysate with M6prbp1 antibody at 0.1ug/ml. Predicted molecular weight: ~47kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mad2l1-antibody-bha17107512</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b901edd9-98be-4632-b161-708e6e374c20.jpg?v=1775785979</image:loc>
      <image:title>MAD2L1 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate with MAD2L1 antibody at 2ug/ml. The expected ~24kDa band and the additional ~29kDa band are blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lyn-antibody-c-terminal-region-bha17106191</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ef5e9ef2-01cf-479e-924a-3ed592a57e71.jpg?v=1775785823</image:loc>
      <image:title>LYN Antibody (C-Terminal Region)</image:title>
      <image:caption>Western blot testing of human 293T cell lysate with LYN antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa (p53lyn), ~56 kDa (p56lyn).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mak-antibody-c-terminal-region-bha17106128</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f57e913e-c55c-4f03-98a2-b74258f0b1ec.jpg?v=1775785812</image:loc>
      <image:title>MAK Antibody (C-Terminal Region)</image:title>
      <image:caption>Western blot testing of human 1) HepG2 and 2) MCF7 cell lysate with MAK antibody at 0.5ug/ml. Predicted molecular weight ~70 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mammaglobin-a-antibody-scgb2a2-bha17107668</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_02960769-c3a7-4fc8-ac3d-83bc64fbed5a.jpg?v=1775785999</image:loc>
      <image:title>Mammaglobin A Antibody / SCGB2A2</image:title>
      <image:caption>IHC testing of FFPE human breast with Mammaglobin A antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/man2a1-antibody-bha17107360</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_586d4311-2dcf-480d-a52f-e60c9559a93d.jpg?v=1775785964</image:loc>
      <image:title>MAN2A1 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with MAN2A1 antibody at 0.3ug/ml. Predicted molecular weight: ~131kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mafa-antibody-bha17105612</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1c2d3488-0eaa-47df-ba69-a1cab288aefc.jpg?v=1775785722</image:loc>
      <image:title>MAFA Antibody</image:title>
      <image:caption>Western blot testing of human 1) HEK293, 2) K562, 3) 22RV1 and 4) rat PC-12 lysate with MAFA antibody. Predicted molecular weight ~37 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mad4-antibody-bha17107071</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e1ff15be-b353-4448-aa46-7556e360bdb5.jpg?v=1775785933</image:loc>
      <image:title>MAD4 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with MAD4 antibody at 0.5ug/ml. Predicted molecular weight: ~24kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/maoa-antibody-bha17105356</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_afe3bc86-ce65-4d6c-bd16-174a9bf466e3.jpg?v=1775785681</image:loc>
      <image:title>MAOA Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with MAOA antibody (green) at 5ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/maob-antibody-bha17107144</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_15446eec-f7d3-4ef4-bb17-f9bc2d08839a.jpg?v=1775785943</image:loc>
      <image:title>MAOB Antibody</image:title>
      <image:caption>Western blot testing of human hippocampus lysate with MAOB antibody at 0.5ug/ml. Predicted/observed molecular weight: ~59kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/map3k8-antibody-bha17105763</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_997e3a0f-7bdf-4e3b-9c3c-a2b1152886a5.jpg?v=1775785746</image:loc>
      <image:title>MAP3K8 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) human HeLa lysate with MAP3K8 antibody at 0.5ug/ml. Expected molecular weight: ~58/52 kDa (isoforms 1/2), observed here at ~52 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/map2k2-antibody-bha17106615</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d98ee975-6852-4cbc-bfe2-f2be3021d4cb.jpg?v=1775785881</image:loc>
      <image:title>MAP2K2 Antibody</image:title>
      <image:caption>Western blot testing of Daudi [A], Jurkat [B], K562 [C] and MOLT4 [D] lysates with MAP2K2 antibody at 0.3ug/ml. Predicted molecular weight: ~45kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/malate-dehydrogenase-1-antibody-bha17107744</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2a102e5b-7355-4b64-aa3d-b89394e4bc2e.jpg?v=1775786005</image:loc>
      <image:title>Malate dehydrogenase 1 Antibody</image:title>
      <image:caption>Western blot testing of human [A], mouse [B] and rat [C] heart lysates with Malate dehydrogenase 1 antibody at 0.03ug/ml. Predicted molecular weight: ~36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/lyn-antibody-bha17107504</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_01edaebe-72a3-401f-9f69-b801488590e2.jpg?v=1775785980</image:loc>
      <image:title>LYN Antibody</image:title>
      <image:caption>Western blot testing of U937 lysate with LYN antibody at 0.1ug/ml. Predicted molecular weight ~58 kDa (isoform 1).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mapk6-antibody-bha17105583</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_822d3873-368d-475d-8b12-6e4cb1c7ce9f.jpg?v=1775785716</image:loc>
      <image:title>MAPK6 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat skeletal muscle, 3) human PANC and 4) mouse NIH3T3 lysate with MAPK6 antibody. Predicted molecular weight ~83 kDa but routinely observed at ~97 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mapk6-antibody-bha17107204</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_41da1cc1-2619-42b0-b045-f400d2640471.jpg?v=1775785947</image:loc>
      <image:title>MAPK6 Antibody</image:title>
      <image:caption>Western blot of HEK293 lysate overexpressing mouse MAPK6-GFP tested with MAPK6 antibody (0.5ug/ml) in left panel and with anti-GFP in right panel. GFP-only exression in the first lane. Observed molecular weight of MAPK6+ GFP: ~130kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/map4k1-antibody-bha17106728</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f678cdf0-b137-4fd3-beca-2b3862176f3e.jpg?v=1775785897</image:loc>
      <image:title>MAP4K1 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with MAP4K1 antibody at 0.5ug/ml. Predicted molecular weight: ~96 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mark4-antibody-bha17107242</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5bab0bc8-6825-447b-a7a5-8a217e6d3a9a.jpg?v=1775785951</image:loc>
      <image:title>MARK4 Antibody</image:title>
      <image:caption>Western blot testing of human prostate lysate with MARK4 antibody at 0.5ug/ml. Predicted molecular weight: ~75kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/maob-antibody-monoamine-oxidase-b-bha17105385</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_19355d2c-b83a-4c11-83c8-95a4072b0447.jpg?v=1775785678</image:loc>
      <image:title>MAOB Antibody / Monoamine Oxidase B</image:title>
      <image:caption>IHC staining of FFPE human brain tissue with MAOB antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mast-cell-tryptase-antibody-tpsab1-bha17105772</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c079da73-734b-4a1b-9821-66753a008a23.jpg?v=1775785747</image:loc>
      <image:title>Mast Cell Tryptase Antibody / TPSAB1</image:title>
      <image:caption>Western blot testing of human HEK293 cell lysate with Mast Cell Tryptase antibody at 0.5ug/ml. Expected molecular weight ~30 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/max-antibody-myc-associated-factor-x-bha17106786</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_35f046fe-555e-49f3-ac90-2ec85d9e23a8.jpg?v=1775785900</image:loc>
      <image:title>MAX Antibody / MYC associated factor X</image:title>
      <image:caption>Western blot testing of Jurkat lysate with MAX antibody at 0.1ug/ml. Two forms of MAX may be observed: 16-17kDa and 21-22kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mc1r-antibody-bha17106056</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3ff22974-9c56-4376-8bb5-74fd657163b4.jpg?v=1775785802</image:loc>
      <image:title>MC1R Antibody</image:title>
      <image:caption>Western blot testing of 1) rat PC12, 2) mouse Hepa1-6, 3) human HeLa and 4) human A375 cell lysate with MC1R antibody at 0.5ug/ml. Predicted molecular weight ~35 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mavs-antibody-bha17106116</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_05f0b261-88a4-4144-9635-0f698adabde0.jpg?v=1775785811</image:loc>
      <image:title>MAVS Antibody</image:title>
      <image:caption>IHC testing of FFPE human liver cancer tissue with MAVS antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mast3-antibody-bha17106689</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0dab8fae-a66f-48bd-890f-eec65ec7824e.jpg?v=1775785891</image:loc>
      <image:title>MAST3 Antibody</image:title>
      <image:caption>Western blot testing of rat kidney lysate with MAST3 antibody at 0.3ug/ml. Predicted molecular weight: ~143kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mbl2-antibody-mannose-binding-lectin-2-bha17106171</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6639f669-55ca-4a1d-80c6-85e0f46acec2.jpg?v=1775785817</image:loc>
      <image:title>MBL2 Antibody / Mannose-Binding Lectin 2</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse liver and 3) mouse HEPA1-6 lysate with MBL2 antibody at 0.5ug/ml. Predicted molecular weight ~26 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mboat4-antibody-bha17106399</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a3b59104-8d49-40c3-9f43-e6edfc0ac84a.jpg?v=1775785855</image:loc>
      <image:title>Mboat4 Antibody</image:title>
      <image:caption>Western blot testing of mouse pancreas lysate with Mboat4 antibody at 0.5ug/ml. The expected ~50kDa band and the additional ~38kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mc2r-antibody-bha17106888</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c4596b06-b835-42a7-9261-354977caded5.jpg?v=1775785912</image:loc>
      <image:title>MC2R Antibody</image:title>
      <image:caption>Western blot testing of human skin lysate with MC2R antibody at 1ug/ml. Predicted molecular weight: ~33/43kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mcl1-antibody-bha17106310</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fb03e9d6-870f-4e33-959a-6acff7e38ebf.jpg?v=1775785841</image:loc>
      <image:title>MCL1 Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with MCL1 antibody at 1ug/ml. Predicted molecular weight: 37/22 kDa (isoforms 1/3).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mcm8-antibody-bha17105674</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ba83b325-e87a-4515-aa80-1af8d7023178.jpg?v=1775785733</image:loc>
      <image:title>MCM8 Antibody</image:title>
      <image:caption>Western blot testing of human 1) A549, 2) SW620, 3) HeLa, 4) PANC, and 5) HepG2 lysate with MCM8 antibody. Expected/observed molecular weight ~94/89 kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mask-antibody-stk26-mst4-bha17107382</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_279e813e-71fb-4232-829e-7cda27fc2ece.jpg?v=1775785965</image:loc>
      <image:title>MASK Antibody / STK26 / MST4</image:title>
      <image:caption>Western blot testing of Jurkat lysate with MASK antibody at 0.5ug/ml. Predicted molecular weight: ~47 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mc2r-antibody-melanocortin-receptor-2-bha17106055</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_48576f49-d213-4c11-af22-388d0e8e4197.jpg?v=1775785801</image:loc>
      <image:title>MC2R Antibody / Melanocortin receptor 2</image:title>
      <image:caption>Flow cytometry testing of fixed human U-251 cells with MC2R antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MC2R antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mcts1-antibody-bha17106528</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d138a759-1b4a-4de2-937d-73c51319af85.jpg?v=1775785870</image:loc>
      <image:title>MCTS1 Antibody</image:title>
      <image:caption>Western blot testing of MOLT4 lysate with MCTS1 antibody at 0.3ug/ml. Predicted molecular weight: ~20kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mcp1-antibody-ccl2-bha17105306</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_420af46c-76b7-4972-81b1-5378277b9e1d.jpg?v=1775785674</image:loc>
      <image:title>MCP1 Antibody / CCL2</image:title>
      <image:caption>Western blot testing of human SW620 cell lysate with MCP1 antibody. Expected/observed molecular weight ~11/9 kDa (precursor/mature).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mc3-receptor-antibody-bha17106028</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5addd9be-651d-4ab5-957e-8e3b3df6f5db.jpg?v=1775785797</image:loc>
      <image:title>MC3 Receptor Antibody</image:title>
      <image:caption>Western blot testing of 1) mouse kidney and 2) human COLO-320 lysate with MC3 Receptor antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mdm2-antibody-bha17106532</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c4d868d7-a137-4f4b-bdf5-52f9c3fc410d.jpg?v=1775785873</image:loc>
      <image:title>MDM2 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with MDM2 antibody at 0.3ug/ml. Predicted molecular weight: ~55 kDa but can be observed at up to ~90 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/med14-antibody-bha17106248</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ad640e12-29b7-441a-8fd7-9840457cf7e9.jpg?v=1775785832</image:loc>
      <image:title>MED14 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver and 2) mouse liver lysate wtih MED14 antibody at 0.5ug/ml. Expected molecular weight: 150-170 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/med18-antibody-bha17106275</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5fb55580-5cbe-4eb6-9050-28076b121f2a.jpg?v=1775785839</image:loc>
      <image:title>MED18 Antibody</image:title>
      <image:caption>Western blot testing of human 1) A431, 2) K562, 3) U-2 OS, 4) HL60, 5) rat liver and 6) mouse kidney lysate with MED18 antibody at 0.5ug/ml. Predicted molecular weight ~24 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/med8-antibody-bha17106265</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_79ac7878-97a0-4b55-a38e-77382c26f90d.jpg?v=1775785835</image:loc>
      <image:title>MED8 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat pancreas, 2) mouse pancreas and 3) human U-2 OS lysate with MED8 antibody at 0.5ug/ml. Expected molecular weight: 29-32 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/med15-antibody-bha17106235</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4eecee46-7d11-42a5-9a6b-7127c72d37fc.jpg?v=1775785835</image:loc>
      <image:title>MED15 Antibody</image:title>
      <image:caption>Western blot testing of human 1) U-87MG, 2) U-2 OS, 3) HeLa, 4) 22RV1, 5) K562, 6) rat liver and 7) mouse thymus lysate with MED15 antibody at 0.5ug/ml. Predicted molecular weight ~87 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/med9-antibody-med25-bha17106277</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_82163683-c4b6-4046-b68c-0e4c05bf0946.jpg?v=1775785838</image:loc>
      <image:title>MED9 Antibody / MED25</image:title>
      <image:caption>Western blot testing of rat 1) brain, 2) heart, 3) kidney and moouse 4) brain, 5) heart, 6) kidney with MED9 antibody at 0.5ug/ml. Predicted molecular weight ~16 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mef2a-antibody-myocyte-specific-enhancer-factor-2a-bha17105705</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f9a01354-2780-43af-be6c-acd28f5bafa6.jpg?v=1775785738</image:loc>
      <image:title>MEF2A Antibody / Myocyte-specific enhancer factor 2A</image:title>
      <image:caption>Immunofluorescent staining of FFPE human U-2 OS cells with MEF2A antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/med13-antibody-bha17106246</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_319faa67-e560-42cf-b149-083d7bcec93c.jpg?v=1775785831</image:loc>
      <image:title>MED13 Antibody</image:title>
      <image:caption>Western blot testing of human 1) U-2 OS and 2) MCF7 cell lysate with MED13 antibody at 0.5ug/ml. Predicted molecular weight ~239-250 kDa, observed here at ~300 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/med4-antibody-bha17106258</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_79270d76-4a04-48ef-9107-ce994932de74.jpg?v=1775785835</image:loc>
      <image:title>MED4 Antibody</image:title>
      <image:caption>Western blot testing of rat spleen lysate with MED4 antibody at 0.5ug/ml. Predicted molecular weight ~30 kDa, commonly observed at 30-36 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/med6-antibody-arc33-bha17106268</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1527e8d4-236f-4147-83ee-e6b22618f10e.jpg?v=1775785835</image:loc>
      <image:title>MED6 Antibody / ARC33</image:title>
      <image:caption>Western blot testing of 1) human A431, 2) human Jurkat, 3) human HepG2, 4) human PC-3, 5) human U-2 OS, 6) human A549, 7) human MCF7, 8) rat C6 and 9) mouse NIH 3T3 cell lysate with MED6 antibody. Predicted molecular weight ~28 kDa, commonly observed at 28-33 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mefv-antibody-marenostrin-pyrin-bha17106815</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9bed42f3-3668-4277-bed8-f37748ceb5f4.jpg?v=1775785904</image:loc>
      <image:title>MEFV Antibody / Marenostrin / Pyrin</image:title>
      <image:caption>IF/ICC staining of fixed and permeabilized human A431 cells with GADD34 antibody (green) at 10ug/ml, DAPI nuclear stain (blue) and phalloidin (red).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mek6-antibody-mkk6-map2k6-bha17106207</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_78f3d0d6-15d0-40ec-82a6-81a8baed0a94.jpg?v=1775785824</image:loc>
      <image:title>MEK6 Antibody / MKK6 / MAP2K6</image:title>
      <image:caption>Western blot testing of 1) human HeLa, 2) human A549 and 3) rat C6 cell lysate with MEK6 antibody at 0.5ug/ml. Predicted molecular weight ~37 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/melk-antibody-bha17107467</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fea5f455-0698-4fa3-a72c-2360ccd116a7.jpg?v=1775785976</image:loc>
      <image:title>MELK Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with MELK antibody at 0.1ug/ml. Predicted molecular weight: ~75/150 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mesothelin-antibody-bha17105593</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_dbcac621-043b-4cd9-8639-3241da082c47.jpg?v=1775785718</image:loc>
      <image:title>Mesothelin Antibody</image:title>
      <image:caption>IHC testing of FFPE mouse lung with Mesothelin antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mesothelin-antibody-bha17106444</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2e59c1cd-e208-43bc-9b72-9538375fdb0e.jpg?v=1775785860</image:loc>
      <image:title>Mesothelin Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with Mesothelin antibody at 0.3ug/ml. The expected ~70kDa band and the additional ~150kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mepce-antibody-bha17107445</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a62ff685-6932-42c7-a36d-9e66b1295ba0.jpg?v=1775785974</image:loc>
      <image:title>MEPCE Antibody</image:title>
      <image:caption>IHC staining of FFPE human testis with MEPCE antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/melanophilin-antibody-bha17106338</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a2621561-c05b-448d-92e1-77d0d43e0429.jpg?v=1775785847</image:loc>
      <image:title>Melanophilin Antibody</image:title>
      <image:caption>Western blot testing of total melanocyte PNS (200ug per lane) of wild-type and leaden (Mlph null) mice with Melanophilin antibody at 0.5ug/ml. The upper band may represent the stacking-separating gel interface.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mga-antibody-max-gene-associated-protein-bha17105608</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0775b644-d242-4f76-b374-6baefd5a9965.jpg?v=1775785719</image:loc>
      <image:title>MGA Antibody / MAX gene associated protein</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) MCF7 and 3) SW620 cell lysate with MGA antibody. Expected molecular weight ~331 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mgst1-antibody-bha17105286</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_627fbf47-88e1-4f91-bac3-5a238ef2e835.jpg?v=1775785675</image:loc>
      <image:title>MGST1 Antibody</image:title>
      <image:caption>IHC staining of FFPE human pancreas cancer tissue with MGST1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mertk-antibody-bha17106994</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5550bdc6-aec0-4a60-9d83-81895ab5e98a.jpg?v=1775785924</image:loc>
      <image:title>MERTK Antibody</image:title>
      <image:caption>Western blot testing of human Daudi lysate with MERTK antibody at 2ug/ml. Predicted molecular weight: 110~205 kDa depending on glycosylation level; observed here at ~140 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mica-antibody-bha17105586</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f0e7db95-95ae-467e-8068-11ba76bf5711.jpg?v=1775785718</image:loc>
      <image:title>MICA Antibody</image:title>
      <image:caption>Western blot testing of human 1) SW620, 2) A549, 3) MCF-7 and 4) HeLa cell lysate with MICA antibody. Predicted molecular weight: ~43 kDa but may be observed at 38-62 kDa depending on truncation and glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mia-antibody-bha17107787</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_edffa02e-8544-47b8-9f55-4df83b04c4ac.jpg?v=1775786012</image:loc>
      <image:title>MIA Antibody</image:title>
      <image:caption>Western blot testing of human glioma lysate with MIA antibody at 1ug/ml. Predicted molecular weight: ~14kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mgp-antibody-matrix-gla-protein-bha17105749</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_85b983ed-19c3-46b2-a2ba-0d0de138b019.jpg?v=1775785745</image:loc>
      <image:title>MGP Antibody / Matrix Gla protein</image:title>
      <image:caption>Western blot testing of human Jurkat cell lysate with MGP antibody. Expected molecular weight ~10 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mint1-antibody-apba1-bha17106757</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_485ec0ba-8d60-4201-8e61-4fd146cab793.jpg?v=1775785897</image:loc>
      <image:title>MINT1 Antibody / APBA1</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with MINT1 antibody at 0.1ug/ml. Predicted molecular weight: ~93kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mig-antibody-cxcl9-bha17105533</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0cc523cd-9998-4ffd-838b-8c54942d374c.jpg?v=1775785704</image:loc>
      <image:title>MIG Antibody / CXCL9</image:title>
      <image:caption>Western blot testing of human 1) placenta, 2) A431 and 3) HeLa lysate with MIG antibody. Expected/observed molecular weight ~19 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/micb-antibody-mhc-class-i-polypeptide-related-sequence-b-bha17105585</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f181eae1-98f6-47e4-954b-c8719e0dffc2.jpg?v=1775785718</image:loc>
      <image:title>MICB Antibody / MHC class I polypeptide-related sequence B</image:title>
      <image:caption>Flow cytometry testing of fixed and permeabilized human K562 cells with MICB antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MICB antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mif-antibody-biotin-conjugate-bha17107576</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4886254f-224f-472c-bf25-229f729e8dfa.jpg?v=1775785987</image:loc>
      <image:title>MIF Antibody [Biotin Conjugate]</image:title>
      <image:caption>Western blot testing of human Daudi lysate with MIF antibody at 0.2ug/ml. Predicted molecular weight ~13kDa. An NAP blocker was used in place of non-fat milk as blocking solution and diluent. (1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mif-antibody-macrophage-migration-inhibitory-factor-bha17107575</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b48d996f-66e9-4254-adf3-0da1f8187055.jpg?v=1775785987</image:loc>
      <image:title>MIF Antibody / Macrophage migration inhibitory factor</image:title>
      <image:caption>Western blot testing of human thymus lysate with MIF antibody at 0.01ug/ml. Predicted molecular weight ~13 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mlh1-antibody-bha17105430</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7ded38c0-9729-4c6e-99d1-0981e75e0092.jpg?v=1775785685</image:loc>
      <image:title>MLH1 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HEK293, 2) HeLa, 3) COLO320, 4) T-47D and 5) A549 cell lysate with MLH1 antibody. Predicted molecular weight: 85/58/74 kDa (isoforms 1/2/3).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mic1-antibody-bha17106594</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f5c6fc61-1901-43cf-9cc7-08eaf4f9f759.jpg?v=1775785880</image:loc>
      <image:title>MIC1 Antibody</image:title>
      <image:caption>IHC staining of FFPE human small intestine with MIC1 antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mmp-9-antibody-bha17105764</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1a167070-6159-4ab0-b6bc-29a496a4cf44.jpg?v=1775785746</image:loc>
      <image:title>MMP-9 Antibody</image:title>
      <image:caption>Western blot testing of rat NRK cell lysate with MMP-9 antibody at 0.5ug/ml. Predicted molecular weight: 92/67-80 kDa (precursor/mature forms).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mll4-antibody-kmt2b-bha17106427</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_be9873e2-f49d-4b13-9815-1a25ec22af8b.jpg?v=1775785858</image:loc>
      <image:title>MLL4 Antibody / KMT2B</image:title>
      <image:caption>IHC testing of FFPE human testis with MLL4 antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mmp10-antibody-bha17105271</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_833c14d3-a7f7-4b54-85ea-2f4226b07e73.jpg?v=1775785674</image:loc>
      <image:title>MMP10 Antibody</image:title>
      <image:caption>Western blot testing of 1) human placenta, 2) HeLa and 3) SGC lysate with MMP10 antibody. Expected molecular weight ~54 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mmp-12-antibody-bha17105417</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c58c4c9d-3965-44a2-b61a-92f4103ed7fc.jpg?v=1775785676</image:loc>
      <image:title>Mmp-12 Antibody</image:title>
      <image:caption>Western blot testing of mouse HEPA lysate with Mmp-12 antibody. Predicted molecular weight: ~55 kDa (pro form), ~45 kDa and ~22 kDa (active forms).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mkk3-antibody-map2k3-mek3-bha17105448</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_32a532a1-38bf-4836-b43d-8e6837bf3528.jpg?v=1775785693</image:loc>
      <image:title>MKK3 Antibody / MAP2K3 / MEK3</image:title>
      <image:caption>Immunofluorescent staining of FFPE human Caco-2 cells with MKK3 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mid1ip1-antibody-bha17107222</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_723b4db5-160f-435a-be63-978438e662ab.jpg?v=1775785950</image:loc>
      <image:title>MID1IP1 Antibody</image:title>
      <image:caption>Western blot of HEK293 lysate overexpressing human MID1IP1-MYC probed with MID1IP1 antibody [1ug/ml] in lane A and anti-MYC in lane C. Mock-transfected HEK293 probed with MID1IP1 antibody [1ug/ml] in lane B. Predicted molecular weight: ~20kDa but routinely observed at ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mmp16-antibody-bha17106252</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_321dd344-3103-417a-904d-56a9d045f840.jpg?v=1775785835</image:loc>
      <image:title>MMP16 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with MMP16 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mmp-8-antibody-bha17105368</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0eb84153-1f6e-439e-9dc0-46f975d71adf.jpg?v=1775785679</image:loc>
      <image:title>MMP-8 Antibody</image:title>
      <image:caption>Western blot testing of human 1) K562 and 2) Jurkat cell lysate with MMP-8 antibody. Expected molecular weight: 55 kDa (latent), 46, 42 kDa (active).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mmp2-antibody-bha17105984</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_52cdb400-417c-4798-ae70-bbc1baa07ac2.jpg?v=1775785789</image:loc>
      <image:title>MMP2 Antibody</image:title>
      <image:caption>Western blot testing of human recombinant MMP2 protein (1ng/lane) with MMP2 antibody at 0.5ug/ml.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mmp14-antibody-bha17106957</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_36749768-243e-4498-be1e-33516fa2601f.jpg?v=1775785920</image:loc>
      <image:title>MMP14 Antibody</image:title>
      <image:caption>Western blot testing of mouse NIH3T3 [A], A549 [B], and HeLa [C] lysates with MMP14 antibody at 1ug/ml. Predicted molecular weight: ~66/54kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mmp11-antibody-bha17106012</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4d583622-3a6f-4f3b-bc48-48093cf20230.jpg?v=1775785795</image:loc>
      <image:title>MMP11 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat spleen and 2) human MM231 lysate with MMP11 antibody at 0.5ug/ml. Predicted molecular weight ~55 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mob2-antibody-bha17106534</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4fed4f51-0e1e-4a59-bf80-db64c5c1ea57.jpg?v=1775785872</image:loc>
      <image:title>MOB2 Antibody</image:title>
      <image:caption>IHC staining of FFPE human lung with MOB2 antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mmp10-antibody-bha17106236</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7b64f110-cedd-4d29-a7d4-d617e09fe6ed.jpg?v=1775785831</image:loc>
      <image:title>MMP10 Antibody</image:title>
      <image:caption>IHC testing of FFPE human breast cancer tissue with MMP10 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mobkl3-antibody-prei3-bha17107696</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d7a04b0e-5ea7-47fb-8582-570082232a12.jpg?v=1775785999</image:loc>
      <image:title>MOBKL3 Antibody / PREI3</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with MOBKL3 antibody at 0.3ug/ml. Predicted/observed molecular weight: ~26kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mmp9-antibody-bha17105317</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c20d6b68-6c63-4d99-aa99-302afc425a9f.jpg?v=1775785683</image:loc>
      <image:title>MMP9 Antibody</image:title>
      <image:caption>IHC staining of FFPE human colon adenocarcinoma with MMP9 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mnsod-antibody-sod2-bha17106726</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_85b366d2-969d-49b8-bb74-5691297ea8d5.jpg?v=1775785896</image:loc>
