Anti-B3GNT8 Antibody Picoband®

SKU:BHA21000586
Suppliers
Boster Bio
Boster Bio
Details Products
Overview
Click light‑blue chips for details
Anti-B3GNT8 antibody (Rabbit, polyclonal, Rabbit IgG). Recommended for IHC, WB applications. Reactivity: Human. Commonly used in Oncology & Angiogenesis studies, including workflows such as Profile the target expression by IHC in FFPE tissue sections, Detect the target by Western blot in cell or tissue lysates.
Target B3GNT8
Host Rabbit
Reactivity Human
Isotype Rabbit IgG
Application(s) IHC, WB
Options selector
Catalog no. Size Conjugation
PB9686 100 ug/vial
Available Options

Select the variant that best fits your experiment.

  • Options:
    • 100 ug/vial / Carrier Free, Unconjugated
      Form: Lyophilized
      Storage: Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
      Applications: IHC,WB
      Application details: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human

      Western blot, 0.1-0.5μg/ml, Human
      Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
    • 100 ug/vial / APC, Biotin, Cy3, FITC, Fluoro488, Fluoro550, Fluoro594, Fluoro647, PE
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.; At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
      Applications: WB,IHC,ELISA; Flow Cytometry
      Application details: Western blot, 0.25-0.5μg/ml
      Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Flow Cytometry, 1-3μg/1x106 cellsContents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
    • 100 ug/vial / HRP
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.
      Applications: WB,IHC,ELISA
      Application details: Western blot, 0.25-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Contents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4.
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: varies by selected option; see option details under Options.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No PB9686
Alternative Names UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8;BGnT-8;Beta-1,3-Gn-T8;Beta-1,3-N-acetylglucosaminyltransferase 8;Beta3Gn-T8;2.4.1.-;B3GNT8 ;B3GALT7 , BGALT15 ;
Cellular Localization Golgi apparatus membrane ; Single-pass type II membrane protein .
Clonality
  • Polyclonal
Concentration Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Host Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8, different from the related mouse sequence by sixteen amino acids.
Isotype
  • Rabbit IgG
Molecular Weight 43 kDa
Product Type
  • Antibodies
  • Primary Antibodies
Reactivity
  • Human
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Target B3GNT8
UniProt # Q7Z7M8

Overview

This antibody is intended for detection of B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8) in biological samples using common immunoassay formats. It is typically selected based on target identity, species reactivity, clonality/clone information, and detection modality.

Vendor notes: Boster Bio Anti-B3GNT8 Antibody Picoband® catalog # PB9686. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Key elements and design rationale

  • Antibody format: Rabbit Polyclonal Rabbit IgG
  • Immunogen / epitope context: A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8, different from the related mouse sequence by sixteen amino acids.
  • Molecular weight context: reported MW: 43 kDa; calculated MW: 43396 MW
  • Reactivity: Human
  • Applications: IHC, WB

As a polyclonal antibody, the reagent recognizes multiple epitopes on the target, which can improve detection robustness but may increase sensitivity to sample-dependent epitope changes.

Biological background

UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8. B3GNT8 is a galactosyltransferase involved in the synthesis of poly-N-acetyllactosamine (polyLacNAc), a linear chain of repeating LacNAc units made up of galactose (Gal) and N-acetylglucosamine (GlcNAc) with the structure (Gal-beta-1-4-GlcNAc-beta-1-3)n. By genomic sequence analysis, the B3GNT8 gene is mapped to chromosome 19q13.2. It was showed that a soluble form of B3GNT8 overexpressed by transfected HEK293 cells selectively transferred GlcNAc from UDP-GlcNAc to the nonreducing terminus of Gal-beta-1-4-GlcNAc-alpha-p-nitrophenyl phosphate and to lactoside-alpha-benzoyl. It did not utilize keratan sulfates or polylactosamine oligosaccharide as substrate. B3GNT8 activity required Mn (2+) and showed less efficiency with Co (2+). The pH optimum was between 7 and 7.5. B3GNT8 also transferred GlcNAc onto alpha-1-acid glycoprotein and ovomucoid, which possess tetraantennary complex type and pentaantennary complex type N-glycans. With a tetraantennary N-glycan substrate, B3GNT8 appeared to prefer the beta-1-2 branch over the beta-1-6 branch. When overexpressed in HCT15 human colon cancer cells, B3GNT8 increased cell surface expression of both polyLacNAc and beta-1-6-branched N-glycans. Functional note: Beta-1,3-N-acetylglucosaminyltransferase that plays a role in the elongation of specific branch structures of multiantennary N-glycans. Has strong activity towards tetraantennary N-glycans and 2,6 triantennary glycans. . Reported localization: Golgi apparatus membrane ; Single-pass type II membrane protein . Expression/tissue context: Highly expressed in small intestine, pancreas, spleen, bone marrow, lung, throat, and ileum, and weakly in fetal brain, cerebellum, heart, liver, tongue, breast, uteri, and testis. Not detected in colon. Differentially expressed in human tumor cell lines. .

Research relevance and current trends

  • Cancer: Researchers commonly examine how B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8) relates to this theme using model systems and orthogonal readouts.
  • Growth Factors: Researchers commonly examine how B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8) relates to this theme using model systems and orthogonal readouts.
  • Growth Factors/Hormones: Researchers commonly examine how B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8) relates to this theme using model systems and orthogonal readouts.

Common research applications

  • Western blotting: compare relative B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8) levels across conditions; band patterns may reflect isoforms and processing.
  • IHC/IHC-F: assess spatial distribution of B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8) across tissue regions and cell types using matched controls.

Notes for experimental interpretation

  • Specificity notes: No cross reactivity with other proteins.
  • Cross-reactivity: No cross-reactivity with other proteins
  • Isoforms and PTMs: Apparent size and signal patterns can differ across splice isoforms, proteolytic processing, and post-translational modifications.
  • Controls: Include an isotype control (as relevant), no-primary control for imaging, and orthogonal validation such as KD/KO samples when available.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Is this PB9686 anti-B3GNT8 antibody reactive to the isotypes of B3GNT8?
The immunogen of PB9686 anti-B3GNT8 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8 (360-397aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC), different from the related mouse sequence by sixteen amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today