Anti-NFIA Antibody Picoband® (monoclonal, 16H11)

SKU:BHA21002116
Suppliers
Boster Bio
Boster Bio
Details Products
Overview
Click light‑blue chips for details
Anti-NFIA antibody (Mouse, monoclonal, clone Clone: 16H11, Mouse IgG2b). Recommended for Flow Cytometry, IF, IHC, ICC, WB applications. Reactivity: Human. Commonly used in Neuroscience studies, including workflows such as Quantify the target-positive cells by flow cytometry in single-cell suspensions, Visualize the target localization by immunofluorescence in cultured cells.
Target NFIA
Clone number Clone: 16H11
Host Mouse
Reactivity Human
Isotype Mouse IgG2b
Application(s) Flow Cytometry, IF, IHC, ICC, WB
Options selector
Catalog no. Size Conjugation
M03531 100 ug/vial
Available Options

Select the variant that best fits your experiment.

  • Options:
    • 100 ug/vial / Carrier Free, Unconjugated
      Form: Lyophilized
      Storage: Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
      Applications: Flow Cytometry,IF,IHC,ICC,WB
      Application details: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

      Immunocytochemistry/Immunofluorescence, 2μg/ml

      Flow Cytometry (Fixed), 1-3μg/1x106 cells
      Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
    • 100 ug/vial / APC, Biotin, Cy3, FITC, Fluoro488, Fluoro550, Fluoro594, Fluoro647, PE
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.; At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
      Applications: WB,IHC,ELISA; Flow Cytometry
      Application details: Western blot, 0.25-0.5μg/ml
      Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Flow Cytometry, 1-3μg/1x106 cellsContents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
    • 100 ug/vial / HRP
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.
      Applications: WB,IHC,ELISA
      Application details: Western blot, 0.25-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Contents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4.
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: varies by selected option; see option details under Options.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No M03531
Alternative Names Nuclear factor 1 A-type; NF1-A; Nuclear factor 1/A; CCAAT-box-binding transcription factor; CTF; Nuclear factor I/A; NF-I/A; NFI-A; TGGCA-binding protein; NFIA; KIAA1439
Cellular Localization Nucleus
Clonality
  • Monoclonal
Concentration Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Host Mouse
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human NFIA, different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Isotype
  • Mouse IgG2b
Molecular Weight 62 kDa
Product Type
  • Antibodies
  • Primary Antibodies
Reactivity
  • Human
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
Target NFIA
UniProt # Q12857

Overview

This antibody is intended for detection of NFIA in biological samples using common immunoassay formats. It is typically selected based on target identity, species reactivity, clonality/clone information, and detection modality.

Vendor notes: Boster Bio Anti-NFIA Antibody Picoband® (monoclonal, 16H11) catalog # M03531. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Key elements and design rationale

  • Antibody format: Mouse Monoclonal Mouse IgG2b
  • Clone number: Clone: 16H11
  • Immunogen / epitope context: A synthetic peptide corresponding to a sequence in the middle region of human NFIA, different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
  • Molecular weight context: reported MW: 62 kDa; calculated MW: nan
  • Reactivity: Human
  • Applications: Flow Cytometry, IF, IHC, ICC, WB

As a monoclonal antibody, the reagent targets a defined epitope, supporting consistency across experiments; epitope masking by PTMs or conformational changes can affect signal.

Biological background

nuclear factor I A. Nuclear factor 1 A-type?is a?protein?that in?humans?is encoded?by the?NFIA?gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins?with similar, and possibly identical, DNA-binding specificity. They function as cellular?transcription factors?and as replication factors for?adenovirus?DNA replication. Diversity in this protein family is generated by multiple?genes, differential?splicing, and heterodimerization. Functional note: Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. Reported localization: Nucleus Expression/tissue context: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Also found in a number of breast tumor cell lines.

Research relevance and current trends

  • Epigenetics and Nuclear Signaling: Researchers commonly examine how NFIA relates to this theme using model systems and orthogonal readouts.
  • Neurogenesis: Researchers commonly examine how NFIA relates to this theme using model systems and orthogonal readouts.
  • Neurology Process: Researchers commonly examine how NFIA relates to this theme using model systems and orthogonal readouts.

Common research applications

  • Western blotting: compare relative NFIA levels across conditions; band patterns may reflect isoforms and processing.
  • IHC/IHC-F: assess spatial distribution of NFIA across tissue regions and cell types using matched controls.
  • IF/ICC: evaluate subcellular localization and co-localization patterns; signal can depend on fixation/permeabilization and epitope accessibility.
  • Flow cytometry: quantify target-positive populations and shifts in expression; gating strategy and background staining controls are essential.

Notes for experimental interpretation

  • Specificity notes: No cross reactivity with other proteins.
  • Cross-reactivity: No cross-reactivity with other proteins.
  • Isoforms and PTMs: Apparent size and signal patterns can differ across splice isoforms, proteolytic processing, and post-translational modifications.
  • Controls: Include an isotype control (as relevant), no-primary control for imaging, and orthogonal validation such as KD/KO samples when available.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Is this M03531 anti-NFIA antibody (monoclonal, 16H11) reactive to the isotypes of NFIA?
The immunogen of M03531 anti-NFIA antibody (monoclonal, 16H11) is A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today