      <image:title>MNSOD Antibody [SOD2]</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with MNSOD antibody at 0.01ug/ml. Predicted molecular weight ~ 25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mms2-antibody-bha17106364</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_baa6b395-388c-460d-bd62-31d550f2f02a.jpg?v=1775785850</image:loc>
      <image:title>MMS2 Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with MMS2 antibody at 0.5ug/ml. Predicted molecular weight: ~16kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mon1a-antibody-bha17107143</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_20159d87-2394-4518-8c43-0686401fea62.jpg?v=1775785940</image:loc>
      <image:title>MON1A Antibody</image:title>
      <image:caption>Western blot testing of human pancreas lysate with MON1A antibody at 1ug/ml. Predicted molecular weight: ~55kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mnat1-antibody-bha17105472</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f25c48ea-c5f9-4916-bc1b-fdd24370e518.jpg?v=1775785694</image:loc>
      <image:title>MNAT1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with MNAT1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mogat2-antibody-bha17107306</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_99b5fea3-4e4e-4813-9743-5335a0063ed2.jpg?v=1775785958</image:loc>
      <image:title>MOGAT2 Antibody</image:title>
      <image:caption>Western blot testing of human duodenum lysate with MOGAT2 antibody at 0.05ug/ml. Predicted/observed molecular weight: ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mmp9-antibody-bha17105434</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d8411ed3-f324-422a-b4e0-d45a6b38a36d.jpg?v=1775785689</image:loc>
      <image:title>MMP9 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat NRK, 2) mouse ANA-1 and 3) mouse HEPA cell lysate with MMP9 antibody. Predicted molecular weight: 92/67-80 kDa (precursor/mature forms), observed here at ~78 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mmp13-antibody-collagenase-3-bha17105903</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_167c43a1-a318-4d20-bcde-614a82ef67c8.jpg?v=1775785774</image:loc>
      <image:title>MMP13 Antibody / Collagenase 3</image:title>
      <image:caption>Western blot testing of human 1) PC-3, 2) U-2 OS, 3) A549, 4) HEK293, 5) rabbit IgG, 6) marker, 7) human MDA-MB-453, 8) monkey COS-7, 9) rat lung and 10) mouse lung lysate with MMP13 antibody at 0.5ug/ml. Predicted molecular weight ~54 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/moesin-antibody-bha17107581</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ec7109c6-b742-4b1d-b3b2-83da792f1c5a.jpg?v=1775785989</image:loc>
      <image:title>Moesin Antibody</image:title>
      <image:caption>Western blot testing of human spleen lysate with Moesin antibody at 1ug/ml. Predicted molecular weight ~68 kDa but routinely observed at 68-78 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mpi-antibody-mannose-phosphate-isomerase-bha17105898</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7b4f4c00-6df7-4abb-924b-024dc3697fe5.jpg?v=1775785777</image:loc>
      <image:title>MPI Antibody / Mannose Phosphate Isomerase</image:title>
      <image:caption>Western blot testing of 1) rat testis and 2) human HeLa lysate with MPI antibody at 0.5ug/ml. Predicted molecular weight ~47 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mps1-antibody-bha17107797</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e693dee3-53ee-47fd-8582-dfb6d1b315c7.jpg?v=1775786012</image:loc>
      <image:title>MPS1 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with MPS1 antibody at 0.03ug/ml. Predicted molecular weight: ~10 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mpp2-antibody-maguk-p55-subfamily-member-2-bha17105865</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_15079417-ff4b-4067-8b1d-75a268a07832.jpg?v=1775785767</image:loc>
      <image:title>MPP2 Antibody / MAGUK p55 subfamily member 2</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse brain with MPP2 antibody at 0.5ug/ml. Predicted molecular weight: isoforms of ~46 kDa and 60-67 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mog-antibody-myelin-oligodendrocyte-glycoprotein-bha17106308</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cf6d03ff-d1d4-453b-a158-3cebbe836248.jpg?v=1775785840</image:loc>
      <image:title>MOG Antibody / Myelin Oligodendrocyte Glycoprotein</image:title>
      <image:caption>Western blot testing of human brain lysate with MOG antibody at 0.03ug/ml. Expected molecular weight: 15-28 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mmp3-antibody-bha17106647</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0df86762-ed16-4a77-9d38-e4c0a46be26a.jpg?v=1775785886</image:loc>
      <image:title>MMP3 Antibody</image:title>
      <image:caption>Western blot testing of human prostate lysate with MMP3 antibody at 0.2ug/ml. Molecular weight: the expected ~54 kDa band and the additional ~24kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mpp5-antibody-bha17107630</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b4959293-1553-453f-8359-c7927be72c81.jpg?v=1775785992</image:loc>
      <image:title>MPP5 Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with MPP5 antibody at 1ug/ml. Predicted molecular weight: ~77kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mrg15-antibody-biotin-conjugate-bha17106327</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a28f4455-639a-412d-bd39-6a31be7f58e3.jpg?v=1775785843</image:loc>
      <image:title>MRG15 Antibody [Biotin Conjugate]</image:title>
      <image:caption>Western blot testing of mouse liver lysate with MRG15 antibody at 3.3ug/ml. An NAP blocker was used in place of non-fat milk as blocking solution and diluent. (1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mpp1-antibody-membrane-palmitoylated-protein-1-bha17105864</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_36293ae6-f8e2-44f2-8977-d4999be135c6.jpg?v=1775785768</image:loc>
      <image:title>MPP1 Antibody / Membrane Palmitoylated Protein 1</image:title>
      <image:caption>Immunofluorescent staining of FFPE human MCF7 cells with MPP1 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/monoamine-oxidase-a-antibody-bha17106506</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_be394659-7f9a-449a-ab0e-6a52c5a9b1b3.jpg?v=1775785868</image:loc>
      <image:title>Monoamine Oxidase A Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with Monoamine Oxidase A antibody at 0.3ug/ml with [B] and without [A] the immunizing peptide. Predicted molecular weight: ~60kDa, observed here at ~70kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mouse-cd11b-antibody-mac-1-itgam-bha17105896</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1a1aafaf-b4a1-48de-8ff3-0f4e79c9efc1.jpg?v=1775785773</image:loc>
      <image:title>Mouse CD11b Antibody / MAC-1 / ITGAM</image:title>
      <image:caption>Western blot testing of mouse 1) brain and 2) HEPA lysate with mouse CD11b antibody at 0.5ug/ml. Expected molecular weight: 127~170 kDa due to glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mrgbp-antibody-bha17106404</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_91c5b516-8b99-4b80-a8d4-46793a76ccb6.jpg?v=1775785855</image:loc>
      <image:title>MRGBP Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with MRGBP antibody at 0.3ug/ml. Predicted molecular weight: ~22kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mrp4-antibody-abcc4-bha17105955</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5c7a3126-3080-4720-be83-f5041b1d7b4c.jpg?v=1775785785</image:loc>
      <image:title>MRP4 Antibody / ABCC4</image:title>
      <image:caption>Western blot testing of human COLO320 cell lysate with MRP4 antibody at 0.5ug/ml. Predicted molecular weight ~150 kDa, often observed at 170-200 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mrpl3-antibody-bha17107713</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8703d7dd-efdd-4d16-ab97-3ffbdf50d651.jpg?v=1775786002</image:loc>
      <image:title>MRPL3 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 cell lysate with MRPL3 antibody at 1ug/ml. Predicted molecular weight: ~38kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mps1-antibody-metallopan-stimulin-1-bha17105879</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_00eb6a14-0681-40e5-9a81-30a32689ed18.jpg?v=1775785772</image:loc>
      <image:title>MPS1 Antibody / Metallopan-stimulin 1</image:title>
      <image:caption>Western blot testing of 1) rat spleen, 2) mouse liver and 3) human HeLa lysate with MPS1 antibody at 0.5ug/ml. Predicted/observed molecular weight ~10 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mrgx1-antibody-bha17105613</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9f249ce8-df1f-4d93-ac88-715860b4b1de.jpg?v=1775785721</image:loc>
      <image:title>MRGX1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat heart, 2) rat skeletal muscle and 3) human MCF7 lysate with MRGX1 antibody. Expected molecular weight ~37 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mrp8-antibody-abcc11-bha17107521</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_36034e9d-05ff-4aea-880a-9ba3bf2137c5.jpg?v=1775785982</image:loc>
      <image:title>MRP8 Antibody / ABCC11</image:title>
      <image:caption>Western blot testing of human breast lysate with MRP8 antibody at 0.5ug/ml. Predicted molecular weight: ~154/150 kDa (isoforms 1/2), observed here at ~125 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mrg15-antibody-bha17106326</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c9345b14-050c-4e02-9737-adda76c12e33.jpg?v=1775785845</image:loc>
      <image:title>MRG15 Antibody</image:title>
      <image:caption>Western blot testing of mouse liver lysate with MRG15 antibody at 0.1ug/ml. Predicted molecular weight: ~41/37 kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mtmr9-antibody-bha17106302</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2dae21ac-e53d-49d1-8202-275adab9b63a.jpg?v=1775785840</image:loc>
      <image:title>MTMR9 Antibody</image:title>
      <image:caption>IHC staining of FFPE rat spleen with MTMR9 antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, DAB-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mta1-antibody-bha17107766</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_949f1db2-5468-4e88-986b-d74df4349266.jpg?v=1775786009</image:loc>
      <image:title>MTA1 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with MTA1 antibody at 0.03ug/ml. Predicted molecular weight: ~81 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/msh5-antibody-bha17107032</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5e1d739d-6829-479e-ace0-1ee074b873ae.jpg?v=1775785929</image:loc>
      <image:title>MSH5 Antibody</image:title>
      <image:caption>IHC testing of FFPE human testis with MSH5 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mthfd1l-antibody-bha17106714</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_695a59bd-60ba-4fe5-b899-57af859ac800.jpg?v=1775785894</image:loc>
      <image:title>MTHFD1L Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with MTHFD1L antibody at 0.1ug/ml. Predicted molecular weight: ~106 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mttfa-antibody-tfam-bha17105514</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5d277899-57c0-4fcb-8c11-ede94eab1684.jpg?v=1775785702</image:loc>
      <image:title>mtTFA Antibody / TFAM</image:title>
      <image:caption>IF/ICC staining of FFPE human A431 cells with mtTFA antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mst2-antibody-bha17106546</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b4f8750e-0edc-49aa-8de9-da19a781f56f.jpg?v=1775785875</image:loc>
      <image:title>MST2 Antibody</image:title>
      <image:caption>Western blot testing of NIH3T3 lysate with MST2 antibody at 1ug/ml. Predicted molecular weight: ~59/56kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mthfs-antibody-bha17107451</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d633efda-484c-429b-bf1b-cb40b40b7468.jpg?v=1775785973</image:loc>
      <image:title>MTHFS Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with MTHFS antibody at 0.5ug/ml with [B] and without [A] blocking/immunizing peptide. Predicted molecular weight: ~23kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/msc-antibody-bha17107798</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6944f51d-0ec0-4da2-9100-07789be54ec2.jpg?v=1775786011</image:loc>
      <image:title>MSC Antibody</image:title>
      <image:caption>Western blot testing of human bone marrow lysate with MSC antibody at 1ug/ml. Predicted molecular weight: ~24kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/muc19-antibody-bha17107378</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f9201cc4-7701-4a7a-9ec5-4593b8e9f1fc.jpg?v=1775785966</image:loc>
      <image:title>Muc19 Antibody</image:title>
      <image:caption>Immunofluorescence testing of mouse submandibular gland cells at E18 with Muc19 antibody at 4ug/ml (nuclear counterstain with DAPI in green).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/muc3-antibody-a-b-bha17105707</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3126c8e3-cd88-491e-914d-6f0de73b66ee.jpg?v=1775785735</image:loc>
      <image:title>MUC3 Antibody (A/B)</image:title>
      <image:caption>Western blot testing of human 1) SW620, 2) COLO320 and 3) Caco-2 cell lysate with MUC3 antibody. Expected molecular weight ~345 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mthfd2l-antibody-bha17107338</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f21daef9-60d4-492e-ba84-718e31f7d764.jpg?v=1775785962</image:loc>
      <image:title>MTHFD2L Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with MTHFD2L antibody at 0.1ug/ml. Predicted molecular weight: ~31kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/murf1-antibody-bha17106732</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1adbd8f1-2084-430d-b133-58361a2c1638.jpg?v=1775785901</image:loc>
      <image:title>MURF1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human skeletal muscle with MURF1 antibody at 1.25ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/munc13-4-antibody-bha17106991</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cab28f95-a305-48a2-9398-0b96faff8ce2.jpg?v=1775785926</image:loc>
      <image:title>Munc13-4 Antibody</image:title>
      <image:caption>Western blot testing of human T-lymphocyte lysate with Munc13-4 antibody at 2ug/ml. Predicted molecular weight: ~123kDa, observed here at ~105kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myd88-antibody-bha17107243</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cdc01864-c7f1-44e5-bbc4-ddb62361c366.jpg?v=1775785953</image:loc>
      <image:title>MyD88 Antibody</image:title>
      <image:caption>Western blot testing of human thymus lysate with MyD88 antibody at 0.03ug/ml. Predicted molecular weight ~33 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/munc18-1-antibody-stxbp1-bha17105497</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bb5c2a68-f4c7-4bcc-95ec-5a8d9d83769f.jpg?v=1775785698</image:loc>
      <image:title>MUNC18-1 Antibody / STXBP1</image:title>
      <image:caption>Immunofluorescent staining of FFPE human HeLa cells with MUNC18-1 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mucin-19-antibody-bha17106762</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7b7ee337-8fe9-4bd4-8721-7570f6d1661b.jpg?v=1775785899</image:loc>
      <image:title>Mucin 19 Antibody</image:title>
      <image:caption>IHC staining of cells of the sublingual salivary gland (SLG) in mouse, but not any cells of the submandibular salivary gland (SMG). Mucin 19 antibody was used at 1.8ug/ml.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/murf3-antibody-bha17107077</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a4b5a296-d823-4cec-82ce-9e02283e7e40.jpg?v=1775785935</image:loc>
      <image:title>MURF3 Antibody</image:title>
      <image:caption>Western blot testing of human muscle lysate with MURF3 antibody at 1ug/ml. Predicted molecular weight: ~43/38 kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/musashi-antibody-msi1-bha17105958</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8c951313-fa28-42b7-ba82-7487788ea5fd.jpg?v=1775785786</image:loc>
      <image:title>Musashi Antibody / MSI1</image:title>
      <image:caption>IHC testing of FFPE human breast cancer tissue with Musashi antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myb-antibody-bha17107185</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c6542c43-b1e1-446b-9fd5-b95941691f69.jpg?v=1775785947</image:loc>
      <image:title>MYB Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with MYB antibody at 0.5ug/ml. Predicted molecular weight 37~85 kDa (isoforms 1-12), observed here at ~85kDa..</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myd88-antibody-bha17106106</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_77f5afdd-5f86-4fe6-97bf-4248d8a05ba3.jpg?v=1775785809</image:loc>
      <image:title>MyD88 Antibody</image:title>
      <image:caption>Western blot testing of 1) mouse spleen, 2) mouse testis and 3) rat spleen lysate with MyD88 antibody at 0.5ug/ml. Predicted molecular weight ~33 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myelin-protein-zero-antibody-mpz-bha17106571</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_693c454e-c079-42af-8fea-76c5fc191407.jpg?v=1775785877</image:loc>
      <image:title>Myelin Protein Zero Antibody / MPZ</image:title>
      <image:caption>Western blot testing of rat spinal cord lysate with Myelin Protein Zero antibody at 0.1ug/ml. Predicted molecular weight: ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myh1-antibody-mutyh-bha17107142</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_26348093-ad4e-4084-908c-3e88e7b2bea9.jpg?v=1775785940</image:loc>
      <image:title>MYH1 Antibody [MUTYH]</image:title>
      <image:caption>Western blot testing of human bone marrow lysate with MYH1 antibody at 0.1ug/ml. Predicted molecular weight: ~60kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myh9-antibody-bha17106665</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7b1563dd-4692-429e-8ca9-a3d17e5691bc.jpg?v=1775785888</image:loc>
      <image:title>MYH9 Antibody</image:title>
      <image:caption>Western blot testing of human peripheral blood lymphocyte lysate with MYH9 antibody at 0.3ug/ml. Predicted molecular weight: ~227kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/mylk-antibody-myosin-light-chain-kinase-bha17107282</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a82a80fa-4c1f-4187-ba4b-fa6568eaa0ff.jpg?v=1775785956</image:loc>
      <image:title>MYLK Antibody / Myosin light chain kinase</image:title>
      <image:caption>Western blot testing of human colon lysate with MYLK antibody at 0.03ug/ml. Predicted molecular weight: isoforms from 197-211 kDa and ~110 kDa, observed here at ~150 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myoglobin-antibody-n-terminal-region-bha17106239</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2e2e2b4d-8332-4605-9cd9-ffe623869a75.jpg?v=1775785830</image:loc>
      <image:title>Myoglobin Antibody (N-Terminal Region)</image:title>
      <image:caption>Western blot testing of human 1) HepG2, 2) HeLa, 3) HL-60 and 4) Jurkat cell lysate with Myoglobin antibody at 0.5ug/ml. Predicted molecular weight ~17 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myo1h-antibody-bha17106774</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_af67d3fa-847b-4c1f-a11a-3666710cb6bd.jpg?v=1775785899</image:loc>
      <image:title>Myo1H Antibody</image:title>
      <image:caption>Western blot testing of NIH3T3 lysate with Myo1H antibody at 0.1ug/ml. The expected ~110 kDa band and the additional ~28 kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myf5-antibody-bha17107745</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fc3a161e-4108-43b1-be69-a1da174ec252.jpg?v=1775786005</image:loc>
      <image:title>MYF5 Antibody</image:title>
      <image:caption>Western blot testing of muscle lysate with MYF5 antibody at 0.5ug/ml with [B] and without [A] blocking/immunizing peptide. Predicted molecular weight ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myd88-antibody-biotin-conjugate-bha17107244</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_90c9e856-313d-49d5-bdff-93406316c345.jpg?v=1775785953</image:loc>
      <image:title>MyD88 Antibody [Biotin Conjugate]</image:title>
      <image:caption>Western blot testing of human thymus lysate with biotinylated MyD88 antibody at 0.2ug/ml. Predicted molecular weight ~33 kDa. An NAP blocker was used in place of non-fat milk as blocking solution and diluent. (1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myeloperoxidase-antibody-bha17106582</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_14d01254-f421-4d39-aebf-7fc8daa7dea8.jpg?v=1775785878</image:loc>
      <image:title>Myeloperoxidase Antibody</image:title>
      <image:caption>Western blot testing of human peripheral blood lymphocyte lysate with Myeloperoxidase antibody at 0.3ug/ml. Expected molecular weight: 59-64 kDa (alpha chain, may be observed at higher molecular weights due to glycosylation), 150+ kDa (glycosylated mature form).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myo9b-antibody-bha17107402</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_71d09030-900e-45b9-a5e6-4a3db989fec3.jpg?v=1775785969</image:loc>
      <image:title>MYO9B Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with MYO9B antibody at 2ug/ml. Predicted molecular weight: ~243kDa, observed here at ~200kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myrip-antibody-bha17107274</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bbaa856c-4100-4e70-bcee-4e25a9e4a5ed.jpg?v=1775785956</image:loc>
      <image:title>MYRIP Antibody</image:title>
      <image:caption>Western blot testing of human amygdala lysate with MYRIP antibody at 0.3ug/ml. Predicted molecular weight: ~95 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myd88-antibody-bha17106107</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4905cae2-8268-4f41-b487-d0eb6a0fdbad.jpg?v=1775785808</image:loc>
      <image:title>MyD88 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver and 2) rat ovary lysate with MyD88 antibody at 0.5ug/ml. Predicted molecular weight ~33 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myo5a-antibody-bha17106985</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a5275723-c657-4fd3-bee2-96bf5a7cf203.jpg?v=1775785923</image:loc>
      <image:title>MYO5A Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with MYO5A antibody at 1ug/ml. Predicted molecular weight: ~215kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nanog-antibody-bha17106086</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3e8517c9-174d-428f-b64c-2fd9ca2431fe.jpg?v=1775785806</image:loc>
      <image:title>NANOG Antibody</image:title>
      <image:caption>Western blot testing of 1) rat ovary, 2) mouse ovary and 3) human MCF7 cell lysate with NANOG antibody at 0.5ug/ml. Predicted molecular weight: 35-45 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/myotilin-antibody-bha17106699</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_50ee5c34-413b-407e-9894-f1bb8a59eaa0.jpg?v=1775785891</image:loc>
      <image:title>Myotilin Antibody</image:title>
      <image:caption>Western blot testing of human skeletal muscle lysate with Myotilin antibody at 0.1ug/ml. Predicted molecular weight: ~55/35kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nac1-antibody-btbd14b-bha17107494</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_42c88306-b5fb-4187-8c2e-1f0eca02ef28.jpg?v=1775785978</image:loc>
      <image:title>NAC1 Antibody / BTBD14B</image:title>
      <image:caption>Western blot testing of human bone marrow lysate with NAC1 antibody at 0.5ug/ml. Predicted molecular weight: ~57 kDa, commonly observed at 57-70 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nanog-antibody-bha17106608</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_37c67691-f0e0-4afa-90bb-3adb96af319b.jpg?v=1775785881</image:loc>
      <image:title>NANOG Antibody</image:title>
      <image:caption>Western blot testing of HeLa (nuclear) cell lysate with NANOG antibody at 0.05ug/ml. Predicted molecular weight: 35~45kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nat1-antibody-bha17106005</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_006fc298-b792-4bd3-b0fc-bac3b3463542.jpg?v=1775785790</image:loc>
      <image:title>NAT1 Antibody</image:title>
      <image:caption>Western blot testing of human A431 cell lysate with NAT1 antibody at 0.5ug/ml. Predicted molecular weight ~34 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nalp3-antibody-cias1-bha17106848</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2ab93f08-7a66-4662-9167-f8d7f60e091b.jpg?v=1775785908</image:loc>
      <image:title>NALP3 Antibody / CIAS1</image:title>
      <image:caption>FACS testing of fixed and permeabilized human U937 cells with NALP3 antibody (blue) at 10ug/10^6 cells and naive goat Ig (black).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ncam-antibody-isoform-2-bha17107265</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_16d1a562-2def-466f-86fb-497c6a75defb.jpg?v=1775785955</image:loc>
      <image:title>NCAM Antibody (isoform 2)</image:title>
      <image:caption>IHC testing of FFPE human adrenal gland tissue with NCAM antibody at 5ug/ml. Required HIER: steamed antigen retrieval with pH6 citrate buffer; AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nanog-antibody-bha17106607</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_978c9aab-91a0-482b-a3c1-5b384c65fcc6.jpg?v=1775785881</image:loc>
      <image:title>Nanog Antibody</image:title>
      <image:caption>Western blot testing of NIH3T3 lysate with Nanog antibody at 0.5ug/ml. Predicted molecular weight: 35~45kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/narg1-antibody-naa15-bha17106083</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3c86769c-7f99-4c97-b2f3-36dc3097c006.jpg?v=1775785805</image:loc>
      <image:title>NARG1 Antibody / NAA15</image:title>
      <image:caption>Western blot testing of human 293T cell lysate with NARG1 antibody at 0.5ug/ml. Predicted molecular weight ~101 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nat1-antibody-bha17107626</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_da1b2e1b-e4bf-4362-ad60-7af4fbff0145.jpg?v=1775785993</image:loc>
      <image:title>NAT1 Antibody</image:title>
      <image:caption>Western blot testing of human erythrocytes lysate with NAT1 antibody at 1ug/ml. Predicted molecular weight: ~34kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nbs1-antibody-nlrp2-bha17107411</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e9b2c4ec-416b-4870-9485-44afd65387e3.jpg?v=1775785970</image:loc>
      <image:title>NBS1 Antibody [NLRP2]</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing human NLRP2/NBS1 with DYKDDDDK tag with NBS1 antibody [1ug/ml] in Lane A and probed with anti-DYKDDDDK tag (1/5000) in lane C. Mock-transfected HEK293 probed with NBS1 antibody [1ug/ml] in Lane B.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ndr1-antibody-bha17107431</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9255fcbf-aaf3-453a-aa0a-946b9c491770.jpg?v=1775785973</image:loc>
      <image:title>NDR1 Antibody</image:title>
      <image:caption>Western blot testing of human spleen lysate with NDR1 antibody at 0.5ug/ml. Predicted molecular weight: ~54kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nckap1-antibody-bha17106099</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bb6cccc9-9e7f-40b6-852e-dc350bd3636d.jpg?v=1775785810</image:loc>
      <image:title>NCKAP1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain, 3) human MCF7 and 4) human 293T lysate with NCKAP1 antibody at 0.5ug/ml. Expected molecular weight: 125-129 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ndrg2-antibody-bha17105677</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6651f0fd-a933-41d9-b5f8-0445beb99dc8.jpg?v=1775785734</image:loc>
      <image:title>NDRG2 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human T-47D cells with NDRG2 antibody (green). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ndrg1-antibody-biotin-conjugate-bha17107069</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c39f204f-4215-4a28-a979-216ffb458d5d.jpg?v=1775785931</image:loc>
      <image:title>NDRG1 Antibody [Biotin Conjugate]</image:title>
      <image:caption>Western blot testing of human kidney lysate with NDRG1 antibody at 2ug/ml. Predicted molecular weight ~43kDa. An NAP blocker was used in place of non-fat milk as blocking solution and diluent. (1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ndrg2-antibody-bha17107285</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fcaf1b74-1077-4dc6-b9e7-533e166b367d.jpg?v=1775785956</image:loc>
      <image:title>NDRG2 Antibody</image:title>
      <image:caption>Western blot testing of human temporal cortex lysate with NDRG2 antibody at 0.1ug/ml. Predicted molecular weight: ~41kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ndufa7-antibody-bha17107788</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e53ef83c-d8b5-4120-9423-d04fba58d45f.jpg?v=1775786012</image:loc>
      <image:title>NDUFA7 Antibody</image:title>
      <image:caption>Western blot testing of human [A], mouse [B] and rat [C] heart lysates with NDUFA7 antibody at 0.1ug/ml. Predicted molecular weight: ~13kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ncam2-antibody-bha17107517</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_97b7e250-c739-4275-81e5-5127da04dcf0.jpg?v=1775785982</image:loc>
      <image:title>NCAM2 Antibody</image:title>
      <image:caption>IHC: 48h-staining of PFA-perfused cryosection of mouse olfactory bulb with NCAM2 antibody at 0.5ug/ml. HIER: pH6 citrate buffer at 95oC for 10min. Staining: NCAM2 (red), VGLUT2 (blue) and NQO1 (green).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ndrg1-antibody-bha17107068</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e3e7f575-f6f1-4397-a121-de0f66ad9731.jpg?v=1775785932</image:loc>
      <image:title>NDRG1 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with NDRG1 antibody at 0.1ug/ml. Predicted molecular weight ~43 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ndufs8-antibody-nadh-ubiquinone-oxidoreductase-23-kda-subunit-bha17106304</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b85b3358-b506-4746-b968-93fd75db6459.jpg?v=1775785841</image:loc>
      <image:title>NDUFS8 Antibody / NADH-ubiquinone oxidoreductase 23 kDa subunit</image:title>
      <image:caption>Western blot testing of mouse heart lysate with NDUFS8 antibody at 0.1ug/ml. Predicted molecular weight: ~24kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ndel1-antibody-bha17106463</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fbcc5a3e-faff-4c6f-becf-8e573a747df9.jpg?v=1775785862</image:loc>
