Transmembrane Proteins

738Products
738 products
Image Product Application(s)TargetSpeciesExpression systemPrice Status ACTION
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human Metalloreductase STEAP2 (STEAP2)
Target: STEAP2
 Functional Assay (In Vitro), ELISA STEAP2 Homo sapiens (Human) in vitro E.coli expression system
From $1,040.00
From $1,040.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human Claudin-1 (CLDN1)-Detergent (Active)
Target: CLDN1
 Functional Assay (In Vitro), ELISA CLDN1 Homo sapiens (Human) Mammalian cell
From $725.00
From $725.00
—
View
CSB-MP006253MO is detected by Mouse anti-6*His monoclonal antibody
Recombinant Mouse C-X-C chemokine receptor type 3 (Cxcr3)-VLPs
Target: Cxcr3
 Functional Assay (In Vitro), ELISA Cxcr3 Mus musculus (Mouse) Mammalian cell
From $558.00
From $558.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Mouse Adiponectin receptor protein 1 (Adipor1)
Target: Adipor1
 Functional Assay (In Vitro), ELISA Adipor1 Mus musculus (Mouse) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Mouse Tetraspanin-1 (Tspan1)
Target: Tspan1
 Functional Assay (In Vitro), ELISA Tspan1 Mus musculus (Mouse) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
CSB-MP001910MOW is detected by Mouse anti-6*His monoclonal antibody
Recombinant Macaca mulatta Apelin receptor (APLNR)-VLPs
Target: APLNR
 Functional Assay (In Vitro), ELISA APLNR Macaca mulatta (Rhesus macaque) Mammalian cell
From $744.00
From $744.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Escherichia coli O6:H1 Sensor protein PhoQ (phoQ)
Target: phoQ
 Functional Assay (In Vitro), ELISA phoQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Mouse Membrane protein MLC1 (Mlc1)
Target: Mlc1
 Functional Assay (In Vitro), ELISA Mlc1 Mus musculus (Mouse) in vitro E.coli expression system
From $1,040.00
From $1,040.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Mouse Tetraspanin-4 (Tspan4)
Target: Tspan4
 Functional Assay (In Vitro), ELISA Tspan4 Mus musculus (Mouse) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
CSB-MP001910MO is detected by Mouse anti-6*His monoclonal antibody
Recombinant Mouse Apelin receptor (Aplnr)-VLPs
Target: Aplnr
 Functional Assay (In Vitro), ELISA Aplnr Mus musculus (Mouse) Mammalian cell
From $558.00
From $558.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human STEAP1 protein (STEAP1)
Target: STEAP1
 Functional Assay (In Vitro), ELISA STEAP1 Homo sapiens (Human) in vitro E.coli expression system
From $1,040.00
From $1,040.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Escherichia coli Colicin-Ia (cia) (626:I→I-GFTFSNYAMSWVRQAPGKGLEWVSSQQYNSYPYT)
Target: cia
 Functional Assay (In Vitro), ELISA cia Escherichia coli E.coli
From $554.00
From $554.00
—
View
CSB-MP004928HU is detected by Mouse anti-6*His monoclonal antibody
Recombinant Human Leukocyte antigen CD37 (CD37)-VLPs (Active)
Target: CD37
 Functional Assay (In Vitro), ELISA CD37 Homo sapiens (Human) Mammalian cell
From $558.00
From $558.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human Long-chain-fatty-acid--CoA ligase 1 (ACSL1)-Detergent
Target: ACSL1
 Functional Assay (In Vitro), ELISA ACSL1 Homo sapiens (Human) Mammalian cell
From $805.00
From $805.00
—
View
CSB-MP005390HU(A4) is detected by Mouse anti-6*His monoclonal antibody
Recombinant Human Neuronal acetylcholine receptor subunit alpha-4(CHRNA4)-VLPs
Target: CHRNA4
 Functional Assay (In Vitro), ELISA CHRNA4 Homo sapiens (Human) Mammalian cell
From $620.00
From $620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Cocal virus Glycoprotein (G)
Target: G
 Functional Assay (In Vitro), ELISA G Cocal virus (COCV) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human Very long chain fatty acid elongase 1 (ELOVL1)
Target: ELOVL1
 Functional Assay (In Vitro), ELISA ELOVL1 Homo sapiens (Human) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Mouse Phosphatidylcholine:ceramide cholinephosphotransferase 1 (Sgms1)
