KX-E-007

SARS (Severe Acute Respiratory Syndrome) Virus; Nidovirales; Coronaviridae; Coronavirus; SARS coronavirus; SARS; Severe acute respiratory syn, SARS (Severe Acute Respiratory Syndrome) Virus; Nidovirales; Coronaviridae; Coronavirus; SARS coronavirus; SARS; Severe acute respiratory syn

SARS-CoV

The product is supplied as lyophilized powder from sterile PBS, pH 7.4，5% mannitol，0.01% tween80

Unconjugated

Product data sheet

Recombinant SARS-CoV-2 spike protein

 (S1 subunit, 10 x his tag)

Expression host:  HEK293 cells

Protein sequence: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSAL EPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRF PNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCV IAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVK NKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTG SNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARAHHHHHHHHHH

Purity: >90% as determined by SDS-PAGE


Figure 1. Purity of S1 (The protein size is larger than expected because of glycosylation)

Biological activity: EC50 = 3.8 nM


Form:  The product is supplied as lyophilized powder from sterile PBS, pH 7.4，5% mannitol，0.01% tween80

Reconstitution: Add deionized water to reconstruct the protein to 1 mg/mL.

Stability and Storage: ​The powder can be stored at 4 °C for up to twelve months. After reconstruction, store under sterile conditions at -20 °C to -80 °C for up to twelve months. It is recommended that the protein is aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
 

HEK293 cells

DON

HEK293 Cells

EC50 = 3.8 nM

PBS, pH 7.4，5% mannitol，0.01% tween80

 

Recombinant SARS-CoV-2 spike protein

Recombinant

76.5kDa

Homo sapiens (Human)

Homo Sapiens (Human)

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSAL EPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRF PNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCV IAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVK NKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTG SNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARAHHHHHHHHHH

Human Cells

 

Coronavirus SARS-CoV-2 in UniProtKB

At the end of 2019, a novel coronavirus (nCoV) of animal origin started infecting humans, initiating a severe outbreak in China. nCoV infection can result in severe and even fatal respiratory diseases, such as acute respiratory distress syndrome. The virus is highly contagious and transmission occurs via airborne droplets and contact. On January 30^th, 2019-nCoV was designated a global health emergency by the WHO. On February 11^th, the WHO called the disease caused by the virus COVID-19, and the virus itself was named Severe Acute Respiratory Syndrome-related coronavirus 2 or SARS-CoV-2 by the International Committee on Taxonomy of Viruses (ICTV).

SARS-CoV-2 belongs to the large family of Coronaviridae, genus Betacoronavirus. This genus comprises mainly vertebrate respiratory viruses, including HCoV-OC43, which is responsible for 10% of common colds, and SARS, which caused an epidemic in 2003, resulting in over 8,000 infected individuals in 26 countries. The novel coronavirus genome has been sequenced. Its close similarity to SARS suggests it has emerged from the same reservoir, namely bats.

With a size of 30 kb, coronaviruses have the largest RNA genomes known to date. The genome encodes a polyprotein 1a that can be elongated by ribosomal frameshifting to produce polyprotein 1ab. The short and elongated polyproteins contain 11 and 15 chains, respectively, and are dedicated to viral RNA transcription and replication, while controlling the host antiviral defense. A strategy used by the virus to escape host cell innate immunity is to induce the formation of a specialized intracellular compartment from the endoplasmic reticulum, called endoplasmic spherules, which protects viral dsRNA replication intermediates. Later on subgenomic mRNAs are translated to produce virion structural proteins and yet another set of immune modulatory factors. Virions are assembled at the ER-Golgi intermediate compartment (or ERGIC) and exported out of the cell. The freshly exported virion is not yet infectious. Its surface is covered by spikes, giving the impression a crown (corona in Latin, hence its name), but spike proteins have to be cleaved in order to become functional and to confer infectivity on the virion. The activating proteolytic cleavages occur in the extracellular space.

It is at the level of spike proteins that SARS-CoV-2 diverges from SARS, differing in both amino acid sequence and glycosylation. The SARS-CoV-2 spike protein cleavage site comprises several arginines, making it an excellent substrate for many host proteases. This feature is predicted to enhance virus tropism and virulence. SARS-CoV-2 interacts with the same host receptor as SARS, ACE2, which presumably explains why both viruses infect lungs, as well as the small intestine and kidney. The functions of several other SARS-CoV-2 proteins are still unclear and need further investigations. Among them is SARS-CoV-2 NS8 protein, which shares sequence similarity with some Bat-hosted coronavirus NS8 proteins, but is entirely different from SARS NS8a or NS8b. Thus, in spite of many similarities to SARS and other coronaviruses, SARS-CoV-2 displays unique molecular features that lead to unpredictable behavior during infection.

SARS-CoV-2 protein sequences from the current public health emergency have been annotated in UniProtKB and made available as a pre-release dataset on the UniProt FTP site. These entries will be available in the usual file formats as part of release 2020_02.

Signal transduction;Tumor immunity;Hematology;

76.5kDa

≥ 92%

PC, SDS, WB, Positive Control, Immunogen, SDS-PAGE

(pdf)