      <image:title>NDEL1 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with NDEL1 antibody at 0.1ug/ml. Predicted molecular weight: ~38/41/37kDa (isoforms 1/2/3).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nectin-4-antibody-pvrl4-bha17105877</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e6eafec5-0916-4da8-9429-91a852257425.jpg?v=1775785769</image:loc>
      <image:title>Nectin-4 Antibody / PVRL4</image:title>
      <image:caption>Western blot testing of human 1) MCF7 and 2) MM453 lysate with Nectin-4 antibody at 0.5ug/ml. Expected molecular weight ~55 kDa (unmodified), ~66 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nedd9-antibody-hef1-cas-l-bha17107640</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9d62c167-7a69-4ebe-a381-30e19e3d92a1.jpg?v=1775785996</image:loc>
      <image:title>NEDD9 Antibody / hEF1 / CAS-L</image:title>
      <image:caption>Western blot testing of human kidney lysate with NEDD9 antibody at 0.1ug/ml. Predicted molecular weight: ~93kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neil1-antibody-bha17106576</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b3cd1fcf-be70-402e-85d6-58318a9f06ec.jpg?v=1775785878</image:loc>
      <image:title>NEIL1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of fixed and permeabilized human U937 cells with NEIL1 antibody (green) at 10ug/ml and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ncf4-antibody-bha17107272</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5055229b-dfa7-4381-be02-8dc4dd99ce0c.jpg?v=1775785955</image:loc>
      <image:title>NCF4 Antibody</image:title>
      <image:caption>Western blot testing of Daudi cell lysate with NCF4 antibody at 0.5ug/ml. Predicted molecular weight: ~39kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nedd8-antibody-bha17105905</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d03eb327-2b3e-4fe3-ab6e-e73ad04b2dc0.jpg?v=1775785776</image:loc>
      <image:title>NEDD8 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with NEDD8 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/net1-antibody-bha17106580</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b876bfbf-e095-4b2b-a46a-2a4a60c44f70.jpg?v=1775785879</image:loc>
      <image:title>NET1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human tonsil with NET1 antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ndufs3-antibody-bha17106716</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_838477b3-9491-4f93-a02d-f3c6cefd9665.jpg?v=1775785895</image:loc>
      <image:title>NDUFS3 Antibody</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with NDUFS3 antibody at 0.3ug/ml. Predicted molecular weight: ~30 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/net1-antibody-bha17106593</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_54598205-f4e8-46ed-9cfc-65c4b6f2a2cd.jpg?v=1775785881</image:loc>
      <image:title>NET1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human breast with NET1 antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nephrin-antibody-bha17105961</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d40755a6-2c94-4d92-9274-63743168d693.jpg?v=1775785784</image:loc>
      <image:title>Nephrin Antibody</image:title>
      <image:caption>Western blot testing of 1) rat kidney, 2) mouse kidney and 3) human 293T lysate with Nephrin antibody at 0.5ug/ml. Expected molecular weight: 134 kDa (unmodified), 150-180 kDa (modified).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ndrg3-antibody-bha17106090</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d133a2b2-1ad9-46bf-9a04-7654884688e8.jpg?v=1775785808</image:loc>
      <image:title>NDRG3 Antibody</image:title>
      <image:caption>Western blot testing of human COLO320 cell lysate with NDRG3 antibody at 0.5ug/ml. Predicted molecular weight ~41 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nek7-antibody-bha17107708</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_93dc47fa-f615-4aca-82b9-a3064c47281e.jpg?v=1775786005</image:loc>
      <image:title>NEK7 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with NEK7 antibody at 0.05ug/ml. Predicted molecular weight: ~34kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neurod4-antibody-bha17107155</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1ea08e0d-ac89-4aea-9edb-f46ca4987e63.jpg?v=1775785942</image:loc>
      <image:title>NeuroD4 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with NeuroD4 antibody at 1ug/ml. Predicted molecular weight: ~38kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nestin-antibody-nes-bha17105453</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_200d8beb-503b-440f-b168-09d02b146acf.jpg?v=1775785691</image:loc>
      <image:title>Nestin Antibody / NES</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) HepG2 cell lysate with Nestin antibody. Predicted molecular weight ~177 kDa but can be observed at up to 240 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neurofascin-antibody-bha17107603</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4cd7c4aa-21ef-4762-aacd-83ec9b06011f.jpg?v=1775785990</image:loc>
      <image:title>Neurofascin Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with Neurofascin antibody at 0.5ug/ml. Molecular weight: observed here at ~170kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neurofibromin-2-antibody-zebrafish-bha17106853</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5e2e82b0-f9c4-4b88-9178-b68c3e9b1065.jpg?v=1775785909</image:loc>
      <image:title>Neurofibromin 2 Antibody (Zebrafish)</image:title>
      <image:caption>Neurofibromin 2 Antibody (Zebrafish)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neurexin-1-antibody-bha17107299</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0d873c2f-81bd-47f1-b5e9-cb88061beefd.jpg?v=1775785957</image:loc>
      <image:title>Neurexin 1 Antibody</image:title>
      <image:caption>Western blot of HEK293 lysate overexpressing human NRXN1-FLAG probed with Neurexin 1 antibody (0.5ug/ml) in Lane A and anti-FLAG (1/3000) in lane C. Mock-transfected HEK293 probed with Neurexin 1 antibody (1ug/ml) in Lane B. Predicted molecular weight: ~162/49kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/netrin-1-antibody-ntn1-bha17107317</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3d2596c2-79f2-420c-831e-f52a991a8cd8.jpg?v=1775785959</image:loc>
      <image:title>Netrin 1 Antibody / NTN1</image:title>
      <image:caption>Western blot testing of rat brain lysate with Netrin 1 antibody at 0.5ug/ml. Expected molecular weight: 68-75 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neurocan-antibody-bha17106260</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2c6646bd-eca0-4f32-ba19-75b017ced6d8.jpg?v=1775785833</image:loc>
      <image:title>Neurocan Antibody</image:title>
      <image:caption>Western blot tesing of rat 1) brain and 2) testis lysate with Neurocan antibody at 0.5ug/ml. Predicted molecular weight ~143 kDa (unmodified), up to ~250 kDa (fully glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nek7-antibody-bha17106403</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_337822ac-4578-4ba2-8ea7-1582c2d22a5b.jpg?v=1775785857</image:loc>
      <image:title>NEK7 Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with NEK7 antibody at 0.1ug/ml. Predicted molecular weight: ~34kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neurogranin-antibody-biotin-conjugate-bha17107349</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fd2ce861-21ea-4622-88e9-bec208f5d497.jpg?v=1775785965</image:loc>
      <image:title>Neurogranin Antibody (Biotin Conjugate)</image:title>
      <image:caption>Western blot testing of human brain (frontal cortex) lysate with biotinylated Neurogranin antibody at 0.1ug/ml. Predicted molecular weight: ~8 kDa but routinely observed at ~17 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neuroligin-2-antibody-bha17107666</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4a975549-d836-4d12-83b1-2cda554a1310.jpg?v=1775785997</image:loc>
      <image:title>Neuroligin 2 Antibody</image:title>
      <image:caption>Western blot testing of human pancreas lysate with Neuroligin 2 antibody at 0.1ug/ml. Predicted molecular weight: ~91kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neurobeachin-antibody-bha17106549</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_701fba86-58eb-4b18-99a8-f39a7c6ed1f0.jpg?v=1775785873</image:loc>
      <image:title>Neurobeachin Antibody</image:title>
      <image:caption>IHC staining of FFPE human cerebral cortex with Neurobeachin antibody at 5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neutrophil-elastase-antibody-hne-bha17105844</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7362ad67-35e4-407d-8265-4bf02a0c63e7.jpg?v=1775785764</image:loc>
      <image:title>Neutrophil Elastase Antibody / HNE</image:title>
      <image:caption>IHC staining of FFPE mouse spleen tissue with TCP1 antibody, HRP-labeled secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ndufs8-antibody-nadh-ubiquinone-oxidoreductase-23-kda-subunit-bha17106743</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f6748cd6-dd4b-4806-a4a4-ae2c2a4ee634.jpg?v=1775785897</image:loc>
      <image:title>NDUFS8 Antibody / NADH-ubiquinone oxidoreductase 23 kDa subunit</image:title>
      <image:caption>IF/ICC staining of fixed and permeabilized human A431 cells with NDUFS8 antibody (green) at 10ug/ml and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neuroblastoma-antibody-bha17107380</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6dbc3ec4-58e8-41bb-80ad-52861ee4fe35.jpg?v=1775785966</image:loc>
      <image:title>Neuroblastoma Antibody</image:title>
      <image:caption>Western blot testing of KELLY cell lysate with Neuroblastoma antibody at 0.1ug/ml. Predicted molecular weight: ~23kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neurogranin-antibody-nrgn-bha17107348</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a345a4b8-f0da-4b6c-989f-6f7a3e6b0bd1.jpg?v=1775785964</image:loc>
      <image:title>Neurogranin Antibody / NRGN</image:title>
      <image:caption>Western blot testing of human brain (frontal cortex) lysate with Neurogranin antibody at 0.1ug/ml. Predicted molecular weight: ~8 kDa but routinely observed at ~17 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neurturin-antibody-bha17106501</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b17ca85e-d1b0-40d4-ba75-792de0b2a6e8.jpg?v=1775785866</image:loc>
      <image:title>Neurturin Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with Neurturin antibody at 0.1ug/ml. Predicted molecular weight: ~22kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nfat1-antibody-nfatc2-bha17106167</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bec5d74b-92be-4ce1-97fb-289061cdde1a.jpg?v=1775785818</image:loc>
      <image:title>NFAT1 Antibody / NFATC2</image:title>
      <image:caption>Western blot testing of human K562 cell lysate with NFAT1 antibody at 0.5ug/ml. Predicted molecular weight ~100 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neuroserpin-antibody-bha17105641</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1bb0492e-c563-4646-8024-aae819dc88fb.jpg?v=1775785725</image:loc>
      <image:title>Neuroserpin Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain, and 3) PANC lysate with Neuroserpin antibody. Expected/observed molecular weight ~46 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neurotrophin-4-antibody-bha17107017</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d5213b17-a46b-4bb7-8523-09417456e0c0.jpg?v=1775785927</image:loc>
      <image:title>Neurotrophin 4 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with Neurotrophin 4 antibody at 0.1ug/ml. Expected molecular weight: 22-45 depending on level of glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/neurturin-antibody-bha17106720</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_04cc7316-6939-4bfb-af2b-911c28b06dbe.jpg?v=1775785894</image:loc>
      <image:title>Neurturin Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with Neurturin antibody at 0.1ug/ml. The expected ~23kDa band and the additional ~50kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nfatc4-antibody-bha17106217</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fb505e55-6a70-4c62-ab9e-b20e7ca69ee6.jpg?v=1775785829</image:loc>
      <image:title>NFATC4 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) mouse testis, 3) human HeLa, 4) human A549 and 6) human SK-OV-3 lysate with NFATC4 antibody at 0.5ug/ml. Predicted molecular weight ~95 kDa, also can be observed at 120-140 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nfat4-antibody-nfatc3-bha17106222</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e2743491-ba41-48a5-b460-1dbe082f32e5.jpg?v=1775785828</image:loc>
      <image:title>NFAT4 Antibody / NFATC3</image:title>
      <image:caption>Western blot testing of human 22RV1 cell lysate with NFAT4 antibody at 0.5ug/ml. Predicted molecular weight: ~116 kDa but can be observed at 140~150 kDa due to phosphorylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nfatc3-antibody-nfat4-bha17107174</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_00e3af32-071a-4b92-aa3c-3ee68935dd70.jpg?v=1775785945</image:loc>
      <image:title>NFATC3 Antibody / NFAT4</image:title>
      <image:caption>Western blot testing of Jurkat nuclear lysate with NFATC3 antibody at 0.03ug/ml. Predicted molecular weight: ~116 kDa but can be observed at 140~150 kDa due to phosphorylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nfia-antibody-nuclear-factor-1-a-type-bha17105866</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_46184afb-e2a7-43f3-9700-021a696e4477.jpg?v=1775785769</image:loc>
      <image:title>NFIA Antibody / Nuclear factor 1 A-type</image:title>
      <image:caption>IHC staining of FFPE mouse brain tissue with NFIA antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nfat2-antibody-nfatc1-isoforms-a-b-c-bha17106122</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_74e64f6b-9198-4982-8fa0-82ff807a31cb.jpg?v=1775785812</image:loc>
      <image:title>NFAT2 Antibody / NFATC1 (isoforms A/B/C)</image:title>
      <image:caption>Flow cytometry testing of fixed and permeabilized human Jurkat cells with NFAT2 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NFAT2 antibody.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nherf2-antibody-isoform-a-bha17106561</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_78799386-24a4-4f8f-8e3e-202bdfcf02e8.jpg?v=1775785877</image:loc>
      <image:title>NHERF2 Antibody [Isoform a]</image:title>
      <image:caption>Western blot testing of human kidney lysate with NHERF2 antibody at 0.3ug/ml. Predicted molecular weight: ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ngal-antibody-bha17107195</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_46c7257e-e06c-4d1c-a0d7-3567da29a897.jpg?v=1775785948</image:loc>
      <image:title>NGAL Antibody</image:title>
      <image:caption>Western blot testing of mouse kidney lysate with NGAL antibody at 2ug/ml. Predicted molecular weight: 22-25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ngf-antibody-nerve-growth-factor-bha17105970</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0973bd63-e578-45d3-a576-69c351ff8118.jpg?v=1775785785</image:loc>
      <image:title>NGF Antibody / Nerve Growth Factor</image:title>
      <image:caption>Western blot testing of recombinant human NGF partial protein (0.5ng/lane) with NGF antibody at 0.5ug/ml.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ngfr-antibody-bha17106316</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_808e0b2f-7280-41ac-beca-995bea2e1f99.jpg?v=1775785842</image:loc>
      <image:title>NGFR Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with NGFR antibody at 0.3ug/ml. Predicted molecular weight ~45/75kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ngal-antibody-lipocalin-2-lcn2-bha17105508</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fd293fc0-3130-4c51-8b38-33bd581ffd77.jpg?v=1775785701</image:loc>
      <image:title>NGAL Antibody / Lipocalin 2 / LCN2</image:title>
      <image:caption>Western blot testing of human 1) A549 and 2) SMMC cell lysate with NGAL antibody at 0.5ug/ml. Predicted/observed molecular weigth: 22-25 kDa (monomer).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ngfr-antibody-bha17107747</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ae8e559b-0f40-4141-a177-db33db834dc5.jpg?v=1775786005</image:loc>
      <image:title>NGFR Antibody</image:title>
      <image:caption>Western blot testing of rat heart lysate with NGFR antibody at 1ug/ml. Predicted molecular weight ~45/75kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nip-antibody-gipc1-bha17107024</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6cf4c822-d27c-4685-ba2f-6d0b7d572211.jpg?v=1775785928</image:loc>
      <image:title>NIP Antibody [GIPC1]</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate and NIP antibody at 0.03ug/ml. Predicted molecular weight: ~36/26kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nkg2d-antibody-bha17107523</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0865e9ea-f0cc-437f-9be7-8dd16aa86605.jpg?v=1775785983</image:loc>
      <image:title>NKG2D Antibody</image:title>
      <image:caption>Western blot testing of human spleen lysate with NKG2D antibody at 0.3ug/ml. Predicted molecular weight ~25/35kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nlrp12-antibody-bha17106516</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cf183227-380e-48eb-bbe3-8c00a028c183.jpg?v=1775785869</image:loc>
      <image:title>Nlrp12 Antibody</image:title>
      <image:caption>Western blot testing of mouse liver lysate with Nlrp12 antibody at 1ug/ml. Predicted molecular weight: ~119kDa, routinely observed at 100~119kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nlrp3-antibody-bha17106625</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_db527404-58c5-4c65-b2cc-0403b3631ff1.jpg?v=1775785883</image:loc>
      <image:title>NLRP3 Antibody</image:title>
      <image:caption>IHC testing of FFPE human tonsil with NLRP3 antibody at 2ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nlrc4-antibody-card12-bha17105658</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_40ff687e-10f3-46e3-889e-f979633a7340.jpg?v=1775785728</image:loc>
      <image:title>NLRC4 Antibody / CARD12</image:title>
      <image:caption>Western blot testing of 1) human 22RV1, 2) RH35 and 3) mouse NIH3T3 lysate with NLRC4 antibody. Expected/observed molecular weight ~116 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nlgn4x-antibody-bha17107720</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b5139fde-aadc-40b5-8945-df0240360e28.jpg?v=1775786004</image:loc>
      <image:title>NLGN4X Antibody</image:title>
      <image:caption>Western blot testing of amygdala lysate with NLGN4X antibody at 1ug/ml. Predicted molecular weight: ~92kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nipp1-antibody-bha17106761</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_23c083b7-6bcf-46ae-af3e-b32128c623c3.jpg?v=1775785898</image:loc>
      <image:title>NIPP1 Antibody</image:title>
      <image:caption>Western blot testing of human HeLa [A], HepG2 [B], Jurkat [C] and mouse NIH3T3 [D] nuclear lysate with NIPP1 antibody at 1ug/ml. Predicted molecular weight: ~39kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nme1-antibody-bha17106737</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ead3102a-2243-4dad-8993-79e1e14dd038.jpg?v=1775785896</image:loc>
      <image:title>NME1 Antibody</image:title>
      <image:caption>Western blot testing of A549 [A] and HeLa [B] lysates with NME1 antibody at 0.01ug/ml. Predicted molecular weight: ~20/17kDa (isoforms a/b).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nmdar2c-antibody-bha17105563</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_41f0031e-249c-442e-963a-2d2b968952f0.jpg?v=1775785712</image:loc>
      <image:title>NMDAR2C Antibody</image:title>
      <image:caption>Western blot testing of rat brain lysate with NMDAR2C antibody. Expected/observed molecular weight ~134 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nlrp12-antibody-bha17107424</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c8ea2f33-9187-42e0-825f-e738909d706d.jpg?v=1775785971</image:loc>
      <image:title>Nlrp12 Antibody</image:title>
      <image:caption>Western blot testing of mouse spleen lysate with Nlrp12 antibody at 1ug/ml. Predicted molecular weight: ~119kDa, routinely observed at 100~119kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nm23-antibody-nme1-bha17105325</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_acc9c0ce-4933-4a67-b7f1-428e585ea5b2.jpg?v=1775785674</image:loc>
      <image:title>NM23 Antibody / NME1</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat liver, 3) rat lung, 4) rat C6, 5) mouse brain, 6) mouse liver, 7) mouse lung and 8) mouse NIH 3T3 cell lysate with NM23 antibody. Expected molecular weight: 17/20 kDa (NM23-H1A/-H1B).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nlrx1-antibody-bha17107602</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_71a22415-f8ea-4683-ad8a-6a86e177e94d.jpg?v=1775785991</image:loc>
      <image:title>NLRX1 Antibody</image:title>
      <image:caption>Western blot testing of human breast cancer lysate with NLRX1 antibody at 2ug/ml. Predicted molecular weight: ~108/102kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nmnat3-antibody-bha17107257</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c8c7c6b8-ce55-4ba0-985a-996b43a01a3e.jpg?v=1775785953</image:loc>
      <image:title>Nmnat3 Antibody</image:title>
      <image:caption>Western blot testing of mouse heart lysate with Nmnat3 antibody at 0.5ug/ml. Predicted/observed molecular weight: ~28kDa. Both observed bands are blocked by addition of immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/noggin-antibody-nog-bha17106243</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2c5839fe-acd6-4037-bcc2-a2c5c727537b.jpg?v=1775785831</image:loc>
      <image:title>Noggin Antibody / NOG</image:title>
      <image:caption>IHC staining of FFPE human placental tissue with Noggin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/no66-antibody-bha17107029</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a12bd58f-c102-42a7-bcb5-f344c0d7caeb.jpg?v=1775785928</image:loc>
      <image:title>NO66 Antibody</image:title>
      <image:caption>Western blot testing of A431 cell lysate with NO66 antibody at 0.3ug/ml. Predicted molecular weight: ~71 kDa. Both observed bands are blocked by addition of the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nn-antibody-bha17107111</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b046be99-6901-4c3d-be7b-24058a6eddbd.jpg?v=1775785936</image:loc>
      <image:title>nn Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with SDHAF1 antibody at 0.3ug/ml. Predicted molecular weight: ~13kDa, observed here at ~19kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nogo-66-receptor-antibody-bha17107557</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_80814b44-7ab9-4039-a81c-0aa08cd5efaa.jpg?v=1775785984</image:loc>
      <image:title>Nogo 66 receptor Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with Nogo 66 receptor antibody at 0.3ug/ml with [B] and without [A] blocking/immunizing peptide</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nmdar2b-antibody-bha17105545</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5d5682ab-2183-4cdb-aba5-d0df140492cb.jpg?v=1775785707</image:loc>
      <image:title>NMDAR2B Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat C6 and 3) mouse brain lysate with NMDAR2B antibody. Expected molecular weight ~166 kDa but may be observed at higher molecular weights due to glycosylation.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nono-antibody-bha17107679</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_91cb3fe9-e937-4130-bc69-60252aa4821a.jpg?v=1775786001</image:loc>
      <image:title>NONO Antibody</image:title>
      <image:caption>IHC staining of FFPE human spleen using NONO antibody at 3.8ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nodal-antibody-bha17106764</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fdef1ab1-7a33-43fe-a425-8eb0c2bfaad6.jpg?v=1775785898</image:loc>
      <image:title>NODAL Antibody</image:title>
      <image:caption>Sandwich ELISA with NODAL antibody at 1.5ug/ml as the detect</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nos1-antibody-nnos-bha17106964</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f566baa7-dafa-4247-bcac-68a4c2ad76db.jpg?v=1775785922</image:loc>
      <image:title>NOS1 Antibody / nNOS</image:title>
      <image:caption>Western blot testing of human skeletal muscle lysate with NOS1 antibody at 0.1ug/ml. Predicted/observed molecular weight: ~161 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nnmt-antibody-bha17107739</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_56a97885-9be6-4120-85b0-1741d14850f1.jpg?v=1775786005</image:loc>
      <image:title>NNMT Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with NNMT antibody at 0.3ug/ml. Predicted molecular weight: ~29kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/npas2-antibody-bha17106221</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cfff0888-efcd-44d6-a052-6adc0bbe2bc0.jpg?v=1775785826</image:loc>
      <image:title>NPAS2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain and 3) human COLO 320 lysate with NPAS2 antibody at 0.5ug/ml. Predicted molecular weight ~92 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nptx1-antibody-bha17106955</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b69d2a38-b7a9-405b-b5f0-99126373e75a.jpg?v=1775785919</image:loc>
      <image:title>NPTX1 Antibody</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with NPTX1 antibody at 1ug/ml. Predicted molecular weight: ~47kDa. The three observed bands are blocked by addition of immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nono-antibody-biotin-conjugate-bha17107680</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_960fac62-f59e-4fc5-8327-a429b1cae765.jpg?v=1775785999</image:loc>
      <image:title>NONO Antibody (Biotin Conjugate)</image:title>
      <image:caption>Western blot testing of mouse brain lysate with biotinylated NONO antibody at 0.1ug/ml. Predicted molecular weight: ~54kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nod2-antibody-bha17107318</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e81d087b-ca0c-4017-a7f5-7e260dc7f7e5.jpg?v=1775785960</image:loc>
      <image:title>NOD2 Antibody</image:title>
      <image:caption>Western blot testing of human peripheral blood mononucleocyte lysate with NOD2 antibody at 0.1ug/ml. Molecular weight: the expected ~100kDa band and the additional ~60kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nox1-antibody-bha17106581</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f0dd92ee-b126-46b8-8c59-59c86b17dc3f.jpg?v=1775785880</image:loc>
      <image:title>NOX1 Antibody</image:title>
      <image:caption>Western blot testing of transgenic mouse aortic smooth muscle (MASM) cell lysate with NOX1 antibody at 1ug/ml (CDK4 Ab used as a loading control).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/npy5r-antibody-bha17107061</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d164866e-f50a-4277-ae3d-00d903460279.jpg?v=1775785930</image:loc>
      <image:title>NPY5R Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with NPY5R antibody at 0.3ug/ml. Predicted/observed molecular weight: ~51kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nqo1-antibody-bha17105326</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8e4400fe-baef-407c-abda-3deb8caa062f.jpg?v=1775785679</image:loc>
      <image:title>NQO1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat lung, 3) human HeLa, 4) A549, 5) MM231, 6) SW620 and 7) 22RV1 with NQO1 antibody. Predicted/observed molecular weight ~30 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/npas4-antibody-bha17106455</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c52ced4a-1ecd-4a39-9383-372295722f86.jpg?v=1775785862</image:loc>
      <image:title>NPAS4 Antibody</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with NPAS4 antibody at 0.3ug/ml. Predicted molecular weight ~87kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nos1-antibody-nnos-bha17106015</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_945e1c19-5b02-480a-a1f3-7f3b7b682ade.jpg?v=1775785793</image:loc>
      <image:title>NOS1 Antibody / nNOS</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse brain lysate with NOS1 antibody at 0.5ug/ml. Predicted molecular weight ~160 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/npr3-antibody-bha17107186</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c72bcff1-11e9-495e-a208-0866e1f99dbf.jpg?v=1775785945</image:loc>
      <image:title>NPR3 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with NPR3 antibody at 1ug/ml. Predicted molecular weight: ~60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nr1i2-antibody-bha17106916</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_043b352c-e20d-4c5a-934b-d1b7e9adae75.jpg?v=1775785917</image:loc>
      <image:title>NR1I2 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 lysate with NR1I2 antibody at 1ug/ml. Predicted molecular weight: ~50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nqo1-antibody-bha17106588</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b5cd07cd-d80e-4de2-b9a5-b8864fce6bc9.jpg?v=1775785879</image:loc>
      <image:title>NQO1 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with NQO1 antibody at 0.3ug/ml. Predicted molecular weight ~30 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nod1-antibody-bha17106748</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2b925990-1795-40e0-91dd-e3908ce564c1.jpg?v=1775785897</image:loc>
      <image:title>NOD1 Antibody</image:title>
      <image:caption>Western blot testing of human duodenum lysate with NOD1 antibody at 0.5ug/ml. Predicted molecular weight: ~107kDa, observed here at ~85kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nr0b1-antibody-dax-1-bha17106389</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_80de72fb-fd60-4268-bf16-34514924864d.jpg?v=1775785853</image:loc>
      <image:title>NR0B1 Antibody / DAX-1</image:title>
      <image:caption>Western blot testing of human testis lysate with NR0B1 antibody at 0.5ug/ml. Predicted molecular weight: 44-52 kDa (two isoforms).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nox5-antibody-bha17107007</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2f89cc69-49a5-46c6-9833-070dcdb7f2fa.jpg?v=1775785924</image:loc>
      <image:title>NOX5 Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with NOX5 antibody. Predicted molecular weight: ~86 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nr1h4-antibody-fxr-c-terminal-region-bha17106161</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b5183e14-643e-406a-a92f-16fe5cc12286.jpg?v=1775785817</image:loc>
      <image:title>NR1H4 Antibody / FXR (C-Terminal Region)</image:title>
