Transmembrane Proteins

738Products
738 products
Image Product Application(s)TargetSpeciesExpression systemPrice Status ACTION
CSB-MP006254HU(F1) is detected by Mouse anti-6*His monoclonal antibody.
Recombinant Human C-X-C chemokine receptor type 4 (CXCR4)-VLPs (Active)
Target: CXCR4
 Functional Assay (In Vitro), ELISA CXCR4 Homo sapiens (Human) Mammalian cell
From $574.74
From $574.74
In Stock at Manufacturer
View
CSB-MP025131HU(M1)is detected by Mouse anti-6*His monoclonal antibody
Recombinant Human Thyrotropin receptor (TSHR), partial-VLPs
Target: TSHR
 Functional Assay (In Vitro), ELISA TSHR Homo sapiens (Human) Mammalian cell
From $574.74
From $574.74
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human Platelet glycoprotein Ib alpha chain (GP1BA), partial
Target: GP1BA
 Functional Assay (In Vitro), ELISA GP1BA Homo sapiens (Human) E.coli
From $315.18
From $315.18
—
View
CSB-MP661031MOd7 detected by Mouse anti-6*His monoclonal antibody
Recombinant Mouse G-protein coupled receptor 183 (Gpr183)-VLPs
Target: Gpr183
 Functional Assay (In Vitro), ELISA Gpr183 Mus musculus (Mouse) Mammalian cell
From $638.60
From $638.60
—
View
CSB-MP837739MO(A4) is detected by Mouse anti-6*His monoclonal antibody
Recombinant Mouse Membrane protein MLC1 (Mlc1)-VLPs
Target: Mlc1
 Functional Assay (In Vitro), ELISA Mlc1 Mus musculus (Mouse) Mammalian cell
From $638.60
From $638.60
—
View
CSB-MP622766HU is detected by Mouse anti-6*His monoclonal antibody
Recombinant Human Frizzled-2 (FZD2)-VLPs
Target: FZD2
 Functional Assay (In Vitro), ELISA FZD2 Homo sapiens (Human) Mammalian cell
From $766.32
From $766.32
—
View
CSB-MP012906HU(A4) is detected by Mouse anti-6*His monoclonal antibody.
Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5)-VLPs (Active)
Target: LGR5
 Functional Assay (In Vitro), ELISA LGR5 Homo sapiens (Human) Mammalian cell
From $638.60
From $638.60
—
View
CSB-MP754160HU is detected by Mouse anti-6*His monoclonal antibody
Recombinant Human STEAP family member 1B (STEAP1B)-VLPs
Target: STEAP1B
 Functional Assay (In Vitro), ELISA STEAP1B Homo sapiens (Human) Mammalian cell
From $766.32
From $766.32
—
View
Recombinant Human Glucagon receptor (GCGR)-VLPs – Figure 1 of 1
Recombinant Human Glucagon receptor (GCGR)-VLPs
Target: GCGR
 Functional Assay (In Vitro), ELISA GCGR Homo sapiens (Human) Mammalian cell
From $574.74
From $574.74
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human CD44 antigen (CD44)-Detergent
Target: CD44
 Functional Assay (In Vitro), ELISA CD44 Homo sapiens (Human) Mammalian cell
From $829.15
From $829.15
—
View
CSB-MP7352HU is detected by Mouse anti-6*His monoclonal antibody
Recombinant Human STEAP4&STEAP1 Heterodimer Protein-VLPs
Target: STEAP4&STEAP1
 Functional Assay (In Vitro), ELISA STEAP4&STEAP1 Homo sapiens (Human) Mammalian cell
From $638.60
From $638.60
—
View
CSB-MP004839HU is detected by Mouse anti-6*His monoclonal antibody.
Recombinant Human C-C chemokine receptor type 1 (CCR1)-VLPs (Active)
Target: CCR1
 Functional Assay (In Vitro), ELISA CCR1 Homo sapiens (Human) Mammalian cell
From $638.60
From $638.60
—
View
CSB-MP619082HU(A4) is detected by Mouse anti-6*His monoclonal antibody.
