ALKBH1 Antibody

SKU:BHA17110595
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Overview
Click light‑blue chips for details
Research-use anti-ALKBH1 primary antibody (Rabbit, isotype Rabbit IgG) for WB, IF and related target-detection assays in RUO workflows.
Target ALKBH1
Host Rabbit
Reactivity Human
Conjugate(s) Unconjugated
Application WB, IF
Options selector
Catalog no. Formulation Size
RQ5956 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water; Size: 100 ug
  • Lead time: typically ships in ~2–3 business days; timing may vary by selected option.
  • Storage: After reconstitution, the ALKBH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No RQ5956
Clonality
  • Polyclonal (rabbit origin)
Host Rabbit
Immunogen Amino acids YLKTARVNMTVRQVLATDQNFPLEPIEDEKRD from the human protein were used as the immunogen for the ALKBH1 antibody.
Isotype
  • Rabbit IgG
Product Type
  • Antibodies
  • Primary Antibodies
Purity Affinity purified
Reactivity
  • Human
Storage After reconstitution, the ALKBH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Target ALKBH1
UniProt # Q13686

Overview

ALKBH1 Antibody is a research-use primary antibody intended for detection of ALKBH1 in experimental workflows. It is supplied in Antigen affinity purified format. Key antibody attributes include Rabbit, Polyclonal (rabbit origin), isotype Rabbit IgG. Applications listed for this product include WB, IF. Reported/annotated localization context: Nuclear, cytoplasmic. Species reactivity (as provided): Human.

Key elements and design rationale

  • Target: ALKBH1 — selectivity and interpretation should be considered in the context of isoforms, post-translational modifications, and related family members when applicable.
  • Format: Antigen affinity purified — format can influence background, multiplexing compatibility, and downstream detection strategies.
  • Antibody identity: Rabbit, Polyclonal (rabbit origin), isotype Rabbit IgG — these attributes help align secondary reagents and controls (e.g., isotype-matched controls) with your assay design.
  • Localization: Nuclear, cytoplasmic — expected subcellular distribution can guide band/structure interpretation and help flag off-target signal.
  • Product notes (from provided description): Nucleic acid dioxygenase ALKBH1 is an enzyme that in humans is encoded by the ALKBH1 gene. It is mapped to 14q24.3. This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine.

Where multiple assay formats are possible, align the antibody format, host/isotype, and listed applications with your detection system and controls to support clear interpretation of signal.

Biological background

In this catalog, ALKBH1 is positioned within Molecular & Cellular Biology research contexts. Localization annotations (e.g., Nuclear, cytoplasmic) can help contextualize expected signal patterns in imaging and fractionation-based readouts. For authoritative gene/protein nomenclature, domains/isoforms, and curated functional annotations, consult resources such as UniProt, NCBI Gene, and Ensembl.

Research relevance and current trends

  • Higher-plex and spatially resolved readouts (e.g., multiplex IF/IHC, spatial omics) are increasing demand for well-characterized primary antibodies with clearly stated host/isotype and labeling strategies.
  • Genetic perturbation controls (knockout/knockdown) and orthogonal measurements (e.g., RNA vs protein) are commonly used to strengthen target attribution when interpreting antibody-derived signals.
  • Reproducibility initiatives emphasize transparent reporting of antibody identity (clone, host, isotype) and experimental context to improve cross-study comparability.

Common research applications

  • WB: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
  • IF: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
  • Typical workflow themes: Western blot validation, IF/ICC localization, ELISA binding assay, Specificity controls.
  • Workflow notes: Validate ALKBH1 by Western blot in cell/tissue lysates (include controls), Detect ALKBH1 localization by IF/ICC in cultured cells (optimize fixation + dilution), Measure binding to ALKBH1 peptide/protein by ELISA with…

When comparing conditions, consistent sample processing and appropriate negative/positive controls support interpretation of qualitative localization differences and quantitative abundance changes.

Notes for experimental interpretation

  • Isoforms and post-translational modifications may shift apparent molecular weight or epitope accessibility, especially across cell states or treatments.
  • Species and tissue context can affect sequence conservation, expression level, and background binding; predicted reactivity should be verified in your sample.
  • Control concepts include isotype-matched controls, secondary-only controls (for indirect detection), and genetic/orthogonal controls (e.g., KO/KD, independent antibodies, or RNA measurements) when feasible.

Monoclonal and polyclonal antibodies can differ in epitope recognition breadth and lot-to-lot characteristics; consider clonality and clone information (when provided) alongside your assay requirements. Conjugated formats may simplify detection but can change background and multiplexing behavior compared with unconjugated primaries.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today