      <image:caption>IF/ICC staining of FFPE human A549 cells with NR1H4 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nr2f6-antibody-bha17105867</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f887184c-3867-4d08-9124-954626805ab2.jpg?v=1775785770</image:loc>
      <image:title>NR2F6 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver and 2) human HeLa lysate with NR2F6 antibody at 0.5ug/ml. Predicted/observed molecular weight ~43 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/npepps-antibody-bha17107452</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_86e7d517-e04b-4668-9d98-af6050707297.jpg?v=1775785974</image:loc>
      <image:title>NPEPPS Antibody</image:title>
      <image:caption>Western blot testing of human brain cerebral cortex lysate with NPEPPS antibody at 0.3ug/ml. Predicted molecular weight: ~100kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nr2b-antibody-bha17107268</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e5d6e029-1efd-47fe-9dde-dfdecaf2f7e7.jpg?v=1775785953</image:loc>
      <image:title>NR2B Antibody</image:title>
      <image:caption>Western blot testing of rat brain lysate with NR2B antibody at 2ug/ml. Predicted molecular weight ~166kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ntrk2-antibody-bha17107502</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_109ffeb1-e6d4-4210-bc2c-4f690515dbfa.jpg?v=1775785979</image:loc>
      <image:title>NTRK2 Antibody</image:title>
      <image:caption>Western blot testing of human hippocampus [A], cerebral cortex [B] and cerebellum [C] lysates with NTRK2 antibody at 0.05ug/ml. Expected molecular weight: 90~140 kDa, depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nrf2-antibody-nrf2l2-bha17107342</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6654011a-6d2b-4d64-9c44-0187bd514944.jpg?v=1775785961</image:loc>
      <image:title>NRF2 Antibody / NRF2L2</image:title>
      <image:caption>Western blot testing of human lung lysate with NRF2 antibody at 0.3ug/ml</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nsg1-antibody-bha17106836</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_27c88e5e-be5e-4964-b69a-20eb6cd07890.jpg?v=1775785908</image:loc>
      <image:title>Nsg1 Antibody</image:title>
      <image:caption>Western blot testing of fetal mouse brain lysate with Nsg1 antibody at 0.1ug/ml. Predicted molecular weight: ~21kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/npy2r-antibody-bha17107254</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_97904d50-ee50-4644-9fab-a87b3e43ef37.jpg?v=1775785955</image:loc>
      <image:title>Npy2r Antibody</image:title>
      <image:caption>Western blot testing of rat brain lysate with Npy2r antibody at 0.1ug/ml. Predicted molecular weight: ~43 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nucb2-antibody-nucleobindin-2-bha17105510</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5fabf698-ff7b-4e8e-b7e5-73ac7fe402b0.jpg?v=1775785701</image:loc>
      <image:title>Nucb2 Antibody / Nucleobindin 2</image:title>
      <image:caption>Western blot testing of mouse HEPA cell lysate with Nucb2 antibody. Predicted molecular weight ~50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/numb-antibody-bha17107765</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e0dedd0f-756b-403f-8467-f5e8489d6773.jpg?v=1775786010</image:loc>
      <image:title>NUMB Antibody</image:title>
      <image:caption>IF/ICC staining of fixed and permeabilized mouse NIH 3T3 cells with NUMB antibody (green) at 10ug/ml and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/oas3-antibody-bha17107169</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_20b58c40-1892-41ca-a793-16680ce7721b.jpg?v=1775785943</image:loc>
      <image:title>OAS3 Antibody</image:title>
      <image:caption>Western blot testing of A431 lysate with OAS3 antibody at 2ug/ml. Predicted molecular weight: ~121kDa, observed here at ~110kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nup50-antibody-bha17106866</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_19a32686-e05a-46ae-b818-53f2d24054fd.jpg?v=1775785911</image:loc>
      <image:title>Nup50 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with Nup50 antibody at 0.5ug/ml. Predicted molecular weight: observed at ~50 or ~60kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/oct1-antibody-pou2f1-bha17107715</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c2d28905-ffef-47cc-8c8f-082cb4d1d38d.jpg?v=1775786003</image:loc>
      <image:title>OCT1 Antibody / POU2F1</image:title>
      <image:caption>Western blot testing of nuclear HeLa lysate with OCT1 antibody at 0.5ug/ml. Predicted molecular weight: ~77 kDa, routinely observed at 90-100 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nup84-antibody-bha17106876</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9bee5372-10cc-49f0-9def-12ba0abcb3eb.jpg?v=1775785912</image:loc>
      <image:title>NUP84 Antibody</image:title>
      <image:caption>Western blot testing of Saccharomyces cerevisiae S288c lysate with NUP84 antibody at 2ug/ml. Positive signal seen in WT but not KO strain.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nur77-antibody-bha17107074</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_decb0159-88ec-4c40-87bf-e733fba634a9.jpg?v=1775785932</image:loc>
      <image:title>NUR77 Antibody</image:title>
      <image:caption>Western blot testing of human thyroid lysate with NUR77 antibody at 2ug/ml. Predicted molecular weight ~64 kDa (isoform 1).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nur77-antibody-bha17105367</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_894aa415-c3dd-467f-aa29-0561789afbb3.jpg?v=1775785679</image:loc>
      <image:title>NUR77 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain, 3) human U87 and 4) human HeLa lysate with NUR77 antibody. Expected/observed molecular weight ~67 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/oct4-antibody-bha17106683</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1c29f60b-7b83-4ed3-8d8c-e3f5830376cb.jpg?v=1775785890</image:loc>
      <image:title>Oct4 Antibody</image:title>
      <image:caption>Western blot testing of mouse NIH3T3 lysate with Oct4 antibody at 1ug/ml. Predicted molecular weight ~38/30 kDa (isoform A/B), commonly observed at 38-45 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/oct6-antibody-bha17107132</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0382e980-9636-457d-b003-ca6395c7f53d.jpg?v=1775785939</image:loc>
      <image:title>OCT6 Antibody</image:title>
      <image:caption>Western blot testing of human umbilical cord lysate with OCT6 antibody at 2ug/ml. Predicted molecular weight: ~45kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/oct6-antibody-bha17107112</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ea620718-a3b8-4849-b7a6-29a37b715363.jpg?v=1775785937</image:loc>
      <image:title>OCT6 Antibody</image:title>
      <image:caption>Western blot testing of A549 lysate with OCT6 antibody at 1ug/ml. Predicted/observed molecular weight: ~45kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/oct2-antibody-pou2f2-bha17107440</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_61d8a5b5-0a68-4eff-9159-2b839001bc8e.jpg?v=1775785973</image:loc>
      <image:title>OCT2 Antibody / POU2F2</image:title>
      <image:caption>Western blot testing of human tonsil lysate with OCT2 antibody at 0.1ug/ml. Predicted molecular weight: isoforms 1-5 range in size from 43~62kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/nup107-antibody-bha17107802</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ebe30243-a5b4-4d27-8418-fad80945a55e.jpg?v=1775786012</image:loc>
      <image:title>NUP107 Antibody</image:title>
      <image:caption>Western blot testing of peripheral blood lymphocyte lysate with NUP107 antibody at 1ug/ml. Expected molecular weight: ~107kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ogg1-antibody-bha17107170</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4794fcc0-ddd2-4692-b7b8-8e2d6bd6ee84.jpg?v=1775785944</image:loc>
      <image:title>OGG1 Antibody</image:title>
      <image:caption>Western blot testing of rat spleen lysate with OGG1 antibody at 0.1ug/ml. Predicted molecular weight ~38 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/oncostatin-m-antibody-osm-bha17106158</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_82f8fdb0-8c51-494f-b313-40762c047ddc.jpg?v=1775785816</image:loc>
      <image:title>Oncostatin M Antibody / OSM</image:title>
      <image:caption>Western blot testing of 1) mouse HEPA1-6 and 2) rat kidney lysate with Oncostatin M antibody at 0.5ug/ml. Expected molecular weight ~28 kDa (precursor), ~24 kDa (pro form), ~28 kDa (glycosylated pro form).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/omg-antibody-bha17105369</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0c97cb5b-706a-40a4-8d17-afdd39eee2d0.jpg?v=1775785675</image:loc>
      <image:title>OMG Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain and 3) human U87 lysate with OMG antibody. Predicted molecular weight: ~50/150 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/orc4l-antibody-bha17106722</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d433628f-d9fe-4f81-a98c-e386517f7646.jpg?v=1775785895</image:loc>
      <image:title>ORC4L Antibody</image:title>
      <image:caption>Western blot testing of mouse heart lysate with ORC4L antibody at 0.5ug/ml. Predicted molecular weight: ~50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/odz3-antibody-bha17107661</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fc09360b-733a-40ac-a543-347cc2e4d619.jpg?v=1775785996</image:loc>
      <image:title>ODZ3 Antibody</image:title>
      <image:caption>Immunofluorescence testing of HeLa cells with ODZ3 antibody at 10ug/ml [green] shows staining of nuclei.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/orc6l-antibody-bha17106884</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9ebb01c5-d0b7-400d-a38b-a874c40c4945.jpg?v=1775785911</image:loc>
      <image:title>ORC6L Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing ORC6L with ORC6L antibody [mock transfection in lane 1]. Predicted molecular weight: ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/omg-antibody-bha17107518</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d4250977-044f-43b2-ba30-a441b615b9b2.jpg?v=1775785982</image:loc>
      <image:title>OMG Antibody</image:title>
      <image:caption>Western blot testing of human amygdala lysate with OMG antibody at 0.1ug/ml. Predicted molecular weight: ~50/150kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/osteocalcin-antibody-bha17105752</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c992c12b-46cb-4207-9e91-03019febfd6d.jpg?v=1775785743</image:loc>
      <image:title>Osteocalcin Antibody</image:title>
      <image:caption>IHC testing of FFPE rat bone tissue with Osteocalcin antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/orexin-receptor-2-antibody-bha17107483</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2f3b983c-9dbb-4487-98b5-4982a899fb01.jpg?v=1775785979</image:loc>
      <image:title>Orexin Receptor 2 Antibody</image:title>
      <image:caption>Western blot testing of mouse fetal brain lysate with Orexin Receptor 2 antibody at 0.5ug/ml. Predicted/observed molecular weight (mouse): ~52kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/orm1-antibody-orosomucoid-1-bha17105734</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_01181849-cfee-4f1f-a69d-6fcaa61ea8de.jpg?v=1775785739</image:loc>
      <image:title>ORM1 Antibody / Orosomucoid 1</image:title>
      <image:caption>Western blot testing of 1) human HCCT, 2) human HCCP, 3) rat liver and 4) mouse liver tissue lysate with ORM1 antibody. Expected molecular weight: 24/41-60 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/osbpl11-antibody-bha17107427</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ea06313c-3570-4531-9c10-bfc35f225798.jpg?v=1775785974</image:loc>
      <image:title>OSBPL11 Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with OSBPL11 antibody at 1ug/ml. Predicted molecular weight: ~86kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/osbp1-antibody-bha17106410</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_30989b87-9401-49a2-b8ca-b85caec9e70e.jpg?v=1775785857</image:loc>
      <image:title>OSBP1 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with OSBP1 antibody at 2ug/ml. Predicted molecular weight: ~90kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/orai1-antibody-bha17107367</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ef674460-2a0f-4e55-bb5e-03501b993256.jpg?v=1775785967</image:loc>
      <image:title>ORAI1 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with ORAI1 antibody at 0.03ug/ml. Predicted molecular weight ~33kDa/45~50kDa (unmodified/glycosylated)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/osteocalcin-antibody-bha17105754</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6c0eba7f-cbfe-4732-b331-d60d402830a5.jpg?v=1775785743</image:loc>
      <image:title>Osteocalcin Antibody</image:title>
      <image:caption>IHC testing of FFPE human osteosarcoma tissue with Osteocalcin antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/otc-antibody-ornithine-carbamoyltransferase-bha17105967</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5b45df5d-c0ac-408d-833e-c6bfcd5ca357.jpg?v=1775785784</image:loc>
      <image:title>OTC Antibody / Ornithine carbamoyltransferase</image:title>
      <image:caption>Western blot testing of 1) rat liver and 2) mouse liver lysate with OTC antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/osbpl9-antibody-orp9-bha17106908</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_95d28aa5-a4c6-42aa-ad63-a2ace99d7a84.jpg?v=1775785915</image:loc>
      <image:title>OSBPL9 Antibody / ORP9</image:title>
      <image:caption>IHC testing of FFPE human lung with OSBPL9 antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/osm-antibody-oncostatin-m-bha17105310</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_42ce3940-3a38-4e3d-8533-c2ae883bf364.jpg?v=1775785675</image:loc>
      <image:title>OSM Antibody / Oncostatin M</image:title>
      <image:caption>Western blot testing of human 1) A549, 2) HUT, 3) Jurkat, 4) SW620 and 5) MCF7 cell lysate with OSM antibody. Expected molecular weight ~28 kDa (precursor), ~24 kDa (pro form), ~28 kDa (glycosylated pro form); observed here at ~40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/osbpl10-antibody-bha17106493</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0352ae76-9f6d-4803-9ac0-676029b9ea98.jpg?v=1775785867</image:loc>
      <image:title>OSBPL10 Antibody</image:title>
      <image:caption>Western blot testing of human duodenum lysate with OSBPL10 antibody at 1ug/ml. Predicted molecular weight: ~84kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/osbpl5-antibody-bha17107291</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_09590c58-f432-41d3-aedd-a04dc25290da.jpg?v=1775785958</image:loc>
      <image:title>OSBPL5 Antibody</image:title>
      <image:caption>Western blot testing of human spleen lysate with OSBPL5 antibody at 2ug/ml. Predicted molecular weight: ~98 kDa, observed here at ~110 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/otoferlin-antibody-otof-bha17105652</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_237d6415-8084-4dcf-bbd4-2393cabbb078.jpg?v=1775785730</image:loc>
      <image:title>Otoferlin Antibody / OTOF</image:title>
      <image:caption>IHC testing of FFPE mouse brain tissue with Otoferlin antibody. HIER: Boil the paraffin sections in pH 8 EDTA buffer for 20 minutes and allow to cool prior to staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/osteopontin-antibody-bha17106643</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8b3f3b2c-d06b-406d-b016-e68c2cf16068.jpg?v=1775785884</image:loc>
      <image:title>Osteopontin Antibody</image:title>
      <image:caption>Western blot testing of MOLT4 lysate with Osteopontin antibody at 0.5ug/ml. Observed molecular weight: 60~65 kDa (with post-translational modifications), ~35 kDa (unmodified).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/osbp-antibody-bha17107339</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4fd213fc-5fc2-42bc-92f9-65152c5eb521.jpg?v=1775785961</image:loc>
      <image:title>OSBP Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with OSBP antibody at 0.1ug/ml. Predicted molecular weight: ~89kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ox40-antibody-cd134-bha17105446</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1ab726d5-485f-4733-86b4-74441adc1c08.jpg?v=1775785689</image:loc>
      <image:title>OX40 Antibody / CD134</image:title>
      <image:caption>Western blot testing of human 1) SW620 and 2) 22RV1 cell lysate with OX40 antibody. Expected molecular weight: 29-50 kDa depending on glcyosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/oxytocin-antibody-bha17107097</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8124c34e-3c3d-4eb8-b17a-2c9f3ded3477.jpg?v=1775785935</image:loc>
      <image:title>Oxytocin Antibody</image:title>
      <image:caption>IHC testing of a PFA-perfused cryosection of human hypothalamus with Oxytocin antibody at 0.05ug/ml. Antigen retrieval with citrate buffer pH 6 at 80oC for 30min, HRP-staining with Ni-DAB after Biotin-SP-anti-goat amplification.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/p130cas-antibody-bha17107449</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_25758cb9-a870-41ba-be57-a281b2fd59b8.jpg?v=1775785974</image:loc>
      <image:title>P130Cas Antibody</image:title>
      <image:caption>Western blot testing of MCF7 [A] and human breast cancer [B] lysates with P130Cas antibody at 1ug/ml. Predicted molecular weight: ~98kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/osteocalcin-antibody-bha17105751</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2f08dd49-b263-4108-b123-e6a660543721.jpg?v=1775785744</image:loc>
      <image:title>Osteocalcin Antibody</image:title>
      <image:caption>IHC testing of FFPE mouse bone tissue with Osteocalcin antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/p27kip1-antibody-bha17107469</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ff828c09-155e-409f-bafa-86b784a18fc9.jpg?v=1775785977</image:loc>
      <image:title>p27Kip1 Antibody</image:title>
      <image:caption>Western blot testing of human prostate lysate with p27Kip1 antibody at 0.1ug/ml. Predicted molecular weight ~27kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/p4ha1-antibody-bha17106543</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8b492c2a-5f04-4f9f-8b0e-2292d644be06.jpg?v=1775785876</image:loc>
      <image:title>P4HA1 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 cell lysate with P4HA1 antibody at 0.2ug/ml. The expected ~60 kDa and additional ~48 kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/p2rx4-antibody-bha17106977</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9e35bf1f-0896-49f2-b1c9-c16e51521647.jpg?v=1775785923</image:loc>
      <image:title>P2rx4 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with P2rx4 antibody at 1ug/ml. Expected molecular weight: 43-70 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/p47phox-antibody-ncf1-bha17106519</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_25f9844c-76df-409b-8367-6628539c5989.jpg?v=1775785870</image:loc>
      <image:title>p47phox Antibody / NCF1</image:title>
      <image:caption>Western blot testing of mouse thymus lysate with p47phox antibody at 0.03ug/ml. Expected/observed molecular weight ~47kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/p54nrb-antibody-nono-bha17105568</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_149e63f0-fdd1-4d7e-8d23-785f8e3ac6af.jpg?v=1775785712</image:loc>
      <image:title>p54nrb Antibody / NONO</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) human placenta and 3) human PANC lysate with p54nrb antibody. Predicted molecular weight ~54 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/p16-antibody-bha17107103</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_dd9157b0-aab2-4738-9a9c-482286882807.jpg?v=1775785937</image:loc>
      <image:title>p16 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with p16 antibody at 1ug/ml. Predicted molecular weight ~16 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/p27-antibody-bha17106929</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2bc7020f-0680-4985-8411-a84fa10aa3aa.jpg?v=1775785917</image:loc>
      <image:title>p27 Antibody</image:title>
      <image:caption>Western blot testing of human breast lysate with p27 antibody at 0.5ug/ml. Predicted molecular weight ~27kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pac1-antibody-dscr2-psmg1-bha17107385</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4b805f9f-6eeb-4493-a1d1-de74c7c64e0d.jpg?v=1775785967</image:loc>
      <image:title>PAC1 Antibody / DSCR2 / PSMG1</image:title>
      <image:caption>Western blot testing of Jurkat lysate with PAC1 antibody at 0.3ug/ml. Predicted/observed molecular weight: ~30 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pad4-antibody-padi4-protein-arginine-deiminase-type-4-bha17106330</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fe92d227-f810-4498-a0c8-dfc84d984fa0.jpg?v=1775785846</image:loc>
      <image:title>PAD4 Antibody / PADI4 / Protein-arginine deiminase type-4</image:title>
      <image:caption>Western blot testing of human spleen lysate with PAD4 antibody at 0.3ug/ml. Predicted molecular weight: ~74 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pacsin3-antibody-bha17106325</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9fb9482b-8536-42a6-81b0-d55ad69dd5ab.jpg?v=1775785845</image:loc>
      <image:title>PACSIN3 Antibody</image:title>
      <image:caption>Western blot testing of H460 lysate with PACSIN3 antibody at 1ug/ml. Predicted molecular weight: ~48kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pah-antibody-phenylalanine-hydroxylase-bha17106155</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6ec97e5a-8103-4862-9e9c-b7b09b677460.jpg?v=1775785819</image:loc>
      <image:title>PAH Antibody / Phenylalanine hydroxylase</image:title>
      <image:caption>IHC staining of FFPE human liver cancer tissue with PAH antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pacap-antibody-bha17107056</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b6158459-061e-4a17-bef8-3e497479dd30.jpg?v=1775785931</image:loc>
      <image:title>PACAP Antibody</image:title>
      <image:caption>Western blot testing of human hippocampus lysate with PACAP antibody at 1ug/ml. Predicted molecular weight: ~19kDa, but can be observed at ~25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pai-1-antibody-biotin-conjugate-bha17107045</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7bfd5a7b-f291-43fc-9f6f-ff41b4a1d9e0.jpg?v=1775785928</image:loc>
      <image:title>PAI-1 Antibody [Biotin Conjugate]</image:title>
      <image:caption>Western blot testing of human HepG2 lysate with PAI-1 antibody at 0.2ug/ml. Predicted molecular weight ~45kDa. An NAP blocker was used in place of non-fat milk as blocking solution and diluent. (1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/paf1-antibody-bha17107584</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ffcfdd13-f3c5-48f1-b13e-23ea5944ffdc.jpg?v=1775785987</image:loc>
      <image:title>PAF1 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with PAF1 antibody at 0.5ug/ml. Predicted/observed molecular weight: ~35kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pallid-antibody-bha17106937</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2f9a522c-f80e-453e-b139-a7ebfb5ad75d.jpg?v=1775785919</image:loc>
      <image:title>PALLID Antibody</image:title>
      <image:caption>Western blot testing of A431 lysate with PALLID antibody at 1ug/ml. Predicted molecular weight: ~20kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pam-antibody-bha17106660</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_add115e7-9ffa-485d-84d0-00b598bb7fff.jpg?v=1775785886</image:loc>
      <image:title>PAM Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with PAM antibody at 1ug/ml. Predicted molecular weight: ~101kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pak1-antibody-bha17107704</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f726d736-d6d5-4493-909b-abe9f76a03de.jpg?v=1775786003</image:loc>
      <image:title>PAK1 Antibody</image:title>
      <image:caption>Western blot testing of rat brain lysate with PAK1 antibody at 1ug/ml. Expected molecular weight 60~70 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pak5-antibody-pak7-bha17105669</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0a625b56-5448-4c39-9e34-15dc5f355db7.jpg?v=1775785731</image:loc>
      <image:title>PAK5 Antibody / PAK7</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain, 3) U87 lysate with PAK5 antibody. Expected/observed molecular weight ~81 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pace4-antibody-pcsk6-bha17105391</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_19835f61-f719-4b20-9e43-ff3443245989.jpg?v=1775785678</image:loc>
      <image:title>PACE4 Antibody / PCSK6</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) human 293 lysate with PACE4 antibody. Expected molecular weight: ~106/105 kDa (isoforms PACE4A-I/II), ~72 kDa (isoform PACE4C), ~55 kDa (isoform PACE4D).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/park7-antibody-dj-1-bha17106153</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_eb9bfa48-ff2d-4f40-97de-2cff999155ae.jpg?v=1775785818</image:loc>
      <image:title>Park7 Antibody / DJ-1</image:title>
      <image:caption>Western blot testing of rat 1) pancreas, 2) kidney, 3) skeletal muscle, 4) liver, 5) testis, 6) heart, 7) mouse kidney and 8) mouse skeletal muscle lysate with Park7 antibody at 0.5ug/ml. Predicted molecular weight ~20 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pah-antibody-bha17106970</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a18329d3-57af-4057-a398-ecb7b1f1a204.jpg?v=1775785922</image:loc>
      <image:title>PAH Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with PAH antibody at 0.3ug/ml. Predicted molecular weight: ~52 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/par2-antibody-f2rl1-bha17105483</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c45336e4-17ff-4f18-9957-a743c76f1d07.jpg?v=1775785695</image:loc>
      <image:title>PAR2 Antibody / F2RL1</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) COLO320, 3) SW620, 4) HepG2 lysate with PAR2 antibody. Expected molecular weight: 33-48 kDa (unmodified), 55-100 kDa (glycosylated). (Ref 1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pai-1-antibody-bha17107044</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_754ffa75-7213-4c60-97ae-aea878b2d35f.jpg?v=1775785931</image:loc>
      <image:title>PAI-1 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with PAI-1 antibody at 0.3ug/ml. Predicted molecular weight ~45kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/patched-antibody-bha17107168</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b7517b47-0231-4fcc-9d6c-ec545bf562cb.jpg?v=1775785943</image:loc>
      <image:title>Patched Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with Patched antibody at 1ug/ml. Predicted molecular weight ~161/154/144 kDa (isoforms L/M/S) with glycosylated PTCH1 visualized at ~200 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/patj-antibody-bha17107753</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_93840fd4-c7a9-4ba5-86f2-ec8da577bed4.jpg?v=1775786006</image:loc>
      <image:title>PATJ Antibody</image:title>
      <image:caption>IHC testing of FFPE human testis with PATJ antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining. Spermatid staining is seen.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/papd5-antibody-trf4-2-bha17107101</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3c7331f8-e1d2-4121-9cff-868ed9fc1b16.jpg?v=1775785936</image:loc>
      <image:title>PAPD5 Antibody / TRF4-2</image:title>
      <image:caption>Western blot testing of human cerebral cortex [A], human frontal cortex [B] and mouse brain [C] lysates with PAPD5 antibody at 0.3ug/ml. Predicted/observed molecular weight: ~76/74kDa (human/mouse, isoform a).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/parva-antibody-parvin-alpha-bha17105666</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e05bfbc4-2eb7-4615-a9e8-23ff8def32d0.jpg?v=1775785729</image:loc>
      <image:title>PARVA Antibody / Parvin alpha</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) human HeLa, 3) SW620 and 4) mouse HEPA lysate with PARVA antibody. Predicted/observed molecular weight ~42 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/parvalbumin-antibody-bha17107090</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_aa042ed4-a8fa-402a-a476-1451240b301d.jpg?v=1775785936</image:loc>
      <image:title>Parvalbumin Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with Parvalbumin antibody at 0.1ug/ml. Predicted molecular weight ~12 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/parp12-antibody-bha17107577</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e0e586c0-0066-4819-95e3-44a719b9162d.jpg?v=1775785987</image:loc>
      <image:title>PARP12 Antibody</image:title>
      <image:caption>PARP12 Antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/par6-antibody-bha17107083</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ec90459e-30d4-4f75-8831-a23ff1b73483.jpg?v=1775785935</image:loc>
      <image:title>PAR6 Antibody</image:title>
      <image:caption>IHC testing of FFPE human pancreas with PAR6 antibody at 10ug/ml. Microwaved antigen retrieval with Tris/EDTA buffer pH9, HRP-staining. Cytoplasmic staining of intralobular ducts is seen.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pax1-antibody-bha17107789</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_51e224c4-73d2-420e-9129-e798e9b5f03f.jpg?v=1775786011</image:loc>
      <image:title>PAX1 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with PAX1 antibody at 0.2ug/ml. Predicted molecular weight: ~55kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/parvalbumin-antibody-biotin-conjugate-bha17107091</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5329fc69-eb9f-4476-be46-37155827d9d8.jpg?v=1775785934</image:loc>
      <image:title>Parvalbumin Antibody [Biotin Conjugate]</image:title>
      <image:caption>Western blot testing of human brain lysate with biotinylated Parvalbumin antibody at 2ug/ml. Predicted molecular weight ~12kDa. An NAP blocker was used in place of non-fat milk as blocking solution and diluent. (1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pax5-antibody-bha17106605</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_79623001-7c59-45cc-a223-d4799cb16aea.jpg?v=1775785882</image:loc>
      <image:title>PAX5 Antibody</image:title>
      <image:caption>Western blot testing of human lymph lysate with PAX5 antibody at 0.3ug/ml. Predicted molecular weight ~42 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/parp2-antibody-bha17107537</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3bc07a74-ad6c-4008-bd3f-f8e823114880.jpg?v=1775785985</image:loc>
