Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband®

SKU:BHA21001397
Suppliers
Boster Bio
Boster Bio
Details Products
Overview
Click light‑blue chips for details
Anti-Ace antibody (Rabbit, polyclonal, Rabbit IgG). Recommended for Flow Cytometry, IHC, WB applications. Reactivity: Mouse,Rat. Commonly used in Oncology & Angiogenesis studies, including workflows such as Quantify the target-positive cells by flow cytometry in single-cell suspensions, Profile the target expression by IHC in FFPE tissue sections.
Target Ace
Host Rabbit
Reactivity Mouse,Rat
Isotype Rabbit IgG
Application(s) Flow Cytometry, IHC, WB
Options selector
Catalog no. Size Conjugation
A00251 100 ug/vial
Available Options

Select the variant that best fits your experiment.

  • Options:
    • 100 ug/vial / Carrier Free, Unconjugated
      Form: Lyophilized
      Storage: Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
      Applications: Flow Cytometry,IHC,WB
      Application details: Western blot, 0.1-0.5μg/ml, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Mouse, Rat

      Flow Cytometry(Fixed), 1-3 μg/1x106 cells, Mouse
      Contents: Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
    • 100 ug/vial / APC, Biotin, Cy3, FITC, Fluoro488, Fluoro550, Fluoro594, Fluoro647, PE
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.; At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
      Applications: WB,IHC,ELISA; Flow Cytometry
      Application details: Western blot, 0.25-0.5μg/ml
      Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Flow Cytometry, 1-3μg/1x106 cellsContents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
    • 100 ug/vial / HRP
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.
      Applications: WB,IHC,ELISA
      Application details: Western blot, 0.25-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Contents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4.
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: varies by selected option; see option details under Options.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No A00251
Alternative Names Angiotensin-converting enzyme; ACE; Dipeptidyl carboxypeptidase I; Kininase II; CD143; Angiotensin-converting enzyme, soluble form; Ace; Dcp1
Cellular Localization Angiotensin-converting enzyme, soluble form: Secreted.
Clonality
  • Polyclonal
Concentration Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Host Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of mouse Ace, which shares 70.3% and 91.9% amino acid (aa) sequence identity with human and rat Ace, respectively.
Isotype
  • Rabbit IgG
Molecular Weight 150-180 kDa
Product Type
  • Antibodies
  • Primary Antibodies
Reactivity
  • Mouse
  • Rat
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Target Ace
UniProt # P09470

Overview

This antibody is intended for detection of Ace in biological samples using common immunoassay formats. It is typically selected based on target identity, species reactivity, clonality/clone information, and detection modality.

Vendor notes: Boster Bio Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband® catalog # A00251. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Key elements and design rationale

  • Antibody format: Rabbit Polyclonal Rabbit IgG
  • Immunogen / epitope context: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Ace, which shares 70.3% and 91.9% amino acid (aa) sequence identity with human and rat Ace, respectively.
  • Molecular weight context: reported MW: 150-180 kDa; calculated MW: 54 kDa
  • Reactivity: Mouse,Rat
  • Applications: Flow Cytometry, IHC, WB

As a polyclonal antibody, the reagent recognizes multiple epitopes on the target, which can improve detection robustness but may increase sensitivity to sample-dependent epitope changes.

Biological background

angiotensin I converting enzyme (peptidyl-dipeptidase A) 1. Angiotensin I converting enzyme (ACE), also called DCP or CD143 is a zinc-containing dipeptidyl carboxypeptidase widely distributed in mammalian tissues and is thought to play a critical role in blood pressure regulation. This gene is mapped to 17q23.3. This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Functional note: Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety. This GPIase activity seems to be crucial for the egg-binding ability of the sperm. Reported localization: Angiotensin-converting enzyme, soluble form: Secreted. Expression/tissue context: Testis-specific isoform is expressed in spermatocytes, adult testis.

Research relevance and current trends

  • Cancer: Researchers commonly examine how Ace relates to this theme using model systems and orthogonal readouts.
  • Cancer Metabolism: Researchers commonly examine how Ace relates to this theme using model systems and orthogonal readouts.
  • Cardiovascular: Researchers commonly examine how Ace relates to this theme using model systems and orthogonal readouts.

Common research applications

  • Western blotting: compare relative Ace levels across conditions; band patterns may reflect isoforms and processing.
  • IHC/IHC-F: assess spatial distribution of Ace across tissue regions and cell types using matched controls.
  • Flow cytometry: quantify target-positive populations and shifts in expression; gating strategy and background staining controls are essential.

Notes for experimental interpretation

  • Specificity notes: No cross reactivity with other proteins.
  • Cross-reactivity: No cross-reactivity with other proteins.
  • Isoforms and PTMs: Apparent size and signal patterns can differ across splice isoforms, proteolytic processing, and post-translational modifications.
  • Controls: Include an isotype control (as relevant), no-primary control for imaging, and orthogonal validation such as KD/KO samples when available.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Is this A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody reactive to the isotypes of ACE?
The immunogen of A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody is A synthetic peptide corresponding to a sequence of mouse Ace (AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
I was wanting to use using your anti-Angiotensin Converting Enzyme 1/Ace antibody for positive regulation of protein tyrosine kinase activity studies. Has this antibody been tested with western blotting on testis tissue? We would like to see some validation images before ordering.
Thank you for your inquiry. This A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody is tested on mouse lung tissue, testis tissue, stomach tissue, rat lung tissue. It is guaranteed to work for WB in mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today