Anti-AKR1B10 Antibody Picoband®

SKU:BHA21001140
Suppliers
Boster Bio
Boster Bio
Details Products
Overview
Click light‑blue chips for details
Anti-AKR1B10 antibody (Rabbit, polyclonal, Rabbit IgG). Recommended for IF, IHC, ICC, WB applications. Reactivity: Human. Commonly used in Oncology & Angiogenesis studies, including workflows such as Visualize the target localization by immunofluorescence in cultured cells, Profile the target expression by IHC in FFPE tissue sections.
Target AKR1B10
Host Rabbit
Reactivity Human
Isotype Rabbit IgG
Application(s) IF, IHC, ICC, WB
Options selector
Catalog no. Size Conjugation
A02976 100 ug/vial
Available Options

Select the variant that best fits your experiment.

  • Options:
    • 100 ug/vial / Carrier Free, Unconjugated
      Form: Lyophilized
      Storage: Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
      Applications: IF,IHC,ICC,WB
      Application details: Western blot, 0.1-0.5μg/ml, Human Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human

      Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human
      Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
    • 100 ug/vial / APC, Biotin, Cy3, FITC, Fluoro488, Fluoro550, Fluoro594, Fluoro647, PE
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.; At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
      Applications: WB,IHC,ELISA; Flow Cytometry
      Application details: Western blot, 0.25-0.5μg/ml
      Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Flow Cytometry, 1-3μg/1x106 cellsContents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
    • 100 ug/vial / HRP
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.
      Applications: WB,IHC,ELISA
      Application details: Western blot, 0.25-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Contents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4.
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: varies by selected option; see option details under Options.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No A02976
Alternative Names Aldo-keto reductase family 1 member B10;1.1.1.-;ARL-1;Aldose reductase-like;Aldose reductase-related protein;ARP;hARP;Small intestine reductase;SI reductase;AKR1B10;AKR1B11;
Cellular Localization Lysosome . Secreted . Secreted through a lysosome-mediated non-classical pathway.
Clonality
  • Polyclonal
Concentration Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Host Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10.
Isotype
  • Rabbit IgG
Molecular Weight 36 kDa
Product Type
  • Antibodies
  • Primary Antibodies
Reactivity
  • Human
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Target AKR1B10
UniProt # O60218

Overview

This antibody is intended for detection of AKR1B10 (Aldo-keto reductase family 1 member B10) in biological samples using common immunoassay formats. It is typically selected based on target identity, species reactivity, clonality/clone information, and detection modality.

Vendor notes: Boster Bio Anti-AKR1B10 Antibody Picoband® catalog # A02976. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Key elements and design rationale

  • Antibody format: Rabbit Polyclonal Rabbit IgG
  • Immunogen / epitope context: A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10.
  • Molecular weight context: reported MW: 36 kDa; calculated MW: 36020 MW
  • Reactivity: Human
  • Applications: IF, IHC, ICC, WB

As a polyclonal antibody, the reagent recognizes multiple epitopes on the target, which can improve detection robustness but may increase sensitivity to sample-dependent epitope changes.

Biological background

Aldo-keto reductase family 1 member B10; Aldo-keto reductase family 1 member B10. Aldo-keto reductase family 1 member B10 is an enzyme that in humans is encoded by the AKR1B10 gene. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. Functional note: Acts as all-trans-retinaldehyde reductase. Can efficiently reduce aliphatic and aromatic aldehydes, and is less active on hexoses (in vitro). May be responsible for detoxification of reactive aldehydes in the digested food before the nutrients are passed on to other organs. . Reported localization: Lysosome . Secreted . Secreted through a lysosome-mediated non-classical pathway. Expression/tissue context: Found in many tissues. Highly expressed in small intestine, colon and adrenal gland.

Research relevance and current trends

  • Cancer: Researchers commonly examine how AKR1B10 (Aldo-keto reductase family 1 member B10) relates to this theme using model systems and orthogonal readouts.
  • Drug Metabolism: Researchers commonly examine how AKR1B10 (Aldo-keto reductase family 1 member B10) relates to this theme using model systems and orthogonal readouts.
  • Energy Metabolism: Researchers commonly examine how AKR1B10 (Aldo-keto reductase family 1 member B10) relates to this theme using model systems and orthogonal readouts.

Common research applications

  • Western blotting: compare relative AKR1B10 (Aldo-keto reductase family 1 member B10) levels across conditions; band patterns may reflect isoforms and processing.
  • IHC/IHC-F: assess spatial distribution of AKR1B10 (Aldo-keto reductase family 1 member B10) across tissue regions and cell types using matched controls.
  • IF/ICC: evaluate subcellular localization and co-localization patterns; signal can depend on fixation/permeabilization and epitope accessibility.

Notes for experimental interpretation

  • Specificity notes: No cross reactivity with other proteins.
  • Cross-reactivity: No cross-reactivity with other proteins
  • Isoforms and PTMs: Apparent size and signal patterns can differ across splice isoforms, proteolytic processing, and post-translational modifications.
  • Controls: Include an isotype control (as relevant), no-primary control for imaging, and orthogonal validation such as KD/KO samples when available.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Is this A02976 anti-AKR1B10 antibody reactive to the isotypes of AKR1B10?
The immunogen of A02976 anti-AKR1B10 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today