      <image:title>PARP2 Antibody</image:title>
      <image:caption>Western blot testing of human spleen lysate with PARP2 antibody at 1ug/ml. Predicted molecular weight: ~66.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pax4-antibody-bha17107055</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fc5c0be4-7c5a-4393-9287-1f9a69a4e0d2.jpg?v=1775785932</image:loc>
      <image:title>PAX4 Antibody</image:title>
      <image:caption>Western blot testing of mouse pancreas lysate with PAX4 antibody at 0.2ug/ml. Predicted/observed molecular weight: ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pax8-antibody-bha17106331</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_75c785a8-a372-4944-b7bc-148355e81fbb.jpg?v=1775785846</image:loc>
      <image:title>PAX8 Antibody</image:title>
      <image:caption>Western blot of HEK293 lysate overexpressing human PAX8A probed with PAX8 antibody at 1ug/ml [mock transfection in lane 1]. Predicted molecular weight ~48kDa but also observed at 55-60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pbx1-antibody-bha17106356</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fe611b7e-77b4-4c43-b0a1-1e7d1ec4b3ea.jpg?v=1775785850</image:loc>
      <image:title>PBX1 Antibody</image:title>
      <image:caption>Western blot testing of K562 lysate with PBX1 antibody at 0.5ug/ml. Predicted molecular weight: ~46kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pax8-antibody-bha17107774</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c1b64e6c-24a1-4f4b-b060-65b2992fb24b.jpg?v=1775786010</image:loc>
      <image:title>PAX8 Antibody</image:title>
      <image:caption>Western blot testing of human 1) kidney and 2) HeLa lysate with PAX8 antibody at 1ug/ml). Predicted molecular weight of isoforms 1-5: 31, 35, 42, 43 and 48 kDa, respectively. PAX-8 can also be observed at ~62 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pax6-antibody-bha17105380</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_07e9c3e4-98cb-4949-a318-496bf0324fa0.jpg?v=1775785674</image:loc>
      <image:title>PAX6 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain, 3) human U87 and 4) human HeLa lysate with PAX6 antibody. Expected/observed molecular weight ~48 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pcbp4-antibody-bha17107612</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0b328fb7-01fe-4a92-88e7-6ec68353235a.jpg?v=1775785993</image:loc>
      <image:title>PCBP4 Antibody</image:title>
      <image:caption>Western blot testing of HeLa cell lysate with PCBP4 antibody at 0.03ug/ml. Predicted molecular weight: ~41kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pax2-antibody-bha17105522</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9d33bcc1-620a-471a-a4c6-e54c421a18f1.jpg?v=1775785702</image:loc>
      <image:title>PAX2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) rat lung lysate with PAX2 antibody. Expected/observed molecular weight ~45 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pc4-antibody-positive-cofactor-4-sub1-bha17105884</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0f2e32b8-145e-4874-b09c-d028b2a38824.jpg?v=1775785772</image:loc>
      <image:title>PC4 Antibody / Positive cofactor 4 / SUB1</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat spleen, 3) rat stomach, 4) rat RH35, 5) mouse liver and 6) mouse spleen tissue lysate with PC4 antibody. Expected molecular weight: 15-19 kDa (unmodified) and ~26 kDa (phosphorylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pcgf2-antibody-bha17107397</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4784d1d9-5a38-4dea-a87e-efe9c0e452fd.jpg?v=1775785970</image:loc>
      <image:title>PCGF2 Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with PCGF2 antibody at 1ug/ml. Predicted molecular weight: ~38kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pck1-antibody-pepck1-pepc-bha17106834</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2cf28bc4-72e2-42c5-9ebc-6b1635f1771d.jpg?v=1775785907</image:loc>
      <image:title>PCK1 Antibody / PEPCK1 / PEPC</image:title>
      <image:caption>Western blot testing of human kidney lysate with PCK1 antibody at 0.5ug/ml. Predicted molecular weight: ~69kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pcbp1-antibody-bha17106297</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b31c89e8-54a1-4522-8af1-3125e1ef6685.jpg?v=1775785841</image:loc>
      <image:title>PCBP1 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with PCBP1 antibody at 0.01ug/ml. Predicted molecular weight: ~38kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pcna-antibody-bha17106751</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a89883a0-9951-4223-92cc-1f9e495ffa81.jpg?v=1775785899</image:loc>
      <image:title>PCNA Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with PCNA antibody at 0.05ug/ml. Expected molecular weight: 29-36 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pck1-antibody-pepck1-pepc-bha17107230</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_df477747-32bd-40a1-99ba-66b1e5ec620c.jpg?v=1775785950</image:loc>
      <image:title>PCK1 Antibody / PEPCK1 / PEPC</image:title>
      <image:caption>IHC testing of FFPE human cerebral cortex with PCK1 antibody at 2ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pcna-antibody-bha17107609</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b20e3730-2421-4887-90eb-69e566153359.jpg?v=1775785994</image:loc>
      <image:title>PCNA Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with PCNA antibody at 0.01ug/ml. Expected molecular weight: 29-36 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pcsk9-antibody-bha17106468</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a20e44b6-3fac-4bf5-a712-f746917564c0.jpg?v=1775785864</image:loc>
      <image:title>PCSK9 Antibody</image:title>
      <image:caption>Western blot of human adipose lysate with PCSK9 antibody at 0.3ug/ml. Predicted molecular weight ~74 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pd-l1-antibody-bha17106412</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f49837e4-04ea-430c-a12b-378a90c3adfc.jpg?v=1775785858</image:loc>
      <image:title>PD-L1 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with PD-L1 antibody at 1ug/ml. Predicted molecular weight ~34 kDa (unmodified), 45-70 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pcgf3-antibody-bha17107799</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_84f1eafc-2675-48f4-acbf-1824a0197465.jpg?v=1775786012</image:loc>
      <image:title>PCGF3 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate and PCGF3 antibody at 1ug/ml. Predicted molecular weight: ~27kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pdcd4-antibody-bha17106801</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bb3add56-e6f9-478e-9c7b-1cd3d80dab84.jpg?v=1775785905</image:loc>
      <image:title>PDCD4 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with PDCD4 antibody at 0.1ug/ml. Expected molecular weight: 50-60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pde5a-antibody-bha17105965</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2042e320-4217-4142-adfe-e67ececed8ba.jpg?v=1775785786</image:loc>
      <image:title>PDE5A Antibody</image:title>
      <image:caption>Western blot testing of 1) rat lung and 2) human PANC1 lysate with PDE5A antibody at 0.5ug/ml. Predicted molecular weight ~100 kDa (isoform 1).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pde4b-antibody-bha17107238</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_61a1a385-dd01-4f29-a775-515104b65bab.jpg?v=1775785951</image:loc>
      <image:title>PDE4B Antibody</image:title>
      <image:caption>Western blot testing of human uterus lysate with PDE4B antibody at 2ug/ml. Predicted molecular weight: ~83kDa, routinely observed at 83~98kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pd-l2-antibody-cd273-bha17105766</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_603ea501-9a72-4f00-b92d-2670486516db.jpg?v=1775785746</image:loc>
      <image:title>PD-L2 Antibody / CD273</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate with PD-L2 antibody at 0.5ug/ml. Expected molecular weight: 31-60 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pdgfr-alpha-antibody-cd140a-bha17105328</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1afad41b-d1e0-4693-9739-5a04bb76c257.jpg?v=1775785678</image:loc>
      <image:title>PDGFR alpha Antibody / CD140a</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) human HeLa, and 3) mouse NIH3T3 lysate with PDGFR alpha antibody. Expected/observed molecular weight: 120~195 kDa, depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pde1a-antibody-bha17106610</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fcf98ad8-7f28-427c-8e14-c62620c6657d.jpg?v=1775785884</image:loc>
      <image:title>PDE1A Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with PDE1A antibody at 1ug/ml. Predicted molecular weight: ~62kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pde5-antibody-bha17107545</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9490d618-7e5f-4c80-9360-c1ff53db7a6a.jpg?v=1775785986</image:loc>
      <image:title>PDE5 Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with PDE5 antibody at 0.3ug/ml. Predicted molecular weight: ~100/95 kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pde11a-antibody-bha17107691</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_84a5bf09-a34a-463f-96c5-ae876b7dd6a3.jpg?v=1775786000</image:loc>
      <image:title>PDE11A Antibody</image:title>
      <image:caption>Western blot testing of human prostate lysate with PDE11A antibody at 1ug/ml. Predicted molecular weight: ~66 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pde4b-antibody-bha17106573</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_21f7d3b0-45ce-4575-a6e8-272aa82d7c44.jpg?v=1775785878</image:loc>
      <image:title>PDE4B Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with PDE4B antibody at 0.5ug/ml. Predicted molecular weight: ~83 kDa, routinely observed at 83~98 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pdcd4-antibody-bha17106177</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5a42abf7-51ef-4034-a85a-f0a3ad3ba5d1.jpg?v=1775785822</image:loc>
      <image:title>PDCD4 Antibody</image:title>
      <image:caption>IHC staining of FFPE human gall bladder adenosquamous carcinoma tissue with PDCD4 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pdia3-antibody-erp57-protein-disulfide-isomerase-a3-bha17105396</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_47338334-9f63-4f0d-89f1-af6addb326df.jpg?v=1775785675</image:loc>
      <image:title>PDIA3 Antibody / ERp57 / Protein disulfide-isomerase A3</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse liver and 3) human A549 lysate with PDIA3 antibody. Predicted molecular weight: ~57-60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pdlim2-antibody-bha17107673</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ea9bbbdb-8815-433d-a0cd-c73402a9fb2a.jpg?v=1775785998</image:loc>
      <image:title>PDLIM2 Antibody</image:title>
      <image:caption>Western blot testing of mouse lung lysate with PDLIM2 antibody at 0.3ug/ml. Predicted/observed molecular weight: ~38kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pdip-antibody-pdia2-bha17107651</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1924700e-b125-499b-ac70-6d98f7c7b4c0.jpg?v=1775785996</image:loc>
      <image:title>PDIp Antibody / PDIA2</image:title>
      <image:caption>Western blot testing of human pancreas lysate with PDIp antibody at 0.03ug/ml. Predicted molecular weight ~58/70 kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pdk1-antibody-pyruvate-dehydrogenase-kinase-1-bha17106545</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_20414b38-3166-48c5-920a-ff17583516ad.jpg?v=1775785874</image:loc>
      <image:title>PDK1 Antibody / Pyruvate dehydrogenase kinase 1</image:title>
      <image:caption>Western blot testing of rat heart lysate with PDK1 antibody at 1ug/ml. Predicted molecular weight ~49 kDa, observed here at ~64 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pd-l1-antibody-bha17105797</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4301432f-eba5-48f8-a2c5-14300ad8aa9d.jpg?v=1775785752</image:loc>
      <image:title>PD-L1 Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with PD-L1 antibody at 0.5ug/ml. Expected molecular weight ~34/40-70 kDa (unmodified/glycosylated), observed here at 40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pdgf-beta-antibody-bha17105969</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_768c044b-e603-4b5f-8e6c-2cbb6233e2f4.jpg?v=1775785786</image:loc>
      <image:title>PDGF beta Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse brain with PDGF beta antibody at 0.5ug/ml. Predicted molecular weight ~27 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pdk4-antibody-bha17105581</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_980e5f2f-d890-4bc0-b15f-7b61dfd3d99d.jpg?v=1775785715</image:loc>
      <image:title>PDK4 Antibody</image:title>
      <image:caption>Western blot testing of 1) human HepG2, 2) human HeLa, 3) human A549, 4) rat skeletal muscle and 5) rat heart tissue lysate with PDK4 antibody. Expected molecular weight ~46 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pdia2-antibody-bha17107010</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ef164c62-6ec7-44f4-b033-811bcee6ffc3.jpg?v=1775785926</image:loc>
      <image:title>PDIA2 Antibody</image:title>
      <image:caption>Western blot testing of human [A], mouse [B] and rat [C] pancreas lysates with PDIA2 antibody at 0.1ug/ml. Predicted molecular weight ~58/70kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pdx1-antibody-pyruvate-dehydrogenase-protein-x-pdxh-bha17107482</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ba1c91c3-6f0d-4877-91a7-778c299a0d30.jpg?v=1775785978</image:loc>
      <image:title>PDX1 Antibody / Pyruvate dehydrogenase protein X / PDXH</image:title>
      <image:caption>Western blot testing of human pancreas lysate with PDX1 antibody at 1ug/ml. Predicted molecular weight ~54kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pedf-antibody-pigment-epithelium-derived-factor-serpinf1-bha17107361</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cf00d047-1828-49df-8574-36bcf6aaf3fa.jpg?v=1775785964</image:loc>
      <image:title>PEDF Antibody / Pigment epithelium-derived factor / SERPINF1</image:title>
      <image:caption>Western blot testing of human albumin-depleted plasma [A] and serum [B] lysates with PEDF antibody at 0.3ug/ml. Predicted molecular weight: ~46kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pebp1-antibody-pbp-rkip-bha17106738</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_95f86070-9e9d-4760-9cc0-47e0566ca881.jpg?v=1775785898</image:loc>
      <image:title>PEBP1 Antibody / PBP / RKIP</image:title>
      <image:caption>Western blot of mouse NIH3T3 (A), and human HEK293 (B) and HepG2 (C) lysate with PEBP1 antibody at 0.01ug/ml. Predicted molecular weight: ~21 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pdcd4-antibody-bha17106709</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7106c68a-813d-41c9-9130-816adc9f527d.jpg?v=1775785893</image:loc>
      <image:title>PDCD4 Antibody</image:title>
      <image:caption>Western blot testing of nuclear mouse NIH3T3 [A] and nuclear human HeLa [B] lysates with PDCD4 antibody at 1ug/ml. Expected molecular weight: 50-60 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pdlim4-antibody-bha17106727</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c4871117-1f3e-48e9-b1d1-7df9f57c1fe4.jpg?v=1775785897</image:loc>
      <image:title>PDLIM4 Antibody</image:title>
      <image:caption>Western blot testing of A431 lysate with PDLIM4 antibody at 0.2ug/ml. Predicted molecular weight: ~35 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pepck2-antibody-bha17107432</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ee4c36c8-56dc-4053-afb5-61067db9aad6.jpg?v=1775785974</image:loc>
      <image:title>PEPCK2 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with PEPCK2 antibody at 2ug/ml. Predicted molecular weight: ~71 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/periplakin-antibody-bha17105960</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a306044c-4086-4bfd-b8b3-5bbba278da59.jpg?v=1775785787</image:loc>
      <image:title>Periplakin Antibody</image:title>
      <image:caption>IHC testing of FFEP human tonsil tissue with Periplakin antibody. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/perp-antibody-bha17106421</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1f5769ef-fb8d-4a93-9012-ac5f696e7333.jpg?v=1775785858</image:loc>
      <image:title>PERP Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with PERP antibody at 1ug/ml. Predicted molecular weight: ~21 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/peroxiredoxin-5-antibody-bha17105395</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_716df272-09ef-4b65-ae74-8378d043fbb2.jpg?v=1775785675</image:loc>
      <image:title>Peroxiredoxin 5 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human HeLa cells with Peroxiredoxin 5 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pf4-antibody-platelet-factor-4-bha17105768</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3f0c3b8e-471e-4df6-9e8b-2d1d146a40c9.jpg?v=1775785747</image:loc>
      <image:title>Pf4 Antibody / Platelet factor 4</image:title>
      <image:caption>IHC staining of FFPE mouse lung tissue with Pf4 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pericentrin-1-antibody-bha17106337</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_45774dde-5662-4df2-b7ed-891f1afe69d0.jpg?v=1775785847</image:loc>
      <image:title>Pericentrin 1 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with Pericentrin 1 antibody at 1ug/ml. Predicted molecular weight: ~75 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/peroxiredoxin-6-antibody-bha17106750</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c43e440c-488e-4087-a30e-1a3216ac8792.jpg?v=1775785899</image:loc>
      <image:title>Peroxiredoxin 6 Antibody</image:title>
      <image:caption>Western blot testing of human liver [A] and heart [B] lysates with Peroxiredoxin 6 antibody at 0.1ug/ml. Expected molecular weight: ~25kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pgam1-antibody-bha17107259</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_64534bd9-9394-4828-8fe9-896de2180f0a.jpg?v=1775785954</image:loc>
      <image:title>PGAM1 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate and PGAM1 antibody at 0.01ug/ml. Predicted molecular weight: ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pex13-antibody-bha17106694</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b9ebd796-55ef-40cc-a560-3398da7e6522.jpg?v=1775785892</image:loc>
      <image:title>PEX13 Antibody</image:title>
      <image:caption>IHC testing of FFPE human liver with PEX13 antibody at 3ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pex6-antibody-bha17106915</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e268d073-e5a8-4b24-b65c-2591454733bd.jpg?v=1775785916</image:loc>
      <image:title>PEX6 Antibody</image:title>
      <image:caption>Western blot testing of rat liver lysate with PEX6 antibody at 0.3ug/ml. Predicted molecular weight: ~104kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/peroxiredoxin-2-antibody-bha17107714</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4062ebce-ff72-4cdf-9f3a-c4ae7a0547fb.jpg?v=1775786003</image:loc>
      <image:title>Peroxiredoxin 2 Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with Peroxiredoxin 2 antibody at 1ug/ml. Predicted molecular weight: ~22kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/peroxiredoxin-4-antibody-bha17105544</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3e1f9c09-8b7e-417f-b144-2eba42d3d04c.jpg?v=1775785708</image:loc>
      <image:title>Peroxiredoxin 4 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain and 3) human HeLa lysate with Peroxiredoxin 4 antibody. Expected/observed molecualr weight ~31 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/periostin-antibody-bha17106189</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9c3579a6-ff0f-4bdc-abd2-d5184684f36f.jpg?v=1775785823</image:loc>
      <image:title>Periostin Antibody</image:title>
      <image:caption>Western blot testing of 1) rat stomach, 2) rat lung, 3) rat NRK cells, 4) mouse heart, 5) mouse intestine and 6) mouse lung lysate with Periostin antibody at 0.5ug/ml. Predicted molecular weight ~93 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pescadillo-antibody-bha17107047</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_727ac5e1-fcfe-462a-b6fd-738c976fd5ef.jpg?v=1775785932</image:loc>
      <image:title>Pescadillo Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with Pescadillo antibody at 1ug/ml. Predicted/observed molecular weight: ~68kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/perilipin-3-antibody-m6prbp1-bha17105769</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d27d42ea-196c-47f4-9f98-f6511793a87d.jpg?v=1775785747</image:loc>
      <image:title>Perilipin 3 Antibody / M6PRBP1</image:title>
      <image:caption>IHC staining of FFPE human colon cancer tissue with Perilipin 3 antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pgp-9-5-antibody-bha17105279</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5e6b59ed-8845-47f4-8163-4860a400af61.jpg?v=1775785680</image:loc>
      <image:title>PGP 9.5 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain and 3) human U87 lysate with PGP 9.5 antibody. Expected/observed molecular weight ~25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pgrp-s-antibody-bha17107767</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fac1ccd5-53f9-4642-81ed-cb126a58d9af.jpg?v=1775786008</image:loc>
      <image:title>PGRP-S Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with PGRP-S antibody at 0.3ug/ml. Predicted molecular weight: ~22/28kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pgc1a-antibody-bha17106559</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_90f5fe67-5250-4d08-a42a-41e4ebb6c31a.jpg?v=1775785877</image:loc>
      <image:title>PGC1A Antibody</image:title>
      <image:caption>Western blot testing of human skeletal muscle lysate with PGC1A antibody at 0.1ug/ml. Predicted molecular weight ~91 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/phlda2-antibody-pleckstrin-homology-like-domain-family-a-member-2-bha17106914</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3edbaaa9-3369-48d3-ba90-313227b6baba.jpg?v=1775785915</image:loc>
      <image:title>PHLDA2 Antibody / Pleckstrin homology-like domain, family A, member 2</image:title>
      <image:caption>IHC testing of FFPE human placental tissue with PHLDA2 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pgrmc1-antibody-bha17106907</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bb51b659-7b89-4173-b8fc-7c1fe8bdb295.jpg?v=1775785915</image:loc>
      <image:title>PGRMC1 Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with PGRMC1 antibody at 0.1ug/ml. Predicted molecular weight: ~22 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/phlpp2-antibody-bha17107770</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_35323ddb-764c-4116-8fc4-0ae6123e08a8.jpg?v=1775786010</image:loc>
      <image:title>PHLPP2 Antibody</image:title>
      <image:caption>Western blot testing of human brain (amygdala, hippocampus, substantia nigra) lysate with PHLPP2 antibody at 0.1ug/ml. Predicted molecular weight: ~134kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/phf11-antibody-bha17107347</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5533ae63-a849-480f-8922-f458ac4053f7.jpg?v=1775785964</image:loc>
      <image:title>PHF11 Antibody</image:title>
      <image:caption>Western blot testing of A) Daudi, B) Jurkat whole and C) Jurkat nuclear lysates with PHF11 antibody at 1ug/ml. Predicted/observed molecular weight: ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/phospho-cd244-antibody-bha17106795</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8b2e1534-5f04-4e08-9828-164035af508f.jpg?v=1775785904</image:loc>
      <image:title>Phospho-CD244 Antibody</image:title>
      <image:caption>Western blot testing of immunoprecipitate from a lysate of human natural killer cells with (+) or without (-) pervanadate treatment of the cells using phospho-CD244 antibody at 2ug/ml.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/phospholamban-antibody-bha17107516</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_392bf49e-6436-43d7-b6b8-bf48c5fa18f8.jpg?v=1775785981</image:loc>
      <image:title>Phospholamban Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with Phospholamban antibody at 0.03ug/ml. Predicted molecular weight: 6/12/18/24kDa (monomer/dimer/oligomers).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pias2-antibody-bha17107286</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ac0fb009-8027-4cec-a61e-366f37c90ed8.jpg?v=1775785956</image:loc>
      <image:title>PIAS2 Antibody</image:title>
      <image:caption>IHC testing of FFPE human testis with PIAS2 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pias4-antibody-piasg-bha17105868</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cfe19bc0-4daf-4c47-b1cb-6e6e7348ebd2.jpg?v=1775785770</image:loc>
      <image:title>PIAS4 Antibody / PIASg</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) mouse testis and 3) human HeLa lysate with PIAS4 antibody at 0.5ug/ml. Predicted/observed molecular weight ~57 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/phox2a-antibody-bha17107321</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9fd2f660-9b35-409f-aee6-128ad56321cb.jpg?v=1775785959</image:loc>
      <image:title>PHOX2A Antibody</image:title>
      <image:caption>Western blot testing of human adrenal gland lysate with PHOX2A antibody at 1ug/ml. Predicted molecular weight: ~30kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pi3k-p110-antibody-beta-pik3cb-bha17106030</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3e43781c-3bd7-4a3e-bcf6-af9392124c40.jpg?v=1775785796</image:loc>
      <image:title>PI3K p110 Antibody (beta) / PIK3CB</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) rat kidney, 3) mouse spleen, 4) mouse thymus, 5) human MCF7 and 6) human K562 lysate with PI3K p110 antibody at 0.5ug/ml. Expected molecular weight ~110 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pi3k-antibody-bha17107183</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_33080701-5f96-4964-8466-1517824a1f39.jpg?v=1775785946</image:loc>
      <image:title>PI3K Antibody</image:title>
      <image:caption>IHC testing of FFPE human cerebellar cortex with PI3K antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/phospholipase-a2-antibody-pla2g4a-cpla2-bha17105449</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_18b57b27-6fb5-417c-8a36-aa0b94d72754.jpg?v=1775785688</image:loc>
      <image:title>Phospholipase A2 Antibody / PLA2G4A / cPLA2</image:title>
      <image:caption>Western blot testing of 1) human HeLa and 2) mouse NIH3T3 cell lysate with Phospholipase A2 antibody. Expected/observed molecular weight ~85 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pinx1-antibody-bha17105633</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ea75ac2c-2a5d-49ae-b4f7-f1a2c681efde.jpg?v=1775785724</image:loc>
      <image:title>PINX1 Antibody</image:title>
      <image:caption>Western blot testing of 1) human placenta, 2) HeLa, 3) HUT and 4) Jurkat lysate with PINX1 antibody. Predicted/observed molecular weight ~37 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pim2-antibody-bha17107277</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d9f91bd1-eff3-4f54-a5e6-880129776926.jpg?v=1775785955</image:loc>
      <image:title>PIM2 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing human PIM2-MYC with PIM2 antibody (0.1ug/ml) in Lane A and anti-MYC (1/1000) in lane C. Mock-transfected HEK293 probed with PIM2 (0.1ug/ml) in Lane B. Predicted molecular weight: ~34kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pick1-antibody-bha17107237</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_abed1232-0bec-463e-944c-041641c9e444.jpg?v=1775785951</image:loc>
      <image:title>PICK1 Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with PICK1 antibody at 1ug/ml. Predicted molecular weight: ~47kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pin1-antibody-bha17107341</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_153d3ba5-a144-4aa5-b595-8a2349be57be.jpg?v=1775785962</image:loc>
      <image:title>PIN1 Antibody</image:title>
      <image:caption>Western blot testing of rat brain lysate with PIN1 antibody at 0.2ug/ml. Expected molecular weight ~18kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pirin-antibody-bha17107085</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_873bff10-0688-4a1b-9bbd-84b9bd398bd0.jpg?v=1775785936</image:loc>
      <image:title>Pirin Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with Pirin antibody at 0.3ug/ml. Predicted/observed molecular weight: ~32kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pkc-eta-antibody-bha17105375</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d3770106-455a-4b32-b63e-ce9f489b63ee.jpg?v=1775785677</image:loc>
      <image:title>PKC eta Antibody</image:title>
      <image:caption>Western blot testing of human 1) A431, 2) A549, 3) HeLa and 4) SKOV lysate with PKC eta antibody. Predicted/observed molecular weight ~78 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pitx3-antibody-bha17107748</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_83e2c38c-be4c-44ac-a961-242491ad5cd5.jpg?v=1775786006</image:loc>
      <image:title>PITX3 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with PITX3 antibody at 1ug/ml. Predicted molecular weight: ~32kDa, routinely observed at 35-40kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pla1-antibody-bha17106903</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e1c06ebe-4ad7-4d1c-9653-70237ca02140.jpg?v=1775785913</image:loc>
      <image:title>PLA1 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate with PLA1 antibody at 2ug/ml. Predicted molecular weight: ~47kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pinx1-antibody-bha17106975</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ca9a7745-a18e-4c4e-95fc-54cc037ff915.jpg?v=1775785922</image:loc>
      <image:title>PINX1 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 lysate with PINX1 antibody at 0.3ug/ml. Predicted molecular weight: ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pist-antibody-bha17107536</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_521c89ee-1693-4f5d-b9df-6b69f0af0187.jpg?v=1775785984</image:loc>
      <image:title>PIST Antibody</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with PIST antibody at 0.05ug/ml. Predicted molecular weight: ~51kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pla2g4c-antibody-bha17107705</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e3dcfbcb-e577-48b6-bfb8-3cdcb7560a64.jpg?v=1775786001</image:loc>
