Anti-LMO2 Antibody Picoband®

SKU:BHA21001727
Suppliers
Boster Bio
Boster Bio
Details Products
Overview
Click light‑blue chips for details
Anti-LMO2 antibody (Rabbit, polyclonal, Rabbit IgG). Recommended for WB applications. Reactivity: Human,Mouse,Rat. Commonly used in Oncology & Angiogenesis studies, including workflows such as Detect the target by Western blot in cell or tissue lysates, Validate the target specificity with KD/KO or isotype controls (application-dependent).
Target LMO2
Host Rabbit
Reactivity Human,Mouse,Rat
Isotype Rabbit IgG
Application(s) WB
Options selector
Catalog no. Size Conjugation
A03502-1 100 ug/vial
Available Options

Select the variant that best fits your experiment.

  • Options:
    • 100 ug/vial / Carrier Free, Unconjugated
      Form: Lyophilized
      Storage: Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
      Applications: WB
      Application details: Western blot,0.1-0.5μg/ml
      Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na<sub>2</sub>HPO<sub>4</sub>, 0.05mg NaN<sub>3</sub>.
    • 100 ug/vial / APC, Biotin, Cy3, FITC, Fluoro488, Fluoro550, Fluoro594, Fluoro647, PE
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.; At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
      Applications: WB,IHC,ELISA; Flow Cytometry
      Application details: Western blot, 0.25-0.5μg/ml
      Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Flow Cytometry, 1-3μg/1x106 cellsContents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
    • 100 ug/vial / HRP
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.
      Applications: WB,IHC,ELISA
      Application details: Western blot, 0.25-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Contents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4.
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: varies by selected option; see option details under Options.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No A03502-1
Alternative Names Rhombotin-2; Cysteine-rich protein TTG-2; LIM domain only protein 2; LMO-2; T-cell translocation protein 2; LMO2; RBTN2; RBTNL1; RHOM2; TTG2
Cellular Localization Nucleus.
Clonality
  • Polyclonal
Concentration Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Host Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human LMO2, which shares 97% amino acid (aa) sequence identity with both mouse and rat LMO2.
Isotype
  • Rabbit IgG
Molecular Weight 23 kDa
Product Type
  • Antibodies
  • Primary Antibodies
Reactivity
  • Human
  • Mouse
  • Rat
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Target LMO2
UniProt # P25791

Overview

This antibody is intended for detection of LMO2 in biological samples using common immunoassay formats. It is typically selected based on target identity, species reactivity, clonality/clone information, and detection modality.

Vendor notes: Boster Bio Anti-LMO2 Antibody Picoband® catalog # A03502-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Key elements and design rationale

  • Antibody format: Rabbit Polyclonal Rabbit IgG
  • Immunogen / epitope context: A synthetic peptide corresponding to a sequence at the C-terminus of human LMO2, which shares 97% amino acid (aa) sequence identity with both mouse and rat LMO2.
  • Molecular weight context: reported MW: 23 kDa; calculated MW: nan
  • Reactivity: Human,Mouse,Rat
  • Applications: WB

As a polyclonal antibody, the reagent recognizes multiple epitopes on the target, which can improve detection robustness but may increase sensitivity to sample-dependent epitope changes.

Biological background

LIM domain only 2. LIM domain only 2 (rhombotin-like 1), also known as LMO2, RBTNL1, RBTN2, RHOM2, LIM Domain Only Protein 2, TTG2, and T-Cell Translocation Protein 2, is a protein which in humans is encoded by the LMO2 gene. LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms. Functional note: Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state. Reported localization: Nucleus.

Research relevance and current trends

  • Cardiovascular: Researchers commonly examine how LMO2 relates to this theme using model systems and orthogonal readouts.

Common research applications

  • Western blotting: compare relative LMO2 levels across conditions; band patterns may reflect isoforms and processing.

Notes for experimental interpretation

  • Specificity notes: No cross reactivity with other proteins.
  • Cross-reactivity: No cross-reactivity with other proteins.
  • Isoforms and PTMs: Apparent size and signal patterns can differ across splice isoforms, proteolytic processing, and post-translational modifications.
  • Controls: Include an isotype control (as relevant), no-primary control for imaging, and orthogonal validation such as KD/KO samples when available.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Is this A03502-1 anti-LMO2 antibody reactive to the isotypes of LMO2?
The immunogen of A03502-1 anti-LMO2 antibody is A synthetic peptide corresponding to a sequence of human LMO2 (QKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain colon using anti-LMO2 antibody A03502-1. Let me know if you need anything else.
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today