AHR Antibody / Aryl Hydrocarbon Receptor

Overview

AHR Antibody / Aryl Hydrocarbon Receptor is a research-use antibody directed against AHR. It is supplied for use in common immunoassay contexts such as WB, IHC-P, FACS (RUO).

Key elements and design rationale

• Target: AHR.
• Description (provided): AHR (Aryl Hydrocarbon Receptor), also called bHLHe76, is a member of the family of basic helix-loop-helix transcription factors.
• Antibody type: Rabbit, Polyclonal (rabbit origin), Rabbit IgG.
• Format: Antigen affinity purified; Antigen affinity purified.
• Reported/predicted localization: Cytoplasmic, nuclear.
• Species reactivity: tested: Human, Mouse, Rat.
• Immunogen (if provided): Amino acids AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH were used as the immunogen for the AHR antibody..

The information above helps you match the antibody format to your assay context, interpret species-dependent differences, and anticipate how epitope context (isoforms, PTMs, or conformational state) may influence signal.

Biological background

AHR (Aryl Hydrocarbon Receptor), also called bHLHe76, is a member of the family of basic helix-loop-helix transcription factors. AhR is a cytosolic transcription factor that is normally inactive, bound to several co-chaperones. The AHR gene is mapped on 7p21.1. Estrogenic actions of AHR agonists were detected in wildtype ovariectomized mouse uteri, but were absent in Ahr -/- or Er-alpha -/- ovariectomized mice. Complex assembly and ubiquitin ligase activity of CUL4B(AHR) in vitro and in vivo are dependent on the AHR ligand. In the CUL4B(AHR) complex, ligand-activated AHR acts as a substrate-specific adaptor component that targets sex steroid receptors for degradation. Cd4-positive cells from mice lacking Ahr developed Th17 responses but failed to produce Il22 and did not show enhanced Th17 development. Activation of Ahr during induction of EAE accelerated disease onset and increased pathology in wildtype mice, but not in Ahr -/- mice. The TDO-AHR pathway is active in human brain tumors and is associated with malignant progression and poor survival. Ahr activity within ROR-gamma-t-positive ILC could be induced by dietary ligands such as those contained in vegetables of the family Brassicaceae.

For curated annotations (gene/protein naming, domains, isoforms, and pathway links) for AHR, consult primary databases such as UniProt, NCBI Gene, and Ensembl.

Research relevance and current trends

• Context-dependent expression studies: researchers often examine AHR abundance and localization across perturbations (genetic, pharmacologic, or environmental) to connect phenotype to molecular changes.
• Reagent reproducibility: there is growing emphasis on antibody specificity checks using orthogonal approaches (e.g., genetic perturbation or independent antibodies) and transparent reporting of clone/lot information.
• Multi-modal datasets: antibody-based readouts are increasingly combined with transcriptomics and imaging to relate protein-level measurements to cell-state transitions.

Common research applications

• Western blotting (immunoblot) for relative detection of target protein abundance and apparent molecular weight.
• Immunohistochemistry for spatial mapping of target expression across tissues and cell types.
• FACS: commonly used to detect or compare AHR across experimental conditions (conceptual guidance only).

When comparing conditions, interpret changes in signal in the context of sample composition, expected localization, and any known isoform complexity for the target.

Notes for experimental interpretation

• Isoforms and PTMs: alternative splicing or post-translational modifications can change epitope accessibility and apparent molecular weight; interpret bands/signals accordingly.
• Cross-reactivity and matrix effects: background binding can vary by sample type, species, and blocking/detection chemistries; include appropriate negative controls.
• Control concepts: where feasible, use genetic perturbation (KO/KD/overexpression), orthogonal assays, or independent antibodies to support specificity claims.

Antibody considerations: Polyclonal reagents may recognize multiple epitopes and can increase sensitivity but may show broader binding profiles, while monoclonal clones provide a single-epitope readout that can improve consistency across experiments. If a conjugate is listed, the antibody supports more direct detection workflows; otherwise, it is typically used with a compatible secondary antibody.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.