      <image:title>PLA2G4C Antibody</image:title>
      <image:caption>Western blot testing of human pancreas lysate with PLA2G4C antibody at 0.03ug/ml. Predicted molecular weight: ~63kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pla2g1b-antibody-bha17107628</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d4ab5023-dfae-4324-9564-d31ddb680912.jpg?v=1775785993</image:loc>
      <image:title>PLA2G1B Antibody</image:title>
      <image:caption>Western blot testing of human pancreas lysate with PLA2G1B antibody at 0.01ug/ml. Predicted molecular weight: ~16kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pkm2-antibody-bha17105315</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7a35335a-956a-45b7-99c1-5e590b79f20a.jpg?v=1775785682</image:loc>
      <image:title>PKM2 Antibody</image:title>
      <image:caption>IHC staining of FFPE mouse skeletal muscle tissue with PKM2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/plap-antibody-placental-alkaline-phosphatase-bha17105924</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f190fee3-d857-4683-a2a2-8112dacebde3.jpg?v=1775785779</image:loc>
      <image:title>PLAP Antibody / Placental alkaline phosphatase</image:title>
      <image:caption>Immunofluorescent staining of FFPE human HeLa cells with PLAP antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pklr-antibody-pyruvate-kinase-isozymes-l-r-bha17105405</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8e50fdb4-f2ea-441f-93d8-1f20970dfa3f.jpg?v=1775785680</image:loc>
      <image:title>PKLR Antibody / Pyruvate kinase isozymes L/R</image:title>
      <image:caption>IHC testing of FFPE human intestinal cancer with PKLR antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pkr-antibody-eif2ak2-bha17105344</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b09155d4-3aea-4dae-b155-583d133e550c.jpg?v=1775785678</image:loc>
      <image:title>PKR Antibody / EIF2AK2</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with PKR antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/plectin-antibody-bha17105566</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_15c2e1aa-4935-4f8b-824d-48d1c4a9700e.jpg?v=1775785714</image:loc>
      <image:title>Plectin Antibody</image:title>
      <image:caption>Immunofluorescent staining of human U-2 OS cells with Plectin antibody (green) and DAPI (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pla2r1-antibody-bha17106841</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_49b1d676-b490-4898-b50e-19d29e3b0a54.jpg?v=1775785911</image:loc>
      <image:title>PLA2R1 Antibody</image:title>
      <image:caption>FACS testing of fixed and permeabilized human HEK293 cells with PLA2R1 antibody (blue) at 10ug/ml and naive goat Ig (black).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/platelet-factor-4-antibody-pf4-bha17105767</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b43bd989-0cdd-4914-b93d-df09fb1fca71.jpg?v=1775785747</image:loc>
      <image:title>Platelet factor 4 Antibody / PF4</image:title>
      <image:caption>IHC staining of FFPE human spleen tissue with Platelet factor 4 antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/plunc-antibody-splunc1-bpifa1-bha17107600</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c9aeddef-8cb4-427d-b94f-3400fec3e9a1.jpg?v=1775785992</image:loc>
      <image:title>PLUNC Antibody / SPLUNC1 / BPIFA1</image:title>
      <image:caption>Western blot testing of secretions from human primary airway cells in culture (lanes 1 and 2), and in human bronchoalveolar lavage fluid (lanes 3 and 4) with PLUNC antibody at 2ug/ml.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/plin1-antibody-perilipin-1-bha17106238</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e5ad2a24-8450-4a70-92a3-cc75614fe05d.jpg?v=1775785829</image:loc>
      <image:title>PLIN1 Antibody / Perilipin 1</image:title>
      <image:caption>Western blot testing of 1) human HeLa, 2) rat liver and 3) mouse liver tissue lysate with PLIN1 antibody. Expected molecular weight: 56-62 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/plzf-antibody-zbtb16-bha17105725</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_81fa059d-eedb-49d2-a1d4-fdf19fd68874.jpg?v=1775785738</image:loc>
      <image:title>PLZF Antibody / ZBTB16</image:title>
      <image:caption>Western blot testing of 1) rat ovary and 2) human SKOV lysate with PLZF antibody. Predicted molecular weight: 74-81 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pmel17-antibody-bha17106439</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9f78e44e-e44e-42eb-b33a-f1bc005da96b.jpg?v=1775785861</image:loc>
      <image:title>PMEL17 Antibody</image:title>
      <image:caption>Western blot testing of human skin lysate with PMEL17 antibody at 1ug/ml. Predicted molecular weight: ~70/100/26 kDa (unmodified/glycosylated/M-beta fragment).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pleckstrin-antibody-bha17107008</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9d4896b3-c017-431a-98a3-2842bda0ed54.jpg?v=1775785925</image:loc>
      <image:title>Pleckstrin Antibody</image:title>
      <image:caption>Western blot testing of human PBMC lysate with Pleckstrin antibody at 0.05ug/ml. Predicted molecular weight: ~40kDa, observed here at ~45kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pld1-antibody-bha17105549</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6c3ad0c7-5d1a-4d34-88bc-fdedd79c61ef.jpg?v=1775785707</image:loc>
      <image:title>PLD1 Antibody</image:title>
      <image:caption>Western blot testing of 1) mouse heart, 2) human 22RV1 and 3) human HeLa cell lysate with PLD1 antibody. Expected/observed molecular weight: ~124 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/plk3-antibody-bha17107741</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d03596f7-a4f5-4cdf-a7df-92573d70a1ce.jpg?v=1775786005</image:loc>
      <image:title>PLK3 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with PLK3 antibody at 2ug/ml. Predicted molecular weight: ~71kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pmca1-antibody-bha17107435</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0ac46a94-aa0a-4846-936c-e89da41c740d.jpg?v=1775785972</image:loc>
      <image:title>PMCA1 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with PMCA1 antibody at 0.03ug/ml. Predicted molecular weight: ~135kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/plexin-d1-antibody-plxnd1-bha17107532</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_951d6d49-3fe3-4a3a-abd8-9c592d18da15.jpg?v=1775785984</image:loc>
      <image:title>Plexin D1 Antibody / PLXND1</image:title>
      <image:caption>Immunofluorescent staining of fixed and permeabilized human U-251 cells with Plexin D1 antibody (green) at 10ug/ml and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pleiotrophin-antibody-bha17106391</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5a55202f-863f-4f32-9861-a02fb92b8127.jpg?v=1775785854</image:loc>
      <image:title>Pleiotrophin Antibody</image:title>
      <image:caption>Western blot testing of rat brain lysate with Pleiotrophin antibody at 0.3ug/ml. Predicted molecular weight: ~19kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pnpla3-antibody-bha17106810</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_df7c1d4d-382b-4b6e-a63c-95ef73d256bb.jpg?v=1775785905</image:loc>
      <image:title>PNPLA3 Antibody</image:title>
      <image:caption>IHC staining of FFPE human skin with PNPLA3 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pln-antibody-phospholamban-bha17105383</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f3576e35-d5b0-4172-811e-09e507f643e0.jpg?v=1775785675</image:loc>
      <image:title>PLN Antibody / Phospholamban</image:title>
      <image:caption>IHC staining of FFPE mouse heart tissue with PLN antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/plk1-antibody-bha17105474</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_048cad8c-cf1d-48c7-9984-7612f55198d3.jpg?v=1775785694</image:loc>
      <image:title>PLK1 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) PANC cell lysate with PLK1 antibody. Predicted/observed molecular weight ~68 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pml-antibody-promyelocytic-leukemia-protein-bha17105870</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a1153e3e-28b1-4ba5-8da6-7950058a735a.jpg?v=1775785770</image:loc>
      <image:title>PML Antibody / Promyelocytic leukemia protein</image:title>
      <image:caption>Western blot testing of human 1) SW620 and 2) U-2 OS lysate with PML antibody at 0.5ug/ml. Expected molecular weight: multiple isoforms from 47-97 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pml-antibody-promyelocytic-leukemia-protein-bha17105871</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_43b5c23d-e73a-4393-a457-89c2a8742fc1.jpg?v=1775785768</image:loc>
      <image:title>PML Antibody / Promyelocytic leukemia protein</image:title>
      <image:caption>Western blot testing of mouse testis lysate with PML antibody at 0.5ug/ml. Expected molecular weight: multiple isoforms from 47-97 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/plau-antibody-bha17107119</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4a188a38-ebb3-448c-9476-ac3205cf0f6d.jpg?v=1775785937</image:loc>
      <image:title>PLAU Antibody</image:title>
      <image:caption>Western blot testing of 293 lysate with PLAU antibody at 0.3ug/ml. Predicted molecular weight: ~48/35kDa (full length/beta-chain). (1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pomc-antibody-bha17107578</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bb64ad75-b28c-4df0-8768-40e514e9c82e.jpg?v=1775785988</image:loc>
      <image:title>POMC Antibody</image:title>
      <image:caption>Western blot testing of NIH3T3 lysate with POMC antibody at 0.1ug/ml. Predicted molecular weight ~29kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/polr2g-antibody-bha17106793</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_05235078-cb6a-4805-99e2-5f59979a6a00.jpg?v=1775785902</image:loc>
      <image:title>POLR2G Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with POLR2G antibody at 2ug/ml. Predicted molecular weight: ~19kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/podoplanin-antibody-bha17106856</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d2b700ec-7b4e-4f54-8a1b-13789bdb370f.jpg?v=1775785911</image:loc>
      <image:title>Podoplanin Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with Podoplanin antibody at 1ug/ml. Predicted molecular weight ~25/36kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/plgf-antibody-pgf-placenta-growth-factor-bha17106181</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_364d48e3-938e-4bb6-906b-0249c7f5f279.jpg?v=1775785821</image:loc>
      <image:title>Plgf Antibody / Pgf / Placenta growth factor</image:title>
      <image:caption>Western blot testing of 1) rat stomach, 2) rat liver, 3) mouse stomach, 4) mouse liver and 5) mouse HEPA1-6 lysate with Plgf antibody at 0.5ug/ml. Predicted molecular weight: ~19 kDa (unmodified), ~28 kDa (glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/podxl-antibody-bha17106634</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_44f9c53e-5d03-4bdc-9a94-955690416b2c.jpg?v=1775785884</image:loc>
      <image:title>PODXL Antibody</image:title>
      <image:caption>Western blot testing of human kidney lysate with PODXL antibody at 1ug/ml. Predicted molecular weight: isoform 1 observed at ~59/165kDa (unmodified/glycosylated), isoform 2 observed at 55/160kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pon2-antibody-paraoxonase-2-bha17105567</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d3225adc-29b9-4603-ada7-aa332c0030ae.jpg?v=1775785712</image:loc>
      <image:title>PON2 Antibody / Paraoxonase 2</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate with PON2 antibody. Expected/observed molecular weight ~39 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/poldip2-antibody-bha17107499</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_92ee6170-41e7-41fa-a86d-01e67b3f74f5.jpg?v=1775785981</image:loc>
      <image:title>POLDIP2 Antibody</image:title>
      <image:caption>Western blot testing of K562 [A], MCF7 [B] and mouse liver [C] lysates with POLDIP2 antibody at 1ug/ml. Predicted molecular weight: ~42kDa, observed here at ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pon2-antibody-paraoxonase-2-bha17106850</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_00125160-6fa5-4e34-829f-7ae9849fda0d.jpg?v=1775785908</image:loc>
      <image:title>PON2 Antibody / Paraoxonase 2</image:title>
      <image:caption>Western blot testing of HepG2 lysate with PON2 antibody at 0.2ug/ml. Predicted molecular weight: ~39/39/38 kDa (isoforms 1/2/3). The three observed bands are blocked by addition of immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pou3f3-antibody-bha17107163</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_acc2340a-7315-465e-b16b-cba5b4b26b15.jpg?v=1775785943</image:loc>
      <image:title>POU3F3 Antibody</image:title>
      <image:caption>Western blot testing of mouse spinal cord lysate with POU3F3 antibody at 1ug/ml. Predicted molecular weight: ~50kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/polycystin-2-antibody-bha17106931</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7432cfb5-3a69-4f86-8eff-8cc921ba3849.jpg?v=1775785918</image:loc>
      <image:title>Polycystin 2 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with Polycystin 2 antibody at 1ug/ml. Predicted molecular weight: ~110kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pon1-antibody-bha17106137</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2eee0757-cecc-4cb6-94b7-d13803f02160.jpg?v=1775785815</image:loc>
      <image:title>PON1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse liver, 3) mouse lung and 4) mouse testis tissue lysate with PON1 antibody at 0.5ug/ml. Predicted molecular weight: ~40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pon1-antibody-bha17106784</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d5b32bd9-ba44-4868-9fe7-9f3bca47cb02.jpg?v=1775785900</image:loc>
      <image:title>PON1 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with PON1 antibody at 1ug/ml. Predicted molecular weight: ~40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pou2af1-antibody-bha17106687</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f32aea05-7e6d-4b14-8148-9107d9785417.jpg?v=1775785892</image:loc>
      <image:title>POU2AF1 Antibody</image:title>
      <image:caption>Western blot of HEK293 lysate overexpressing human BOB1-FLAG probed with BOB-1 antibody (1ug/ml) in lane A and with anti-FLAG (1/3000) in lane C. Mock-transfected probed with anti-BOB-1 (1ug/ml) in lane B. Predicted molecular weight: ~28/35-40kDa (unmodified/ubiquitinated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pou6f1-antibody-bha17106989</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_679745ee-51cc-436c-a12d-2441a96b883f.jpg?v=1775785923</image:loc>
      <image:title>POU6F1 Antibody</image:title>
      <image:caption>Western blot testing of human cerebral cortex lysate with POU6F1 antibody at 0.3ug/ml. Predicted/observed molecular weight: ~33kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pp2a-antibody-bha17107081</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5ee1f286-665a-471b-b0bc-fdba74fb43c5.jpg?v=1775785933</image:loc>
      <image:title>PP2A Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate [lane 1], mouse liver [lane 2] and rat liver [lane 3] with PP2A antibody at 0.5ug/ml. Expected molecular weight: 37/41/33/32 kDa (alpha/beta/delta/epsilon isoforms).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/por-antibody-cypor-cytochrome-p450-oxidoreductase-bha17105332</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c7a66aa7-48ef-49d9-9cf3-ec983551dec2.jpg?v=1775785682</image:loc>
      <image:title>POR Antibody / CYPOR / Cytochrome P450 Oxidoreductase</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) human placenta, 3) human HepG2 and 4) mouse HEPA1-6 lysate with POR antibody. Predicted molecular weight: ~77 kDa, observed here at ~85 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pon2-antibody-paraoxonase-2-bha17106944</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_475c6c42-17f9-4856-8a76-726bec9966f7.jpg?v=1775785918</image:loc>
      <image:title>PON2 Antibody / Paraoxonase 2</image:title>
      <image:caption>IHC testing of FFPE human liver with PON2 antibody at 2ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pou4f3-antibody-bha17106742</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_60c3a6bc-ed3c-40d8-88a6-c780f7f4f8ed.jpg?v=1775785897</image:loc>
      <image:title>POU4F3 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with POU4F3 antibody at 0.2ug/ml. Predicted molecular weight: ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ppp2ca-b-antibody-pp2a-alpha-and-beta-bha17106904</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_00856e86-26b2-41d0-9b7d-1fdc124d77a5.jpg?v=1775785913</image:loc>
      <image:title>PPP2CA/B Antibody / PP2A alpha + beta</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with PPP2CA/B antibody at 0.05ug/ml. Predicted molecular weight: ~36kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/poll-antibody-bha17107543</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b3f79f4c-5528-4685-9c35-2999800facc7.jpg?v=1775785985</image:loc>
      <image:title>POLL Antibody</image:title>
      <image:caption>Western blot testing of human 1) A549 and 2) HepG2 cell lysate with POLL antibody at 0.5ug/ml and 1ug/ml, respectively. Predicted molecular weight ~63 kDa, also observed at ~68 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ppid-antibody-bha17106533</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0b411711-e6a7-4123-989b-d7fab688edd5.jpg?v=1775785874</image:loc>
      <image:title>PPID Antibody</image:title>
      <image:caption>Western blot testing of human brain [frontal cortex] lysate with PPID antibody at 0.1ug/ml. Predicted molecular weight: ~40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pou3f2-antibody-bha17106334</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e62c51d7-22de-4981-9c6b-a86e4c70b66b.jpg?v=1775785845</image:loc>
      <image:title>POU3F2 Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with POU3F2 antibody at 0.1ug/ml. Predicted molecular weight: ~47kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ppt1-antibody-bha17105464</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f5250438-6eca-4261-b7a1-60c5254d3c15.jpg?v=1775785693</image:loc>
      <image:title>PPT1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain, 3) rat liver, 4) mouse liver, 5) human HepG2, 6) human 293T and 7) MCF-7 lysate with PPT1 antibody. Expected/observed molecular weight ~34 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ppp2r1a-antibody-bha17107527</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7a60598c-ff62-4931-8944-95f46367d308.jpg?v=1775785983</image:loc>
      <image:title>PPP2R1A Antibody</image:title>
      <image:caption>Western blot testing of human lymph node lysate with PPP2R1A antibody at 0.03ug/ml. Predicted molecular weight ~65 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pram1-antibody-bha17106544</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e453cacb-8d86-4692-a33c-4ca95b23075c.jpg?v=1775785873</image:loc>
      <image:title>PRAM1 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with PRAM1 antibody at 2ug/ml. Predicted molecular weight: ~79kDa but routinely observed at 97kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prdm4-antibody-pr-domain-zinc-finger-protein-4-bha17106469</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bf502621-b3dd-4a7c-8da6-3c943406aa7b.jpg?v=1775785864</image:loc>
      <image:title>PRDM4 Antibody / PR domain zinc finger protein 4</image:title>
      <image:caption>Western blot testing of human brain lysate with PRDM4 antibody at 0.3ug/ml. Predicted molecular weight: ~88 kDa, observed here at ~70 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ppar-delta-antibody-bha17106401</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_492f6f66-149b-47cd-89d3-57fdf76e9e0f.jpg?v=1775785855</image:loc>
      <image:title>PPAR delta Antibody</image:title>
      <image:caption>Western blot testing of human MOLT4 lysate with PPAR delta antibody at 0.3ug/ml. Predicted molecular weight: ~50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ppp2r5a-antibody-bha17106366</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d77fd451-241a-4957-b1c4-a7d4267dcf62.jpg?v=1775785851</image:loc>
      <image:title>PPP2R5A Antibody</image:title>
      <image:caption>Western blot testing of human muscle lysate with PPP2R5A antibody at 0.5ug/ml. Predicted molecular weight: ~56kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pppde1-antibody-bha17106865</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_997d99bc-3e3a-4b5a-ab74-3546a18acb85.jpg?v=1775785909</image:loc>
      <image:title>PPPDE1 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing human PPPDE1-MYC probed with PPPDE1 antibody (0.5ug/ml) in Lane A and anti-MYC (1/5000) in lane C. Mock-transfected HEK293 probed with PPPDE1 antibody (1ug/ml) in Lane B.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prdm1-antibody-blimp1-bha17106579</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ee64ef93-2d7d-419a-8bc9-1e9695b01fd5.jpg?v=1775785880</image:loc>
      <image:title>PRDM1 Antibody / BLIMP1</image:title>
      <image:caption>Western blot testing of A431 lysate with PRDM1 antibody at 0.3ug/ml. Predicted molecular weight: ~92/77kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prdm1-antibody-blimp1-bha17107511</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0dfee5de-c161-4ec0-b6a5-44fa7821a935.jpg?v=1775785981</image:loc>
      <image:title>PRDM1 Antibody / BLIMP1</image:title>
      <image:caption>IF/ICC staining of fixed and permeabilized human U-251 cells with PRDM11 antibody (green) at 10ug/ml and DAPI nuclear stain (blue).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prdm14-antibody-bha17106693</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c4f4a60a-6041-4ea0-9ec4-af83c0b31473.jpg?v=1775785890</image:loc>
      <image:title>PRDM14 Antibody</image:title>
      <image:caption>Western blot testing of A549 lysate with PRDM14 antibody at 2ug/ml. Predicted molecular weight: ~64kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prkab1-antibody-ampk-beta-1-bha17105686</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6d62eb71-1102-4e41-998b-9350c5dd2402.jpg?v=1775785735</image:loc>
      <image:title>PRKAB1 Antibody / AMPK beta 1</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with PRKAB1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ppp2r5e-antibody-bha17107550</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1ea85a69-1d28-468a-9394-83b7b8fa7e91.jpg?v=1775785983</image:loc>
      <image:title>PPP2R5E Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum [A], mouse [B] and rat [C] brain lysate with PPP2R5E antibody at 0.1ug/ml. Predicted molecular weight: 50~56kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ppp2r5d-antibody-bha17107450</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_73cfaa40-962e-4a13-978b-5ba0d1b8b66e.jpg?v=1775785973</image:loc>
      <image:title>PPP2R5D Antibody</image:title>
      <image:caption>Western blot testing of 293 lysate with PPP2R5D antibody at 2ug/ml. Image shows isoforms of ~70kDa and ~60kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ppar-gamma-antibody-middle-region-bha17106132</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3d8db068-2974-42b4-b5d3-7e71fb88bae6.jpg?v=1775785814</image:loc>
      <image:title>PPAR gamma Antibody (Middle Region)</image:title>
      <image:caption>Western blot testing of human 1) K562 and 2) MCF7 cell lysate with PPAR gamma antibody at 0.5ug/ml. Predicted molecular weight: 54-57 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prmt3-antibody-bha17106644</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e4d04f75-e7f4-4b33-bb05-a08b9680079b.jpg?v=1775785886</image:loc>
      <image:title>PRMT3 Antibody</image:title>
      <image:caption>Western blot testing of MCF7 lysate with PRMT3 antibody at 1ug/ml. Predicted molecular weight: ~60kDa, routinely observed at 60~70kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prefoldin-antibody-bha17106633</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6378065a-5d59-48bb-8156-9f21958e8633.jpg?v=1775785885</image:loc>
      <image:title>Prefoldin Antibody</image:title>
      <image:caption>Western blot testing of K562 lysate with Prefoldin antibody at 1ug/ml. Predicted molecular weight: ~14kDa. Both observed bands are blocked by addition of immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prdm11-antibody-bha17107564</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b6532612-90d6-4e37-a710-295604b3fe8d.jpg?v=1775785987</image:loc>
      <image:title>PRDM11 Antibody</image:title>
      <image:caption>Western blot testing of A549 lysate with PRDM11 antibody at 2ug/ml. Predicted molecular weight: ~58/54 kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prlr-antibody-prolactin-receptor-bha17105333</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f0146d35-2233-43d8-a606-f1cd281d0933.jpg?v=1775785677</image:loc>
      <image:title>PRLR Antibody / Prolactin Receptor</image:title>
      <image:caption>Western blot testing of human MCF7 cell lysate with PRLR antibody. Expected molecular weight: 70-117 kDa depending on glcosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/preb-antibody-prolactin-regulatory-element-binding-protein-bha17106249</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b5886d42-a816-4b74-ab75-d09554a7e38e.jpg?v=1775785833</image:loc>
      <image:title>PREB Antibody / Prolactin regulatory element-binding protein</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) placenta and 3) A549 lysate with PREB antibody at 0.5ug/ml. Predicted molecular weight ~45 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prex1-antibody-bha17106952</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cdce9447-c831-447f-9cfd-0ffe4dfd5288.jpg?v=1775785921</image:loc>
      <image:title>PREX1 Antibody</image:title>
      <image:caption>Western blot testing of human temporal cortex lysate with PREX1 antibody at 1ug/ml. Predicted molecular weight: ~186 kDa, observed here at ~150 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prkcb-antibody-bha17106583</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d1b92c06-0aec-4036-97ae-f7053382f58a.jpg?v=1775785880</image:loc>
      <image:title>PRKCB Antibody</image:title>
      <image:caption>Western blot testing of human placenta [A] and rat brain [B] lysates with PRKCB antibody at 0.3ug/ml. Predicted molecular weight: ~77 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prokineticin-receptor-2-antibody-bha17107610</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7a13c49c-8384-4d89-a6be-72f1fb461e5a.jpg?v=1775785991</image:loc>
      <image:title>Prokineticin receptor 2 Antibody</image:title>
      <image:caption>Western blot of human cerebellum (A), rat brain (B) and rat testis (C) lysate with Prokineticin receptor 2 antibody at 0.1ug/ml. Predicted molecular weight (human): ~44kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prmt2-antibody-bha17106669</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d3661ab1-5cf2-4c11-8573-eb3b80487cfc.jpg?v=1775785889</image:loc>
      <image:title>PRMT2 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with PRMT2 antibody at 2ug/ml. Predicted molecular weight: ~37kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prodh-antibody-bha17106933</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3794be55-c9c6-4f2d-8e6b-1a1cb8877763.jpg?v=1775785917</image:loc>
      <image:title>PRODH Antibody</image:title>
      <image:caption>IHC testing of FFPE human cerebellum with PRODH antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prmt6-antibody-bha17106936</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6b790707-8e08-45c7-bd09-b8a4829d9966.jpg?v=1775785918</image:loc>
      <image:title>PRMT6 Antibody</image:title>
      <image:caption>Western blot testing of MCF7 lysate with PRMT6 antibody at 0.5ug/ml. Predicted molecular weight: ~42kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prodh-antibody-bha17106773</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0e7a8793-2362-4377-907e-f9feabbb01eb.jpg?v=1775785901</image:loc>
      <image:title>PRODH Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with PRODH antibody at 0.3ug/ml. Both isoforms are detected in this image.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prkar1a-antibody-bha17105991</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_cfcb70ca-0c78-4eab-8c61-b77acc945d51.jpg?v=1775785790</image:loc>
      <image:title>PRKAR1A Antibody</image:title>
      <image:caption>Western blot testing of 1) rat thymus, 2) human HepG2 and 3) human MCF7 lysate with PRKAR1A antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prkaa2-antibody-bha17106441</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_88839588-26df-4f94-ad82-08dfa8c8dd97.jpg?v=1775785860</image:loc>
      <image:title>PRKAA2 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with PRKAA2 antibody at 1ug/ml. Predicted molecular weight: ~62kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prothrombin-antibody-bha17106279</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0e3934c0-4650-4fbf-a17d-d92767affd4d.jpg?v=1775785837</image:loc>
      <image:title>Prothrombin Antibody</image:title>
      <image:caption>IHC testing of FFPE human colon cancer tissue with Prothrombin antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/proteinase-3-antibody-prtn3-bha17107165</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_49395920-2e5b-4920-ba22-9ddf7ee30274.jpg?v=1775785946</image:loc>
      <image:title>Proteinase 3 Antibody / PRTN3</image:title>
      <image:caption>Western blot testing of human spleen lysate with Proteinase 3 antibody at 2ug/ml. Predicted molecular weight ~28 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prpf31-antibody-prp31-bha17107551</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c4253cf0-9e0e-4fdb-b187-adeff8a4e40e.jpg?v=1775785984</image:loc>
      <image:title>PRPF31 Antibody / PRP31</image:title>
      <image:caption>Western blot testing of cell line A431 lysate with PRPF31 antibody at 0.3ug/ml. Predicted molecular weight: ~55kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/psd95-antibody-dlg4-bha17105506</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_57bfc1d5-3909-431d-8ca4-ba4282d1a2d5.jpg?v=1775785699</image:loc>
      <image:title>PSD95 Antibody / DLG4</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain, 3) human SHG-44 and 4) human U-87 MG lysate with PSD95 antibody. Predicted molecular weight ~80 kDa but routinely observed at 90~95 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ps2-antibody-tff1-bha17106190</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c9b483ef-2c73-4931-aab4-37f17f4741a9.jpg?v=1775785822</image:loc>