Recombinant Human BDNF/NT-3 growth factors receptor (NTRK2)-VLPs
Target: NTRK2
 Functional Assay (In Vitro), ELISA NTRK2 Homo sapiens (Human) Mammalian cell
From $638.60
From $638.60
—
View
Recombinant Mouse Protein HIDE1 (Hide1)-VLPs – Figure 1 of 1
Recombinant Mouse Protein HIDE1 (Hide1)-VLPs
Target: Hide1
 Functional Assay (In Vitro), ELISA Hide1 Mus musculus (Mouse) Mammalian cell
From $638.60
From $638.60
—
View
CSB-MP854119HU is detected by Mouse anti-6*His monoclonal antibody
Recombinant Human Metalloreductase STEAP2 (STEAP2)-VLPs
Target: STEAP2
 Functional Assay (In Vitro), ELISA STEAP2 Homo sapiens (Human) Mammalian cell
From $638.60
From $638.60
—
View
Recombinant Human CD63 antigen (CD63)-VLPs – Figure 1 of 1
Recombinant Human CD63 antigen (CD63)-VLPs
Target: CD63
 Functional Assay (In Vitro), ELISA CD63 Homo sapiens (Human) Mammalian cell
From $574.74
From $574.74
—
View
Recombinant Human CD276 antigen (CD276)-VLPs – Figure 1 of 1
Recombinant Human CD276 antigen (CD276)-VLPs
Target: CD276
 Functional Assay (In Vitro), ELISA CD276 Homo sapiens (Human) Mammalian cell
From $638.60
From $638.60
—
View
Recombinant Human Transmembrane protein 184B(TMEM184B)-VLPs – Figure 1 of 1
Recombinant Human Transmembrane protein 184B(TMEM184B)-VLPs
Target: TMEM184B
 Functional Assay (In Vitro), ELISA TMEM184B Homo sapiens (Human) Mammalian cell
From $638.60
From $638.60
—
View
CSB-MP021546HU(A4)d7 is detected by Mouse anti-10*His monoclonal antibody.
Recombinant Human Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1)-VLPs (Active)
Target: SLC2A1
 Functional Assay (In Vitro), ELISA SLC2A1 Homo sapiens (Human) Mammalian cell
From $638.60
From $638.60
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human Somatostatin receptor type 2 (SSTR2)-Detergent
Target: SSTR2
 Functional Assay (In Vitro), ELISA SSTR2 Homo sapiens (Human) Mammalian cell
From $829.15
From $829.15
—
View
The purity of VLPs was greater than 95% as determined by SEC-HPLC
Recombinant Human Adenosine receptor A2a (ADORA2A)-VLPs
Target: ADORA2A
 Functional Assay (In Vitro), ELISA ADORA2A Homo sapiens (Human) Mammalian cell
From $574.74
From $574.74
—
View
The purity of VLPs was greater than 95% as determined by SEC-HPLC
Recombinant Mouse G-protein coupled receptor 183 (Gpr183)-VLPs
Target: Gpr183
 Functional Assay (In Vitro), ELISA Gpr183 Mus musculus (Mouse) Mammalian cell
From $638.60
From $638.60
—
View
Recombinant Mouse Thyrotropin receptor (Tshr)-VLPs – Figure 1 of 1
Recombinant Mouse Thyrotropin receptor (Tshr)-VLPs
Target: Tshr
 Functional Assay (In Vitro), ELISA Tshr Mus musculus (Mouse) Mammalian cell
From $638.60
From $638.60
—
View
CSB-MP001910HU is detected by Mouse anti-6*His monoclonal antibody
Recombinant Human Apelin receptor (APLNR)-VLPs
Target: APLNR
 Functional Assay (In Vitro), ELISA APLNR Homo sapiens (Human) Mammalian cell
From $574.74
From $574.74
—
View
Recombinant Human Transmembrane 4 L6 family member 1 (TM4SF1)-VLPs – Figure 1 of 1
