Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband®

SKU:BHA21001138
Suppliers
Boster Bio
Boster Bio
Details Products
Overview
Click light‑blue chips for details
Anti-OTC antibody (Rabbit, polyclonal, Rabbit IgG). Recommended for WB applications. Reactivity: Human,Mouse,Rat. Commonly used in Oncology & Angiogenesis studies, including workflows such as Detect the target by Western blot in cell or tissue lysates, Validate the target specificity with KD/KO or isotype controls (application-dependent).
Target OTC
Host Rabbit
Reactivity Human,Mouse,Rat
Isotype Rabbit IgG
Application(s) WB
Options selector
Catalog no. Size Conjugation
A00721-1 100 ug/vial
Available Options

Select the variant that best fits your experiment.

  • Options:
    • 100 ug/vial / Carrier Free, Unconjugated
      Form: Lyophilized
      Storage: Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
      Applications: WB
      Application details: Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human
      Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na<sub>2</sub>HPO<sub>4</sub>, 0.05mg NaN<sub>3</sub>.
    • 100 ug/vial / APC, Biotin, Cy3, FITC, Fluoro488, Fluoro550, Fluoro594, Fluoro647, PE
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.; At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
      Applications: WB,IHC,ELISA; Flow Cytometry
      Application details: Western blot, 0.25-0.5μg/ml
      Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Flow Cytometry, 1-3μg/1x106 cellsContents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
    • 100 ug/vial / HRP
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.
      Applications: WB,IHC,ELISA
      Application details: Western blot, 0.25-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Contents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4.
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: varies by selected option; see option details under Options.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No A00721-1
Alternative Names Ornithine carbamoyltransferase, mitochondrial;2.1.3.3;Ornithine transcarbamylase;OTCase;OTC;
Cellular Localization Mitochondrion matrix.
Clonality
  • Polyclonal
Concentration Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Host Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human OTC, different from the related mouse and rat sequences by three amino acids.
Isotype
  • Rabbit IgG
Molecular Weight 40 kDa
Product Type
  • Antibodies
  • Primary Antibodies
Reactivity
  • Human
  • Mouse
  • Rat
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Target OTC
UniProt # P00480

Overview

This antibody is intended for detection of OTC (Ornithine carbamoyltransferase, mitochondrial) in biological samples using common immunoassay formats. It is typically selected based on target identity, species reactivity, clonality/clone information, and detection modality.

Vendor notes: Boster Bio Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband® catalog # A00721-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Key elements and design rationale

  • Antibody format: Rabbit Polyclonal Rabbit IgG
  • Immunogen / epitope context: A synthetic peptide corresponding to a sequence at the N-terminus of human OTC, different from the related mouse and rat sequences by three amino acids.
  • Molecular weight context: reported MW: 40 kDa; calculated MW: 39935 MW
  • Reactivity: Human,Mouse,Rat
  • Applications: WB

As a polyclonal antibody, the reagent recognizes multiple epitopes on the target, which can improve detection robustness but may increase sensitivity to sample-dependent epitope changes.

Biological background

Ornithine carbamoyltransferase, mitochondrial; Ornithine carbamoyltransferase, mitochondrial. Ornithine transcarbamylase (OTC) (also called ornithine carbamoyltransferase) is an enzyme that catalyzes the reaction between carbamoyl phosphate (CP) and ornithine (Orn) to form citrulline (Cit) and phosphate (Pi). This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may also play a role in that disease. Functional note: May be a tumor suppressor. May be involved in energy and/or nutrient sensing through the AMPK and mTOR signaling pathways. May regulate phosphorylation of RPS6KB1. Reported localization: Mitochondrion matrix. Expression/tissue context: Mainly expressed in liver and intestinal mucosa.

Research relevance and current trends

  • Biochemicals: Researchers commonly examine how OTC (Ornithine carbamoyltransferase, mitochondrial) relates to this theme using model systems and orthogonal readouts.
  • Chemical Type: Researchers commonly examine how OTC (Ornithine carbamoyltransferase, mitochondrial) relates to this theme using model systems and orthogonal readouts.
  • Neuroscience: Researchers commonly examine how OTC (Ornithine carbamoyltransferase, mitochondrial) relates to this theme using model systems and orthogonal readouts.

Common research applications

  • Western blotting: compare relative OTC (Ornithine carbamoyltransferase, mitochondrial) levels across conditions; band patterns may reflect isoforms and processing.

Notes for experimental interpretation

  • Specificity notes: No cross reactivity with other proteins.
  • Cross-reactivity: No cross-reactivity with other proteins.
  • Isoforms and PTMs: Apparent size and signal patterns can differ across splice isoforms, proteolytic processing, and post-translational modifications.
  • Controls: Include an isotype control (as relevant), no-primary control for imaging, and orthogonal validation such as KD/KO samples when available.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Is this A00721-1 anti-Ornithine Carbamoyltransferase/OTC antibody reactive to the isotypes of OTC?
The immunogen of A00721-1 anti-Ornithine Carbamoyltransferase/OTC antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human OTC (33-70aa NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK), different from the related mouse and rat sequences by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today