      <image:title>pS2 Antibody / Tff1</image:title>
      <image:caption>IHC testing of FFPE mouse stomach tissue with pS2 antibody at 1ug/ml. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/psma3-antibody-proteasome-20s-alpha-3-bha17105875</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_875c9e62-15db-4444-b148-5378be3a1e52.jpg?v=1775785770</image:loc>
      <image:title>PSMA3 Antibody / Proteasome 20S alpha 3</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) mouse lung and 3) human 293T lysate with PSMA3 antibody at 0.5ug/ml. Predicted/observed molecular weight ~28 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/psd95-antibody-dlg4-bha17106787</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7fd23046-2e2a-4ae2-b98a-bdcf59cd56fd.jpg?v=1775785903</image:loc>
      <image:title>PSD95 Antibody / DLG4</image:title>
      <image:caption>Western blot testing of rat brain lysate with PSD95 antibody at 0.3ug/ml. Molecular weight: routinely observed at 80~95 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prpf31-antibody-prp31-bha17107300</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a1a00fd8-83a4-40c9-a5ea-226c9788a74f.jpg?v=1775785958</image:loc>
      <image:title>PRPF31 Antibody / PRP31</image:title>
      <image:caption>Western blot testing of HeLa cell lysate with PRPF31 antibody at 1ug/ml with [B] and without [A] blocking/immunizing peptide. Predicted molecular weight: ~55kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/psat1-antibody-phosphoserine-aminotransferase-bha17105872</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7745a42d-09b2-4746-a5fa-498126f2531f.jpg?v=1775785770</image:loc>
      <image:title>PSAT1 Antibody / Phosphoserine aminotransferase</image:title>
      <image:caption>Western blot testing of 1) rat pancreas and 2) human HeLa lysate with PSAT1 antibody at 0.5ug/ml. Predicted/observed molecular weight ~40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/psme2-antibody-bha17107650</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c080dce7-fdb5-4662-a9b9-f5c1f602c079.jpg?v=1775785996</image:loc>
      <image:title>PSME2 Antibody</image:title>
      <image:caption>Western blot testing of human spleen lysate with PSME2 antibody at 0.5ug/ml. Predicted molecular weight: ~27 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/psma2-antibody-proteasome-20s-alpha-2-bha17105874</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3bdef8be-9959-4d81-81bd-66cf276031bf.jpg?v=1775785770</image:loc>
      <image:title>PSMA2 Antibody / Proteasome 20S alpha 2</image:title>
      <image:caption>Western blot testing of 1) rat testis and 2) human MCF7 lysate with PSMA2 antibody at 0.5ug/ml. Predicted/observed molecular weight ~26 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/psmb4-antibody-bha17107682</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7229f081-6c3b-4e8a-a680-775d9feb2c91.jpg?v=1775785999</image:loc>
      <image:title>PSMB4 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate with PSMB4 antibody at 0.1ug/ml. Predicted molecular weight ~29 kDa, commonly observed at 26-29 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/psma4-antibody-proteasome-20s-alpha-4-bha17105876</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f44c822b-c2ee-453e-93b4-63dc3422fefa.jpg?v=1775785769</image:loc>
      <image:title>PSMA4 Antibody / Proteasome 20S alpha 4</image:title>
      <image:caption>Western blot testing of 1) rat liver, 2) mouse spleen and 3) human HeLa lysate with PSMA4 antibody at 0.5ug/ml. Predicted/observed molecular weight ~29 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/psmb3-antibody-bha17107656</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a004e0e4-91a2-4052-9606-88efae1de607.jpg?v=1775785997</image:loc>
      <image:title>PSMB3 Antibody</image:title>
      <image:caption>Western blot testing of K562 lysate with PSMB3 antibody at 1ug/ml. Predicted molecular weight: ~23 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/psme1-antibody-bha17107403</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_497fcc23-0f01-4b1a-9ef3-789b61f33e56.jpg?v=1775785969</image:loc>
      <image:title>PSME1 Antibody</image:title>
      <image:caption>Western blot testing of human peripheral blood mononucleocyte lysate with PSME1 antibody at 0.3ug/ml. Predicted molecular weight: ~29kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prrx1-antibody-bha17107079</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a0b7c7e8-d428-445e-bdd7-b3e9ac5ea389.jpg?v=1775785932</image:loc>
      <image:title>PRRX1 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with PRRX1 antibody at 1ug/ml. Predicted/observed molecular weight: ~27 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptger4-antibody-ep4-prostaglandin-e-receptor-4-bha17106021</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0b92a70f-5af0-4bde-a7e9-764db4a70bec.jpg?v=1775785795</image:loc>
      <image:title>PTGER4 Antibody / EP4 / Prostaglandin E Receptor 4</image:title>
      <image:caption>Western blot testing of human 1) SW620 and 2) MCF7 cell lysate with PTGER4 antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/psma1-antibody-proteasome-20s-alpha-1-bha17105873</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8a1ee56c-3967-4ea4-8861-f8eebb7545c7.jpg?v=1775785772</image:loc>
      <image:title>PSMA1 Antibody / Proteasome 20S alpha 1</image:title>
      <image:caption>IHC staining of FFPE human rectum adenocarcinoma tissue with PSMA1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptch1-antibody-bha17106872</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_64d9261b-4c33-451c-b068-9c451e261a25.jpg?v=1775785911</image:loc>
      <image:title>PTCH1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human breast tissue with PTCH1 antibody at 3.75ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptcd2-antibody-bha17107698</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_761b1639-b013-4f24-8717-a9b25aaa306a.jpg?v=1775786000</image:loc>
      <image:title>PTCD2 Antibody</image:title>
      <image:caption>Western blot testing of human liver lysate with PTCD2 antibody at 0.5ug/ml. Predicted molecular weight: ~44kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptbp1-antibody-bha17106558</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6ce8de2c-b15d-417e-b316-5c1999ef9b5c.jpg?v=1775785876</image:loc>
      <image:title>PTBP1 Antibody</image:title>
      <image:caption>Western blot testing of human ovay lysate with PTBP1 antibody at 0.1ug/ml. Predicted molecular weight ~57 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/psp-antibody-parotid-secretory-protein-bha17107503</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_379e9bd1-88f3-4f2f-bd54-8ccee3eafe47.jpg?v=1775785982</image:loc>
      <image:title>Psp Antibody / Parotid secretory protein</image:title>
      <image:caption>ICC testing of mouse submanidbular gland cells (in blue) with Psp antibody at 4ug/ml (counter staining of E-cadherin in red and nuclear in green).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/prune2-antibody-bha17107568</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a67d4e5a-c519-465e-8f20-bf8ff30cfd6a.jpg?v=1775785987</image:loc>
      <image:title>PRUNE2 Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with PRUNE2 antibody at 1ug/ml. Predicted/observed molecular weight: ~30kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptchd3-antibody-bha17107369</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f1f94684-50ec-4102-a6ef-0650b676eff9.jpg?v=1775785965</image:loc>
      <image:title>PTCHD3 Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with PTCHD3 antibody at 0.3ug/ml. Predicted molecular weight: ~87kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pten-antibody-bha17106103</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b4e57c4d-760e-4624-b940-3a29d04bd579.jpg?v=1775785807</image:loc>
      <image:title>PTEN Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse liver and 3) human A549 lysate with PTEN antibody at 0.5ug/ml. Predicted molecular weight: 47~55 kDa (isoform 1), 65~70 kDa (&apos;long&apos; isoform).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptch1-antibody-bha17106782</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_29e3aedf-7d7a-4747-8b4d-01195aad838d.jpg?v=1775785902</image:loc>
      <image:title>PTCH1 Antibody</image:title>
      <image:caption>Western blot testing of mouse fetal kidney lysate with PTCH1 antibody at 2ug/ml. Predicted molecular weight ~161/154/144 kDa (isoforms L/M/S) with glycosylated PTCH1 visualized at ~200 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptchd1-antibody-bha17106551</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_42738955-497f-43a3-9bff-c4b682229c28.jpg?v=1775785875</image:loc>
      <image:title>PTCHD1 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with PTCHD1 antibody at 0.5ug/ml. The expected ~100kDa band and the additional ~50kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/psmf1-antibody-pi31-proteasome-inhibitor-pi31-subunit-bha17106567</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f3399261-4abc-4657-95d0-c9e9acfaf343.jpg?v=1775785878</image:loc>
      <image:title>PSMF1 Antibody / PI31 / Proteasome inhibitor PI31 subunit</image:title>
      <image:caption>Western blot testing of human kidney lysate and PSMF1 antibody at 1ug/ml. Predicted molecular weight: ~30kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptp4a1-antibody-bha17107279</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2b27d930-d4c6-42b9-867f-5e05a65e9f95.jpg?v=1775785954</image:loc>
      <image:title>PTP4A1 Antibody</image:title>
      <image:caption>Western blot testing of A549 lysate with PTP4A1 antibody at 1ug/ml. Predicted/observed molecular weight: ~20kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptger3-antibody-bha17107384</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f866dd17-3688-4cbe-96d0-80431ada604d.jpg?v=1775785966</image:loc>
      <image:title>PTGER3 Antibody</image:title>
      <image:caption>Western blot testing of human adipose lysate with PTGER3 antibody at 1ug/ml. Predicted molecular weight: ~50/47kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pu-1-antibody-spi1-bha17106626</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fabdbd94-5f3c-4be9-91de-22db6d16ad1c.jpg?v=1775785884</image:loc>
      <image:title>PU.1 Antibody / SPI1</image:title>
      <image:caption>Western blot testing of Daudi lysate with PU.1 antibody at 0.03ug/ml. Predicted molecular weight ~31 kDa but routinely observed at ~40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptger1-antibody-bha17106703</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1f1cf03f-2592-4179-b9a2-be04e4757283.jpg?v=1775785892</image:loc>
      <image:title>PTGER1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human kidney with PTGER1 antibody at 2ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pten-antibody-bha17105493</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0514174e-a51b-4438-a17e-1c6e3c7f941a.jpg?v=1775785698</image:loc>
      <image:title>PTEN Antibody</image:title>
      <image:caption>Western blot testing of rat brain with PTEN antibody. Expected molecular weight: 47~55 kDa (isoform 1), 65~70 kDa (&apos;long&apos; isoform).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptgs2-antibody-cox2-bha17106020</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_95c6fa06-320d-4754-991a-99ec4ccc6d10.jpg?v=1775785796</image:loc>
      <image:title>PTGS2 Antibody / COX2</image:title>
      <image:caption>Western blot testing of human 1) Jurkat, 2) HeLa, 3) HepG2, 4) A549 and 5) U-87 MG cell lysate with PTGS2 antibody at 0.5ug/ml. Predicted molecular weight ~69 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptp4a2-antibody-bha17105543</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1ff6fdee-2a07-47ed-aaf7-a833f17a328e.jpg?v=1775785709</image:loc>
      <image:title>PTP4A2 Antibody</image:title>
      <image:caption>IHC testing of FFPE human prostate cancer with PTP4A2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptpn2-antibody-bha17105337</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1814ad7c-3406-4933-bebf-04eadd1790e3.jpg?v=1775785680</image:loc>
      <image:title>PTPN2 Antibody</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) Jurkat lysate with PTPN2 antibody. Predicted/observed molecular weight ~48 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptp1b-antibody-protein-tyrosine-phosphatase-1b-n-terminal-region-bha17106141</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_bac10c1c-4db0-4763-8890-15556433ab3f.jpg?v=1775785816</image:loc>
      <image:title>PTP1B Antibody / Protein-tyrosine phosphatase 1B / N-Terminal Region</image:title>
      <image:caption>IHC staining of FFPE rat spleen tissue with PTP1B antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pu-1-antibody-spi1-bha17105340</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_50af7c09-161a-409b-9c92-840959c700a4.jpg?v=1775785676</image:loc>
      <image:title>PU.1 Antibody / SPI1</image:title>
      <image:caption>IHC testing of FFPE human tonsil with PU.1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pum2-antibody-bha17106668</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_61cca29f-604e-436c-9cbf-8f53d50d8375.jpg?v=1775785888</image:loc>
      <image:title>PUM2 Antibody</image:title>
      <image:caption>Western blot testing of HEK293 lysate overexpressing human PUM2-FLAG with PUM2 antibody (0.5ug/ml) in Lane A and probed with anti-FLAG (1/3000) in lane C. Mock-transfected HEK293 probed with PUM2 antibody (1ug/ml) in Lane B.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptger2-antibody-bha17105442</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_522f4de4-e179-44f6-b3b2-17b718877f08.jpg?v=1775785688</image:loc>
      <image:title>PTGER2 Antibody</image:title>
      <image:caption>Western blot testing of human 1) placenta, 2) A549 and 3) HepG2 lysate with PTGER2 antibody. Expected/observed molecular weight: 40~53 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pyy-antibody-peptide-yy-bha17105770</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b5e5d04e-60d5-4b70-b32b-5a837fe481f3.jpg?v=1775785748</image:loc>
      <image:title>PYY Antibody / Peptide YY</image:title>
      <image:caption>Immunofluorescent staining of FFPE rat stomach tissue with PYY antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptov1-antibody-bha17105607</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4d65e8e8-d78b-434a-a637-19b714220fd9.jpg?v=1775785720</image:loc>
      <image:title>PTOV1 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) rat kidney lysate with PTOV1 antibody. Predicted/expected molecular weight ~47 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/qki-antibody-bha17106983</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d94a9da3-5c6f-4aec-b8d7-b0dc0faecb32.jpg?v=1775785924</image:loc>
      <image:title>QKI Antibody</image:title>
      <image:caption>Western blot testing of mouse brain lysate with QKI antibody at 0.3ug/ml. Predicted/observed molecular weight: ~38kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rab14-antibody-bha17105495</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8d8e7cb7-d439-4544-b1eb-72db81f40198.jpg?v=1775785699</image:loc>
      <image:title>RAB14 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) human Raji and 3) human SMMC lysate with RAB14 antibody. Expected/observed molecular weight ~24 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rab10-antibody-bha17105494</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_76030c91-f2a7-4198-88ed-8560b3b4529d.jpg?v=1775785696</image:loc>
      <image:title>RAB10 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse thymus, 3) mouse brain, 4) human HeLa, 5) MCF7 and 6) COLO320 lysate with RAB10 antibody. Expected/observed molecular weight ~22 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/purine-nucleoside-phosphorylase-antibody-pnp-bha17105912</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_df9f6bc3-9b7f-4d93-b1a8-336941c8a0fe.jpg?v=1775785780</image:loc>
      <image:title>Purine Nucleoside Phosphorylase Antibody / PNP</image:title>
      <image:caption>IHC testing of FFPE human renal cancer tissue with Purine nucleoside phosphorylase antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rab13-antibody-bha17105467</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_62415855-4c5c-49cd-b002-c3beb5a9b1bd.jpg?v=1775785692</image:loc>
      <image:title>RAB13 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human MCF7 cells with RAB13 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rab18-antibody-bha17105657</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3dd5045a-8eaa-40e3-bc70-48907af253dd.jpg?v=1775785730</image:loc>
      <image:title>RAB18 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) rat lung, 3) human 293, 4) human HeLa and 5) human HepG2 lysate with RAB18 antibody. Expected molecular weight ~23 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ptprf-antibody-lar-bha17105285</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8906a4ce-83ad-4f07-974d-171757d4ea03.jpg?v=1775785680</image:loc>
      <image:title>PTPRF Antibody / LAR</image:title>
      <image:caption>Western blot testing of human 1) HeLa, 2) A431 and 3) A549 cell lysate with PTPRF antibody. Observed molecular weight ~240 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/pyruvate-carboxylase-antibody-bha17107314</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0ea46e81-6f05-4bb4-ae7d-0edce387c275.jpg?v=1775785960</image:loc>
      <image:title>Pyruvate Carboxylase Antibody</image:title>
      <image:caption>Western blot testing of mouse liver lysate with Pyruvate Carboxylase antibody at 0.03ug/ml. Predicted molecular weight: ~130 kDa, observed here at 140~150 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rab5-antibody-bha17105350</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_6ea27de4-c678-4d70-9169-fd54923992df.jpg?v=1775785673</image:loc>
      <image:title>RAB5 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain, and human 3) HeLa, 4) SW620, 5) 293 and 6) Jurkat lysate with RAB5 antibody. Expected/observed molecular weight ~25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rab2-antibody-bha17107099</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f32314e1-2529-483c-a013-be925ce64f11.jpg?v=1775785937</image:loc>
      <image:title>RAB2 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with RAB2 antibody at 1ug/ml. Isoforms of 24kDa and 21kDa can be detectd.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rab8a-antibody-bha17107675</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_55a533f0-38fd-4ef6-8692-b3c2b79c610e.jpg?v=1775786001</image:loc>
      <image:title>RAB8A Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with RAB8A antibody at 0.1ug/ml. Predicted molecular weight: ~24kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rabenosyn-5-antibody-bha17106867</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8cc48b5d-9128-441c-8100-297455076715.jpg?v=1775785910</image:loc>
      <image:title>Rabenosyn 5 Antibody</image:title>
      <image:caption>Western blot testing of A431 lysate with Rabenosyn 5 antibody at 0.3ug/ml. Predicted molecular weight: ~89kDa but commonly observed at ~110kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/racgap1-antibody-biotin-conjugate-bha17107076</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9cdc7e85-222e-4d04-9a44-4611f0ac3eb9.jpg?v=1775785931</image:loc>
      <image:title>RACGAP1 Antibody (Biotin Conjugate)</image:title>
      <image:caption>Western blot testing of human Jurkat lysate with biotinylated RACGAP1 antibody at 1ug/ml. Predicted molecular weight: ~71kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rab11fip1-antibody-bha17106759</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8151d012-b850-4042-99d7-93340447a9a5.jpg?v=1775785898</image:loc>
      <image:title>RAB11FIP1 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with RAB11FIP1 antibody at 0.2ug/ml. Predicted molecular weight: ~71kDa, routinley observed at 80~90kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rab9-antibody-bha17105466</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a7956a71-18e2-4521-bd21-947bb52cfee5.jpg?v=1775785693</image:loc>
      <image:title>RAB9 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human HeLa cells with RAB9 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rad51ap1-antibody-bha17106341</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_24df8a85-a54e-40c5-8f22-a8ba7682474e.jpg?v=1775785849</image:loc>
      <image:title>RAD51AP1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human testis with RAD51AP1 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rac1-antibody-ras-related-c3-botulinum-toxin-substrate-1-bha17105501</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_40811084-0d83-486f-a29f-7ae2084c9e1f.jpg?v=1775785700</image:loc>
      <image:title>RAC1 Antibody / Ras-related C3 botulinum toxin substrate 1</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with RAC1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rab11a-antibody-bha17105498</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b800a2bb-7f0a-411b-af09-dd7c2c7614a6.jpg?v=1775785699</image:loc>
      <image:title>RAB11A Antibody</image:title>
      <image:caption>IF/ICC staining of FFPE human U-2 OS cells with RAB11 antibody (green) at 5ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/racgap1-antibody-bha17107075</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8086e337-0ed9-40fb-8626-d57b88801636.jpg?v=1775785934</image:loc>
      <image:title>RACGAP1 Antibody</image:title>
      <image:caption>Western blot testing of K562 lysate with RACGAP1 antibody at 1ug/ml. Predicted molecular weight: ~71 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rag2-antibody-bha17105487</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ef3b0a4d-f322-466e-8db7-b5f2e0fababf.jpg?v=1775785696</image:loc>
      <image:title>RAG2 Antibody</image:title>
      <image:caption>Western blot testing of human 1) A549, 2) 22RV1 and 3) U20S cell lysate with RAG2 antibody. Expected/observed molecular weight ~59 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ranbp16-antibody-bha17107702</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a1231185-08ea-4d5d-9cb3-4b0c54c8281e.jpg?v=1775786001</image:loc>
      <image:title>RANBP16 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with RANBP16 antibody at 0.5ug/ml. Predicted molecular weight: ~124 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rab7-antibody-bha17105465</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_514b27e2-f76b-4bc7-be40-5e53a2df2bbd.jpg?v=1775785691</image:loc>
      <image:title>RAB7 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human MCF7 cells with RAB7 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ranbp1-antibody-bha17107565</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_19801f85-eacf-47aa-9b1f-7e65b22e0a6f.jpg?v=1775785989</image:loc>
      <image:title>RanBP1 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with RanBP1 antibody at 0.05ug/ml. Expected molecular weight: 23-26 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ralb-antibody-bha17105293</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_42e7401e-ef72-4281-82b2-9a6118abdc3f.jpg?v=1775785673</image:loc>
      <image:title>RALB Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A549 cells with RALB antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rala-antibody-bha17105292</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c6fbd16b-3e7a-4bae-8802-d2b839a953a7.jpg?v=1775785675</image:loc>
      <image:title>RALA Antibody</image:title>
      <image:caption>Western blot testing of rat 1) brain, 2) thymus, 3) testis, 4) mouse thymus, 5) mouse liver, 6) human HeLa and 7) human MCF7 lysate with RALA antibody. Expected/observed molecular weight ~24 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ran-antibody-ras-related-nuclear-protein-bha17106119</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_869deed4-ae1e-45d6-acf5-ca5c57ff8c4e.jpg?v=1775785814</image:loc>
      <image:title>RAN Antibody / Ras-related nuclear protein</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) rat testis, 3) rat thymus, 4) mouse brain, 5) mouse testis, 6) mouse thymus, 7) human A549, 8) human 22RV1 and 9) human HeLa lysate with RAN antibody at 0.5ug/ml. Predicted molecular weight ~25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rage-antibody-bha17105565</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4832e3d4-701e-4a8c-91d1-1e68687f5518.jpg?v=1775785713</image:loc>
      <image:title>RAGE Antibody</image:title>
      <image:caption>Western blot testing of 1) rat lung, 2) human RH35 and 3) HeLa lysate with RAGE antibody. Predicted molecular weight: 45-55 kDa depending on glycosylation level.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rae1-antibody-bha17107574</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_fbd132aa-26ff-4332-9d5f-f97252094232.jpg?v=1775785987</image:loc>
      <image:title>RAE1 Antibody</image:title>
      <image:caption>Western blot testing of A) HepG2, B) HeLa, C) Jurkat and D) MCF7 lysates with RAE1 antibody at 0.1ug/ml. Predicted molecular weight: ~41 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ramp1-antibody-bha17106734</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f43a1590-007d-4799-b7ce-e7ea9a3ae3ec.jpg?v=1775785896</image:loc>
      <image:title>Ramp1 Antibody</image:title>
      <image:caption>Western blot testing of rat brain lysate with Ramp1 antibody at 0.3ug/ml. Routinely observed at ~18kDa and 40kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rap1-antibody-bha17107030</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_76d85d15-f489-4086-b3a9-a451b61d7be5.jpg?v=1775785928</image:loc>
      <image:title>RAP1 Antibody</image:title>
      <image:caption>Western blot testing of human tonsil lysate with RAP1 antibody at 0.2ug/ml. Predicted molecular weight ~44kDa but routinely observed at 55~60kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rassf3-antibody-bha17106414</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c885b8a8-fa0f-4ee3-8d4c-aa65fe1186e0.jpg?v=1775785857</image:loc>
      <image:title>RASSF3 Antibody</image:title>
      <image:caption>Western blot testing of heart lysate with RASSF3 antibody at 0.5ug/ml with [B] and without [A] immunizing/blocking peptide. Predicted molecular weight: ~27kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ran-antibody-bha17106293</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e4667af0-687d-44b3-bc0b-9e8738b0754b.jpg?v=1775785839</image:loc>
      <image:title>RAN Antibody</image:title>
      <image:caption>Western blot testing of A431 with RAN antibody at 0.5ug/ml. Predicted molecular weight ~25 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rankl-antibody-bha17105771</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_325c8e57-cb65-4b73-88cc-2c925688172e.jpg?v=1775785746</image:loc>
      <image:title>RANKL Antibody</image:title>
      <image:caption>Western blot testing of rat brain lysate with RANKL antibody at 0.5ug/ml. Expected molecular weight: 35-40 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ranbp1-antibody-ran-specific-binding-protein-1-bha17106032</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e8a34ff4-8f9c-497d-a8e1-f00f6488fbbb.jpg?v=1775785798</image:loc>
      <image:title>RanBP1 Antibody / Ran-specific binding protein 1</image:title>
      <image:caption>IHC testing of FFPE human lung cancer tissue with RanBP1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rank-antibody-bha17106101</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0b529ecf-4cf6-435d-b5aa-6c71d6dd3767.jpg?v=1775785810</image:loc>
      <image:title>RANK Antibody</image:title>
      <image:caption>IHC testing of FFPE human intestinal cancer tissue with RANK antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rangap1-antibody-bha17106342</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e52d3cc0-0f89-4adf-822e-cb9c688d6ab8.jpg?v=1775785849</image:loc>
      <image:title>RANGAP1 Antibody</image:title>
      <image:caption>Western blot testing of NIH3T3 lysate with RANGAP1 antibody at 0.2ug/ml. Predicted molecular weight: ~68kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ranbp2-antibody-c-terminal-region-bha17106169</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0d9f0b62-ed5d-4125-ac5f-3ec51c5ab473.jpg?v=1775785817</image:loc>
      <image:title>RanBP2 Antibody (C-Terminal Region)</image:title>
      <image:caption>Western blot testing of 1) rat brain and 2) mouse brain lysate with RanBP2 antibody at 0.5ug/ml. Predicted molecular weight ~358 kDa, observed here at ~270 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ranbp9-antibody-bha17107078</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2ebbef9a-a24b-447f-adfe-c868efc114de.jpg?v=1775785932</image:loc>
      <image:title>RANBP9 Antibody</image:title>
      <image:caption>IHC testing of FFPE human tonsil with RANBP9 antibody at 3ug/ml. Microwaved antigen retrieval with Tris/EDTA buffer pH9, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rbbp4-antibody-rbap48-nurf55-bha17105538</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_07ec2ae3-38a7-48fc-add6-9bb7ab193a0d.jpg?v=1775785709</image:loc>
      <image:title>RBBP4 Antibody / RbAp48 / NURF55</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with RBBP4 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rassf7-antibody-bha17106480</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e0b6a838-773e-475a-8e60-5b554ba1a277.jpg?v=1775785866</image:loc>
      <image:title>RASSF7 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat cell lysate with RASSF7 antibody at 1ug/ml. Predicted molecular weight: ~40kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rasgap-antibody-rasa1-bha17105355</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_da0ada2d-6088-451c-8fb2-086f52184ff5.jpg?v=1775785676</image:loc>
      <image:title>RASGAP Antibody / RASA1</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A431 cells with RASGAP antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rap1a-antibody-krev1-bha17105499</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ac0954d4-20f8-45b7-ab84-58a15bd14777.jpg?v=1775785698</image:loc>
      <image:title>RAP1A Antibody / KREV1</image:title>
      <image:caption>Western blot testing of rat 1) heart, 2) lung, 3) stomach, 4) kidney and mouse 5) heart, 6) lung, 7) stomach and 8) kidney lysate with RAP1A antibody. Expected molecular weight ~21 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rbm3-antibody-bha17106685</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_424925e4-661d-49a0-9ad8-fc39edf34b3e.jpg?v=1775785890</image:loc>