Recombinant Human Transmembrane 4 L6 family member 1 (TM4SF1)-VLPs
Target: TM4SF1
 Functional Assay (In Vitro), ELISA TM4SF1 Homo sapiens (Human) Mammalian cell
From $574.74
From $574.74
—
View
Recombinant Human Somatostatin receptor type 2 (SSTR2)-VLPs – Figure 1 of 1
Recombinant Human Somatostatin receptor type 2 (SSTR2)-VLPs
Target: SSTR2
 Functional Assay (In Vitro), ELISA SSTR2 Homo sapiens (Human) Mammalian cell
From $574.74
From $574.74
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human BDNF/NT-3 growth factors receptor (NTRK2)-Detergent
Target: NTRK2
 Functional Assay (In Vitro), ELISA NTRK2 Homo sapiens (Human) Mammalian cell
From $829.15
From $829.15
—
View
CSB-MP020802HU is detected by Mouse anti-6*His monoclonal antibody
Recombinant Human Stearoyl-CoA desaturase (SCD)-VLPs
Target: SCD
 Functional Assay (In Vitro), ELISA SCD Homo sapiens (Human) Mammalian cell
From $638.60
From $638.60
—
View
CSB-MP011673HU(A4) is detected by Mouse anti-6*His monoclonal antibody
Recombinant Human C-X-C chemokine receptor type 2 (CXCR2)-VLPs (Active)
Target: CXCR2
 Functional Assay (In Vitro), ELISA CXCR2 Homo sapiens (Human) Mammalian cell
From $574.74
From $574.74
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human Claudin-18.2 (CLDN18.2)-Detergent
Target: CLDN18.2
 Functional Assay (In Vitro), ELISA CLDN18.2 Homo sapiens (Human) Mammalian cell
From $704.52
From $704.52
—
View
CSB-MP006255HUd7 is detected by Mouse anti-6*His monoclonal antibody
Recombinant Human C-X-C chemokine receptor type 5 (CXCR5)-VLPs
Target: CXCR5
 Functional Assay (In Vitro), ELISA CXCR5 Homo sapiens (Human) Mammalian cell
From $574.74
From $574.74
—
View
The purity of VLPs was greater than 90% as determined by SEC-HPLC
Recombinant Human Claudin-6 (CLDN6), Fluorescent-VLPs
Target: CLDN6
 Functional Assay (In Vitro), ELISA CLDN6 Homo sapiens (Human) Mammalian cell
From $574.74
From $574.74
—
View
Recombinant Human Claudin-6 (CLDN6), partial-VLPs – Figure 1 of 2
Recombinant Human Claudin-6 (CLDN6), partial-VLPs
Target: CLDN6
 Functional Assay (In Vitro), ELISA CLDN6 Homo sapiens (Human) Mammalian cell
From $574.74
From $574.74
—
View
CSB-MP004841HU is detected by Mouse anti-6*His monoclonal antibody
Recombinant Human C-C chemokine receptor type 2 (CCR2)-VLPs
Target: CCR2
 Functional Assay (In Vitro), ELISA CCR2 Homo sapiens (Human) Mammalian cell
From $574.74
From $574.74
—
View
Recombinant Human Claudin-6(CLDN6), partial-VLPs – Figure 1 of 1
Recombinant Human Claudin-6(CLDN6), partial-VLPs
Target: CLDN6
 Functional Assay (In Vitro), ELISA CLDN6 Homo sapiens (Human) Mammalian cell
From $469.68
From $469.68
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Escherichia coli Colicin-Ia (cia) (626:I→I-QGISSRLAWYQQKPEKAPKSLIYARSPWGYYLDS)
Target: cia
 Functional Assay (In Vitro), ELISA cia Escherichia coli E.coli
From $570.62
From $570.62
—
View

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information