Target: Sgms1
 Functional Assay (In Vitro), ELISA Sgms1 Mus musculus (Mouse) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human Long-chain-fatty-acid--CoA ligase 1 (ACSL1)-Detergent
Target: ACSL1
 Functional Assay (In Vitro), ELISA ACSL1 Homo sapiens (Human) Mammalian cell
From $805.00
From $805.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Drosophila melanogaster Gustatory receptor for sugar taste 43a (Gr43a)
Target: Gr43a
 Functional Assay (In Vitro), ELISA Gr43a Drosophila melanogaster (Fruit fly) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human Solute carrier family 23 member 2 (SLC23A2)
Target: SLC23A2
 Functional Assay (In Vitro), ELISA SLC23A2 Homo sapiens (Human) in vitro E.coli expression system
From $1,040.00
From $1,040.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human Large neutral amino acids transporter small subunit 2 (SLC7A8)
Target: SLC7A8
 Functional Assay (In Vitro), ELISA SLC7A8 Homo sapiens (Human) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
CSB-MP004842HU is detected by Mouse anti-6*His monoclonal antibody.
Recombinant Human C-C chemokine receptor type 3 (CCR3)-VLPs
Target: CCR3
 Functional Assay (In Vitro), ELISA CCR3 Homo sapiens (Human) Mammalian cell
From $620.00
From $620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Pig Leukocyte surface antigen CD47 (CD47)
Target: CD47
 Functional Assay (In Vitro), ELISA CD47 Sus scrofa (Pig) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
No image
Recombinant Human E3 ubiquitin-protein ligase synoviolin (SYVN1)
Target: SYVN1
 Functional Assay (In Vitro), ELISA SYVN1 Homo sapiens (Human) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Streptococcus pyogenes serotype M6 Streptolysin O (slo)
Target: slo
 Functional Assay (In Vitro), ELISA slo Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human Trace amine-associated receptor 1 (TAAR1)
Target: TAAR1
 Functional Assay (In Vitro), ELISA TAAR1 Homo sapiens (Human) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human Sphingosine 1-phosphate receptor 5 (S1PR5)
Target: S1PR5
 Functional Assay (In Vitro), ELISA S1PR5 Homo sapiens (Human) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human Mitochondrial dicarboxylate carrier (SLC25A10)
Target: SLC25A10
 Functional Assay (In Vitro), ELISA SLC25A10 Homo sapiens (Human) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Xanthomonas albilineans histidine kinase (rpfC)
Target: rpfC
 Enzyme Activity rpfC Xanthomonas albilineans (strain GPE PC73 / CFBP 7063) in vitro E.coli expression system
From $2,160.00
From $2,160.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human Serine/threonine-protein phosphatase PGAM5,mitochondrial (PGAM5) (G166A,V167A,K169A)
Target: PGAM5
 Functional Assay (In Vitro), ELISA PGAM5 Homo sapiens (Human) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Mouse 2-acylglycerol O-acyltransferase 2 (Mogat2)
Target: Mogat2
 Functional Assay (In Vitro), ELISA Mogat2 Mus musculus (Mouse) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Escherichia coli Probable phosphatidylethanolamine transferase Mcr-1 (mcr1)
Target: mcr1
 Functional Assay (In Vitro), ELISA mcr1 Escherichia coli in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human BDNF/NT-3 growth factors receptor (NTRK2)
Target: NTRK2
 Functional Assay (In Vitro), ELISA NTRK2 Homo sapiens (Human) in vitro E.coli expression system
From $1,040.00
From $1,040.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Mouse G-protein coupled receptor 171 (Gpr171)
Target: Gpr171
 Functional Assay (In Vitro), ELISA Gpr171 Mus musculus (Mouse) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Recombinant Human 2-acylglycerol O-acyltransferase 2 (MOGAT2)
Target: MOGAT2
 Functional Assay (In Vitro), ELISA MOGAT2 Homo sapiens (Human) in vitro E.coli expression system
From $1,620.00
From $1,620.00
—
View

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information