      <image:title>RBM3 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 lysate with RBM3 antibody at 0.01ug/ml. The expected ~17kDa band and the additional ~48kDa band are both blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rcan1-antibody-calcipressin-1-bha17107136</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a145555c-07e3-4475-9cb2-9cda43e0c7e7.jpg?v=1775785941</image:loc>
      <image:title>RCAN1 Antibody / Calcipressin 1</image:title>
      <image:caption>Western blot testing of mouse brain and KO mouse brain lysates with RCAN1 antibody at 1ug/ml.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rbx1-antibody-roc1-bha17105500</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_1d231491-bce6-4cd8-b0d8-39b961ab997c.jpg?v=1775785699</image:loc>
      <image:title>RBX1 Antibody / ROC1</image:title>
      <image:caption>Western blot testing of 1) rat testis, 2) rat brain, 3) mouse brain and 4) mouse spleen lysate with RBX1 antibody. Expected molecular weight: 12-15 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rbp4-antibody-retinol-binding-protein-4-bha17106710</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ee7f906f-5d49-4164-99e0-5a300f7e23b6.jpg?v=1775785892</image:loc>
      <image:title>RBP4 Antibody / Retinol Binding Protein 4</image:title>
      <image:caption>Western blot testing of human liver lysate with RBP4 antibody at 0.3ug/ml. Predicted molecular weight: ~23kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rbp4-antibody-retinol-binding-protein-4-bha17106174</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d1c1b4f8-e107-481b-a692-43c66d059dc1.jpg?v=1775785819</image:loc>
      <image:title>RBP4 Antibody / Retinol Binding Protein 4</image:title>
      <image:caption>Western blot testing of 1) mouse liver, 2) rat liver, 3) human placenta and 4) human HepG2 lysate with RBP4 antibody at 0.5ug/ml. Predicted molecular weight ~23 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rel-b-antibody-bha17105516</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_732b13a5-6306-44f4-b07a-9ad4d2504fe8.jpg?v=1775785702</image:loc>
      <image:title>Rel-B Antibody</image:title>
      <image:caption>Western blot testing of human 1) Ramos and 2) Daudi lysate with Rel-B antibody. Expected molecular weight ~62 kDa, can be observed as a ~57/68 kDa doublet.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rer1-antibody-bha17107126</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_30e18029-90c2-4fee-8ce4-b66174f10bea.jpg?v=1775785938</image:loc>
      <image:title>RER1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human uterus tissue with RER1 antibody at 3.75ug/ml. Required HIER: steamed antigen retrieval with pH6 citrate buffer; AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rest-antibody-bha17107757</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c60307e3-2957-40c1-9b0d-f16219d2305f.jpg?v=1775786008</image:loc>
      <image:title>REST Antibody</image:title>
      <image:caption>Western blot testing of HEK293 [A] and HeLa [B] lysate with REST antibody at 0.3ug/ml. Predicted molecular weight ~122kDa but routinely observed at ~140kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rel-antibody-c-rel-bha17107591</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c48086bb-b610-48ab-83a1-55beb449f9fa.jpg?v=1775785991</image:loc>
      <image:title>REL Antibody / c-Rel</image:title>
      <image:caption>Western blot testing of human spleen lysate with REL antibody at 0.5ug/ml. Predicted molecular weight: ~69 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rgs13-antibody-bha17106537</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7c4b803a-fda3-4477-a060-4ff9f57744ce.jpg?v=1775785872</image:loc>
      <image:title>RGS13 Antibody</image:title>
      <image:caption>Western blot testing of peripheral blood mononucleocyte lysate with RGS13 antibody at 0.5ug/ml. Predicted molecular weight: ~19kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/resistin-antibody-bha17105655</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0f6a1a90-68b2-4e64-ba77-7bbd576e4948.jpg?v=1775785727</image:loc>
      <image:title>Resistin Antibody</image:title>
      <image:caption>Western blot testing of human recombinant protein with Resistin antibody. Expected size: ~11 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/relaxin-antibody-rln1-bha17106266</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_36e236dd-1b39-4e3d-bd5c-a137238d7b9e.jpg?v=1775785836</image:loc>
      <image:title>Relaxin Antibody / RLN1</image:title>
      <image:caption>Western blot testing of rat PC-12 cell lysate with Relaxin antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rhcg-antibody-bha17106947</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_55077dc9-3b78-4b53-b6ac-9dc39737e017.jpg?v=1775785919</image:loc>
      <image:title>RHCG Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with RHCG antibody at 1ug/ml. Predicted molecular weight: ~53kDa, routinely observed at ~60kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rgs14-antibody-bha17107240</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b4cc28e2-e28a-4cfc-bb79-88dd35877003.jpg?v=1775785952</image:loc>
      <image:title>RGS14 Antibody</image:title>
      <image:caption>FACS testing of fixed and permeabilized human HeLa cells with RGS14 antibody (blue) at 10ug/ml and naive goat Ig (black).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ribonuclease-inhibitor-antibody-rnh1-bha17105305</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c249e7e4-49ba-487f-8c1c-1bce1a774870.jpg?v=1775785677</image:loc>
      <image:title>Ribonuclease Inhibitor Antibody / RNH1</image:title>
      <image:caption>IHC staining of FFPE human intestinal cancer tissue with Ribonuclease Inhibitor antibody. HIER: boil tissue sections in pH6 citrate buffer for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/retinal-s-antigen-antibody-bha17106237</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c8248ee2-f9f0-41a7-8596-e4d9dc91793d.jpg?v=1775785830</image:loc>
      <image:title>Retinal S antigen Antibody</image:title>
      <image:caption>Western blot testing of 1) rat eye ball and 2) mouse eye ball lysate with Retinal S antigen antibody at 0.5ug/ml. Expected molecular weight ~48 kDa, observed at 45-55 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ribosomal-protein-l19-antibody-bha17107561</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8162d640-a8a1-44dd-8d86-a27030ea5550.jpg?v=1775785986</image:loc>
      <image:title>Ribosomal Protein L19 Antibody</image:title>
      <image:caption>Western blot testing of human testis lysate with Ribosomal Protein L19 antibody at 0.1ug/ml. Expected molecular weight: 23-28 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rig-i-antibody-ddx58-bha17106120</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_73852867-5099-4057-a530-d5f29ac9f09e.jpg?v=1775785809</image:loc>
      <image:title>RIG-I Antibody / DDX58</image:title>
      <image:caption>Western blot testing of 1) rat spleen, 2) rat thymus, 3) mouse spleen, 4) mouse thymus, 5) mouse NIH3T3 and 6) human Jurkat lysate with RIG-I antibody at 0.5ug/ml. Expected molecular weight: 106-115 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rhbg-antibody-bha17107804</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c5fb3a7a-caf0-4bc6-a923-c8fe933ba568.jpg?v=1775786010</image:loc>
      <image:title>RHBG Antibody</image:title>
      <image:caption>Western blot testing of NSO lysate with RHBG antibody at 1ug/ml. Predicted molecular weight: ~50/55kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rgs1-antibody-bha17107653</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8fb35f05-f26a-45ba-ac3a-f1cf6244bff3.jpg?v=1775785996</image:loc>
      <image:title>RGS1 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 lysate with RGS1 antibody at 1ug/ml. Predicted molecular weight: ~24 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rgs18-antibody-bha17106431</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_54f6016a-b48a-4829-b5ad-16a25a361e2e.jpg?v=1775785858</image:loc>
      <image:title>RGS18 Antibody</image:title>
      <image:caption>Western blot testing of human peripheral blood mononucleocyte lysate with RGS18 antibody at 1ug/ml. Predicted molecular weight: ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rkip-antibody-pbp-pebp1-bha17106639</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5ea9bfb3-f159-4d4d-8f8c-569aa62c4153.jpg?v=1775785885</image:loc>
      <image:title>RKIP Antibody / PBP / PEBP1</image:title>
      <image:caption>Western blot testing of human prostate lysate with RKIP antibody at 0.01ug/ml. Predicted molecular weight: ~21kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ric8a-antibody-bha17106425</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a5e4f8a9-7abc-4d75-b344-ba4df57bed07.jpg?v=1775785859</image:loc>
      <image:title>RIC8A Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with RIC8A antibody at 1ug/ml. Predicted molecular weight: ~60kDa, observed here at ~70kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rnf13-antibody-bha17107146</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_94a5738f-083e-468f-8023-8db89bdbc8ac.jpg?v=1775785943</image:loc>
      <image:title>RNF13 Antibody</image:title>
      <image:caption>Western blot testing of mouse [A] and rat [B] eye lysates with RNF13 antibody at 2ug/ml. Predicted molecular weight: ~43kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rnf39-antibody-bha17106377</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f1a2ea77-a80c-4faa-90e3-1eead74146ca.jpg?v=1775785852</image:loc>
      <image:title>RNF39 Antibody</image:title>
      <image:caption>Western blot testing of human brain lysate with RNF39 antibody at 1ug/ml. Predicted molecular weight: ~46/38 kDa (isoforms 1/2).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rnf13-antibody-bha17107812</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5936d48a-5a99-4d01-bcfd-fa25123c3fb7.jpg?v=1775786011</image:loc>
      <image:title>RNF13 Antibody</image:title>
      <image:caption>RNF13 Antibody</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rip140-antibody-bha17106833</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3ceaa056-5f59-4764-b677-243ae7f4fc55.jpg?v=1775785907</image:loc>
      <image:title>RIP140 Antibody</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with RIP140 antibody at 0.5ug/ml. Predicted molecular weight: ~127kDa, routinely observed at ~140kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/robo1-antibody-bha17107034</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_02ba9e88-8f2c-43cb-b4b8-9a1ab23a2262.jpg?v=1775785930</image:loc>
      <image:title>ROBO1 Antibody</image:title>
      <image:caption>IHC staining of FFPE human kidney tissue with ROBO1 antibody at 6ug/ml. Required HIER: steamed antigen retrieval with pH6 citrate buffer; HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rnf2-antibody-ring1b-bha17107807</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9cf3dd20-5c47-40c8-bf5e-9e6683a04bb8.jpg?v=1775786013</image:loc>
      <image:title>RNF2 Antibody / RING1B</image:title>
      <image:caption>Western blot testing of K562 lysate with RNF2 antibody at 0.5 ug/ml. Predicted molecular weight: ~38kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rnf213-antibody-bha17107490</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e3bd0269-7158-4dee-bb13-7ed605726a59.jpg?v=1775785981</image:loc>
      <image:title>RNF213 Antibody</image:title>
      <image:caption>IHC testing of FFPE human kidney with RNF213 antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining. Rare nucleoli staining is seen.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rnf34-antibody-bha17107250</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_523a6f0f-7b74-40c6-8fc5-dc30f2b48fd6.jpg?v=1775785952</image:loc>
      <image:title>RNF34 Antibody</image:title>
      <image:caption>IHC testing of FFPE human kidney with RNF34 antibody at 4ug/ml. HIER: steamed with pH9 Tris/EDTA buffer, HRP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rictor-antibody-bha17107443</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f8fc7de1-3a26-4676-849a-6b2323f8a86b.jpg?v=1775785975</image:loc>
      <image:title>RICTOR Antibody</image:title>
      <image:caption>IHC testing of FFPE human kidney with RICTOR antibody at 2.5ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rnf8-antibody-bha17107039</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_24c9ad42-a667-412c-818b-78d0112485a2.jpg?v=1775785928</image:loc>
      <image:title>RNF8 Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with RNF8 antibody at 0.1ug/ml. Predicted molecular weight ~56 kDa but may be observed at larger sizes due to ubiquitination.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rnf31-antibody-bha17106790</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_5a3adbeb-9791-4ef5-9426-714c77c81a62.jpg?v=1775785900</image:loc>
      <image:title>RNF31 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 lysate with RNF31 antibody at 2ug/ml. Predicted molecular weight: ~120kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rnd1-antibody-rho-related-gtp-binding-protein-rho6-bha17106257</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_938928a4-0051-4a02-a962-2bf02b049ae1.jpg?v=1775785831</image:loc>
      <image:title>RND1 Antibody / Rho-related GTP-binding protein Rho6</image:title>
      <image:caption>Western blot testing of mouse liver lysate with RND1 antibody at 0.5ug/ml. Predicted molecular weight ~26 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rnf115-antibody-bha17106658</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f0b5633c-7722-4679-a49e-847f46345b18.jpg?v=1775785888</image:loc>
      <image:title>RNF115 Antibody</image:title>
      <image:caption>Western blot testing of HEPG2 cell lysate with RNF115 antibody at 0.3ug/ml. Predicted molecular weight: ~34kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/ror1-antibody-bha17107067</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_34badc5f-22fd-40f9-a4b6-312f9927076f.jpg?v=1775785933</image:loc>
      <image:title>ROR1 Antibody</image:title>
      <image:caption>IHC testing of FFPE human prostate tissue with ROR1 antibody at 3ug/ml. Required HIER: steamed antigen retrieval with pH6 citrate buffer.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rpa1-antibody-bha17105387</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e847d336-1863-4634-85ba-a676ceeb3916.jpg?v=1775785680</image:loc>
      <image:title>RPA1 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE human A549 cells with RPA1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rpe65-antibody-bha17106998</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e43ff574-f368-4628-97ca-b7d04e57370a.jpg?v=1775785923</image:loc>
      <image:title>RPE65 Antibody</image:title>
      <image:caption>Western blot testing of rat retina lysate with RPE65 antibody at 0.5ug/ml. Predicted molecular weight 60~65kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rpa70-antibody-bha17106415</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0fe4e4bb-7096-49da-941f-af250365c5d5.jpg?v=1775785859</image:loc>
      <image:title>RPA70 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with RPA70 antibody at 0.3ug/ml. Expected molecular weight: ~70kDa. The ~80kDa band is likely acetylated RPA70.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rorc-antibody-bha17106398</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_96c522b9-304d-4f65-9157-10b4dba51eb3.jpg?v=1775785855</image:loc>
      <image:title>RORC Antibody</image:title>
      <image:caption>Western blot testing of human colon lysate with RORC antibody at 0.1ug/ml. Predicted molecular weight: ~56 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rpgrip1l-antibody-protein-fantom-bha17106585</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_648449ba-d700-4983-9859-19b5f9c7e14e.jpg?v=1775785878</image:loc>
      <image:title>RPGRIP1L Antibody / Protein fantom</image:title>
      <image:caption>Western blot testing of human cerebellum lysate with RPGRIP1L antibody at 0.3ug/ml. Predicted molecular weight: ~151kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rnf7-antibody-bha17106494</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e722749c-51fe-44c7-87d9-7d04f4f30a81.jpg?v=1775785868</image:loc>
      <image:title>RNF7 Antibody</image:title>
      <image:caption>Western blot testing of human heart lysate with RNF7 antibody at 1ug/ml. Predicted molecular weight: ~13kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rpl8-antibody-bha17107251</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_97bcced1-7be9-4241-9e44-c7114e1b3f55.jpg?v=1775785954</image:loc>
      <image:title>RPL8 Antibody</image:title>
      <image:caption>Western blot testing of HepG2 cell lysate with RPL8 antibody at 0.01ug/ml. Predicted molecular weight: ~28kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rpsa-antibody-40s-ribosomal-protein-sa-laminin-receptor-1-bha17105880</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a0d3598e-4fad-4b96-b2e6-6acafda7f013.jpg?v=1775785772</image:loc>
      <image:title>RPSA Antibody / 40S Ribosomal protein SA / Laminin Receptor 1</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) U-2 OS cell lysate with RPSA antibody at 0.5ug/ml. Routinely observed molecular weight: 37-40 kDa and 67 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rpl23-antibody-bha17107289</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_45458568-34be-4fa9-befe-7fcce378d96f.jpg?v=1775785956</image:loc>
      <image:title>RPL23 Antibody</image:title>
      <image:caption>Western blot testing of human colorectal cancer lysate with RPL23 antibody at 0.1ug/ml. Predicted molecular weight: ~15kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rps19-antibody-bha17107398</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_839806e7-1145-4c38-be39-b658248a7f36.jpg?v=1775785971</image:loc>
      <image:title>RPS19 Antibody</image:title>
      <image:caption>Western blot testing of K562 lysate with RPS19 antibody at 0.1ug/ml. Predicted molecular weight: ~16 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rrm2-antibody-bha17105407</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ce326739-f8c8-428b-89d8-d207c4a61683.jpg?v=1775785673</image:loc>
      <image:title>RRM2 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat heart, 2) mouse heart, 3) human A431 and 4) human HeLa lysate with RRM2 antibody. Expected/observed molecular weight: 45~50 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rpl19-antibody-ribosomal-protein-l19-bha17105878</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d3245d0d-d2f1-4a51-946d-b4c4fd40d431.jpg?v=1775785771</image:loc>
      <image:title>RPL19 Antibody / Ribosomal protein L19</image:title>
      <image:caption>IHC staining of FFPE human brain tissue with RPL19 antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rps6-antibody-bha17106048</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_2ae1ceda-f851-4d93-90af-cc4adcdd3a7d.jpg?v=1775785803</image:loc>
      <image:title>RPS6 Antibody</image:title>
      <image:caption>IHC testing of FFPE human intestinal cancer tissue with RPS6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rxr-beta-antibody-bha17106454</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ce1e7d2b-37bf-42e1-a191-3ce53d93203b.jpg?v=1775785862</image:loc>
      <image:title>RXR beta Antibody</image:title>
      <image:caption>Western blot testing of A431 lysate and RXR beta antibody at 1ug/ml. Predicted molecular weight: ~57kDa but routinely observed at 57~60kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rps6ka2-antibody-rsk3-bha17107012</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_e692ae64-5a1e-42cf-9b49-86faf23c9432.jpg?v=1775785927</image:loc>
      <image:title>RPS6KA2 Antibody [RSK3]</image:title>
      <image:caption>Western blot testing of mouse lung lysate with RPS6KA2 antibody at 0.01ug/ml, observed here at ~75kDa. (1)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/s100a11-antibody-bha17105413</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_72c431c3-4dd3-4af6-967d-5db24e8bda74.jpg?v=1775785673</image:loc>
      <image:title>S100A11 Antibody</image:title>
      <image:caption>Western blot testing of human HeLa cell lysate with S100A11 antibody. Expected/observed molecular weight: 12-15 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rrad-antibody-bha17107191</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_c3977c11-d27e-40ac-9ee8-e2a0dd147bea.jpg?v=1775785945</image:loc>
      <image:title>RRAD Antibody</image:title>
      <image:caption>Figure A): Western blot of HEK293 lysates overexpressing several HA-tagged mouse GTPases including RRAD and compared with an HA-specific antibody. Figure B): Western blot of WT and KO lysates of mouse heart (100ug protein). RRAD antibody was used at 0.5ug/ml.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/rxr-alpha-antibody-bha17106453</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a7b96e4e-d47d-4d71-991b-397862646b79.jpg?v=1775785861</image:loc>
      <image:title>RXR alpha Antibody</image:title>
      <image:caption>Western blot testing of nuclear HeLa lysate with RXR alpha antibody at 0.3ug/ml. Predicted molecular weight: ~51kDa but routinely observed at 54~60kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/s100a8-antibody-bha17107319</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_37576126-8277-415b-a04d-94eceab10c1a.jpg?v=1775785959</image:loc>
      <image:title>S100A8 Antibody</image:title>
      <image:caption>Western blot testing of human lung lysate with S100A8 antibody at 0.03ug/ml. Predicted molecular weight ~11kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/s100a9-antibody-bha17106713</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_552a320a-f076-4efd-9831-35dd8eb303b1.jpg?v=1775785893</image:loc>
      <image:title>S100A9 Antibody</image:title>
      <image:caption>Western blot testing of human peripheral mononucleocytes lysate with S100A9 antibody at 0.5ug/ml. Predicted molecular weight ~13 kDa, routinely observed at 13~16 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/s100a4-antibody-bha17106430</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0135a7a4-6aa3-4d60-a0f4-880403b4707a.jpg?v=1775785859</image:loc>
      <image:title>S100A4 Antibody</image:title>
      <image:caption>Western blot testing of human placenta lysate with S100A4 antibody at 0.03ug/ml. Predicted molecular weight ~12 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/s1pr2-antibody-bha17107722</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_89f22e23-9c5b-48e0-a580-835cfab95eba.jpg?v=1775786003</image:loc>
      <image:title>S1PR2 Antibody</image:title>
      <image:caption>Western blot testing of human frontal cortex lysate with S1PR2 antibody at 0.5ug/ml. Predicted molecular weight: ~39kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/sap97-antibody-bha17105542</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_4286e827-5c55-49cb-b621-73735dcd4cf3.jpg?v=1775785706</image:loc>
      <image:title>SAP97 Antibody</image:title>
      <image:caption>Western blot testing of 1) rat lung, 2) mouse lung, 3) HeLa, 4) MM231, 5) COLO320, 6) A549 and 7) mouse NIH3T3 lysate with SAP97 antibody. Predicted molecular weight: ~103 kDa, rountinely observed at ~140 kDa (Ref 1).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/s100a9-antibody-bha17105411</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_68368030-5852-415f-aa7e-bb6bc9a3631b.jpg?v=1775785678</image:loc>
      <image:title>S100A9 Antibody</image:title>
      <image:caption>Western blot testing of mouse ovary lysate with S100A9 antibody. Expected/observed molecular weight ~14 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/sart1-antibody-bha17107084</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_ac83d85a-22d4-4f9d-ac56-2e3ea6c08589.jpg?v=1775785934</image:loc>
      <image:title>SART1 Antibody</image:title>
      <image:caption>Western blot testing of HeLa lysate with SART1 antibody at 0.03ug/ml. Predicted molecular weight: ~90 kDa, routinely observed at 110-125 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/sap102-antibody-synapse-associated-protein-102-bha17106241</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_80f9c2ce-0f74-45a3-938c-5d4733f3bbec.jpg?v=1775785830</image:loc>
      <image:title>SAP102 Antibody / Synapse-associated protein 102</image:title>
      <image:caption>IHC testing of FFPE mouse brain tissue with SAP102 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/sar1-antibody-sar1a-bha17107207</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b7b31dec-6380-40bb-988a-ce1b8e8b921a.jpg?v=1775785950</image:loc>
      <image:title>SAR1 Antibody / SAR1A</image:title>
      <image:caption>Western blot testing of NIH3T3 lysate with SAR1 antibody at 0.1ug/ml. Predicted molecular weight: ~22 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/sae1-antibody-bha17107570</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_f73ce49f-3202-4d98-8637-de357d19309f.jpg?v=1775785988</image:loc>
      <image:title>SAE1 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with SAE1 antibody at 1ug/ml. Predicted/observed molecular weight: ~40kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/s6k-antibody-rps6kb1-bha17107569</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_56775947-a313-4309-b179-cefe19f71d8d.jpg?v=1775785986</image:loc>
      <image:title>S6K Antibody [RPS6KB1]</image:title>
      <image:caption>Western blot testing of human placenta lysate with S6K antibody at 0.05ug/ml. Predicted molecular weight: ~59kDa, routinely observed at 59-70kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/sall4-antibody-bha17106671</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_d3a6e2e2-2347-4213-a1a5-3893cf184045.jpg?v=1775785888</image:loc>
      <image:title>Sall4 Antibody</image:title>
      <image:caption>Western blot testing of rat testis lysate with Sall4 antibody at 0.1ug/ml. Predicted molecular weight ~110/68kDa (Isoforms a/b). All three bands are blocked by the immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/samsn1-antibody-bha17107247</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0baa1855-71ca-4565-a866-67e9c151c5ac.jpg?v=1775785952</image:loc>
      <image:title>SAMSN1 Antibody</image:title>
      <image:caption>Western blot testing of Jurkat lysate with SAMSN1 antibody at 1ug/ml. Predicted molecular weight: ~49kDa (isoform 3, UniProt# Q9NSI8).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/satb1-antibody-bha17106960</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_17a30007-9af8-4584-aadf-6adfe4e29a00.jpg?v=1775785921</image:loc>
      <image:title>SATB1 Antibody</image:title>
      <image:caption>Western blot testing of MOLT4 lysate with SATB1 antibody at 0.3ug/ml. Predicted molecular weight ~86kDa, routinely observed at 100~110kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/safb-antibody-scaffold-attachment-factor-b1-bha17105881</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_36df5d6b-56f4-4ec0-92f4-e2e2b25e3073.jpg?v=1775785771</image:loc>
      <image:title>SAFB Antibody / Scaffold attachment factor B1</image:title>
      <image:caption>Western blot testing of human 1) HeLa and 2) MCF7 cell lysate with SAFB antibody at 0.5ug/ml. Predicted molecular weight: ~103 kDa but routinley observed at ~150 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/s100a8-antibody-bha17105384</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_3c81a368-ef59-4f9f-b3f9-f3021c562204.jpg?v=1775785677</image:loc>
      <image:title>S100A8 Antibody</image:title>
      <image:caption>Immunofluorescent staining of FFPE mouse NIH 3T3 cells with S100A8 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/scg10-antibody-bha17106317</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_8cd1fa62-3a7e-4adc-b243-dc0575c62bc0.jpg?v=1775785843</image:loc>
      <image:title>SCG10 Antibody</image:title>
      <image:caption>Western blot testing of mouse fetal brain lysate with SCG10 antibody at 0.5ug/ml. Predicted molecular weight: ~21 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/sar1b-antibody-bha17106564</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_7f71dbce-2b00-4be0-8c12-4fdd186153b0.jpg?v=1775785879</image:loc>
      <image:title>SAR1B Antibody</image:title>
      <image:caption>Western blot testing of mouse liver lysate with SAR1B antibody at 0.03ug/ml. Predicted molecular weight: ~22kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/sart3-antibody-tip110-bha17107572</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_b72f6706-9cbe-4ce5-abd9-5d95c07d8684.jpg?v=1775785986</image:loc>
      <image:title>SART3 Antibody / Tip110</image:title>
      <image:caption>Western blot testing of Jurkat cell lysate with SART3 antibody at 0.01ug/ml. Predicted molecular weight: ~111kDa, observed here at ~170kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/scarb2-antibody-bha17107629</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_18447c8e-fc42-4952-9114-6efbf25886d0.jpg?v=1775785994</image:loc>
      <image:title>SCARB2 Antibody</image:title>
      <image:caption>Western blot testing of human cerebral cortex lysate with SCARB2 antibody at 0.1ug/ml. Predicted molecular weight: ~54/85kDa (unmodified/glycosylated).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/scap2-antibody-skap2-prap-bha17107062</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_a7732d60-da98-4ec5-a8e4-63239122048e.jpg?v=1775785931</image:loc>
      <image:title>SCAP2 Antibody / SKAP2 / PRAP</image:title>
      <image:caption>Western blot testing of Jurkat lysate with SCAP2 antibody at 0.5ug/ml. Both the expected 40 kDa and additional 28 kDa band block with the addition of immunizing peptide.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/scp2-antibody-bha17107405</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_9779b65b-4914-4067-aaa5-3a710b68cc27.jpg?v=1775785971</image:loc>
      <image:title>SCP2 Antibody</image:title>
      <image:caption>IHC testing of FFPE human liver with SCP2 antibody at 4ug/ml. HIER: steamed with pH6 citrate buffer, AP-staining.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/sca-1-antibody-ly6a-e-bha17105978</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_beabc090-37a0-4a32-9d93-215c9b60dff8.jpg?v=1775785787</image:loc>
      <image:title>Sca-1 Antibody / Ly6A/E</image:title>
      <image:caption>Western blot testing of mouse HepA1-6 cell lysate with Sca-1 antibody at 0.5ug/ml. Expected molecular weight: 14-18 kDa.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.ebiohippo.com/products/scn1a-antibody-nav1-1-c-terminal-region-bha17105420</loc>
    <lastmod>2026-05-28T04:20:32-04:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0949/7424/7277/files/get_image_0fa358a6-0e77-475e-a586-10450721165c.jpg?v=1775785678</image:loc>
      <image:title>SCN1A Antibody / Nav1.1 (C-Terminal Region)</image:title>
      <image:caption>Western blot testing of 1) rat brain, 2) mouse brain and 3) U87 cell lysate with SCN1A antibody. Predicted molecular weight ~229 kDa but routinely observed at ~250 kDa.</image:caption>
    </image:image>
  </url>
</urlset>
