AFF4 Antibody

SKU:BHA17110924
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Overview
Click light‑blue chips for details
Research-use anti-AFF4 primary antibody (Mouse, clone 8G12, isotype Mouse IgG2b) for WB, FACS and related target-detection assays in RUO workflows.
Target AFF4
Clone number 8G12
Host Mouse
Reactivity Human
Conjugate(s) Unconjugated
Application WB, FACS
Options selector
Catalog no. Formulation Size
RQ6288 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water; Size: 100 ug
  • Lead time: typically ships in ~2–3 business days; timing may vary by selected option.
  • Storage: After reconstitution, the AFF4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No RQ6288
Clonality
  • Monoclonal (mouse origin)
Host Mouse
Immunogen Amino acids RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ from the human protein were used as the immunogen for the AFF4 antibody.
Isotype
  • Mouse IgG2b
Product Type
  • Antibodies
  • Primary Antibodies
Purity Affinity purified
Reactivity
  • Human
Storage After reconstitution, the AFF4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Target AFF4
UniProt # Q9UHB7

Overview

AFF4 Antibody is a research-use primary antibody intended for detection of AFF4 in experimental workflows. It is supplied in Antigen affinity purified format. Key antibody attributes include Mouse, Monoclonal (mouse origin), clone 8G12, isotype Mouse IgG2b. Applications listed for this product include WB, FACS. Species reactivity (as provided): Human.

Key elements and design rationale

  • Target: AFF4 — selectivity and interpretation should be considered in the context of isoforms, post-translational modifications, and related family members when applicable.
  • Format: Antigen affinity purified — format can influence background, multiplexing compatibility, and downstream detection strategies.
  • Antibody identity: Mouse, Monoclonal (mouse origin), clone 8G12, isotype Mouse IgG2b — these attributes help align secondary reagents and controls (e.g., isotype-matched controls) with your assay design.
  • Product notes (from provided description): The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.

Where multiple assay formats are possible, align the antibody format, host/isotype, and listed applications with your detection system and controls to support clear interpretation of signal.

Biological background

In this catalog, AFF4 is positioned within Molecular & Cellular Biology, Leukemia research contexts. For authoritative gene/protein nomenclature, domains/isoforms, and curated functional annotations, consult resources such as UniProt, NCBI Gene, and Ensembl.

Research relevance and current trends

  • Higher-plex and spatially resolved readouts (e.g., multiplex IF/IHC, spatial omics) are increasing demand for well-characterized primary antibodies with clearly stated host/isotype and labeling strategies.
  • Genetic perturbation controls (knockout/knockdown) and orthogonal measurements (e.g., RNA vs protein) are commonly used to strengthen target attribution when interpreting antibody-derived signals.
  • Reproducibility initiatives emphasize transparent reporting of antibody identity (clone, host, isotype) and experimental context to improve cross-study comparability.

Common research applications

  • WB: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
  • FACS: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
  • Typical workflow themes: Western blot validation, Flow cytometry staining, ELISA binding assay, Specificity controls.
  • Workflow notes: Validate AFF4 by Western blot in cell/tissue lysates (include controls), Quantify AFF4-positive cells by flow cytometry in single-cell suspensions (include viability gate), Measure binding to AFF4 peptide/protein by E…

When comparing conditions, consistent sample processing and appropriate negative/positive controls support interpretation of qualitative localization differences and quantitative abundance changes.

Notes for experimental interpretation

  • Isoforms and post-translational modifications may shift apparent molecular weight or epitope accessibility, especially across cell states or treatments.
  • Species and tissue context can affect sequence conservation, expression level, and background binding; predicted reactivity should be verified in your sample.
  • Control concepts include isotype-matched controls, secondary-only controls (for indirect detection), and genetic/orthogonal controls (e.g., KO/KD, independent antibodies, or RNA measurements) when feasible.

Monoclonal and polyclonal antibodies can differ in epitope recognition breadth and lot-to-lot characteristics; consider clonality and clone information (when provided) alongside your assay requirements. Conjugated formats may simplify detection but can change background and multiplexing behavior compared with unconjugated primaries.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today