Ataxin-1 Antibody

SKU:BHA11904552
Suppliers
StressMarq Biosciences Inc.
StressMarq Biosciences Inc.
Details Products
Overview
Click light‑blue chips for details
Mouse Anti-Mouse Ataxin-1 Monoclonal IgG2b
Target Ataxin-1
Clone number N76/8 (Formerly sold as S76-8)
Clonality Monoclonal
Application(s) WB, IHC, ICC/IF, IP
Host Mouse
Options selector
Catalog no. Size Conjugate(s)
SMC-455D 100 ug
SMC-455S 12 ug
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Size (2) — 100 ug, 12 ug; Conjugate(s) (10) — Unconjugated, ATTO 390, ATTO 488, ATTO 594, APC, BI, FITC, HRP, PCP, RPE
  • Lead time: options listed as “in stock at manufacturer” typically ship in 2–3 business days; other statuses may take longer.
  • Storage: -20ºC, Conjugated antibodies should be stored according to the product label
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No SMC-455
Accession Number NP_001186233.1
Alternative Names Ataxin 1, Ataxin-1, ATX1, Atxn1, D6S504E, OTTHUMP00000016065, SCA1, Spinocerebellar ataxia type 1 protein
Cellular Localization Cytoplasm | Nucleus
Clonality
  • Monoclonal
Concentration 1 mg/ml
Host Mouse
Immunogen Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Isotype
  • IgG2b
Product Type
  • Antibodies
  • Primary Antibodies
Reactivity
  • Human
  • Mouse
  • Rat
Shipping Blue Ice or 4ºC
Storage -20ºC, Conjugated antibodies should be stored according to the product label
Target Ataxin-1

Ataxin-1 (ATXN1) is a critical protein in neurodegenerative disease research, particularly for its role in spinocerebellar ataxia type 1 (SCA1), a progressive, autosomal dominant disorder. SCA1 primarily affects Purkinje cells in the cerebellum and brainstem, leading to motor dysfunction and neuronal degeneration. Ataxin-1 belongs to the ATXN1 protein family and contains a conserved AXH domain, which is implicated in RNA binding and transcriptional regulation.

Emerging evidence suggests that Ataxin-1 plays a pivotal role in RNA metabolism and nuclear function. It localizes to RNA- and transcription-dependent nuclear inclusions, indicating its involvement in gene expression regulation. While Ataxin-1 is broadly expressed across tissues, its expression in the brain is neuron-specific, underscoring its specialized function in the central nervous system.

Mutations in the ATXN1 gene, particularly polyglutamine (polyQ) expansions, drive the pathogenic mechanisms of SCA1 by altering protein conformation, disrupting normal protein interactions, and impairing neuronal homeostasis. As such, Ataxin-1 serves as a valuable model for understanding protein misfolding, RNA dysregulation, and selective neuronal vulnerability in neurodegenerative diseases.

Research into Ataxin-1 continues to illuminate fundamental processes in neuroscience and offers promising avenues for therapeutic intervention in SCA1 and related disorders.

1 µg/ml of SMC-455 was sufficient for detection of Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.

Cite this product varies by variant:

  • SMC-455D — Size: 100 ug: Ataxin-1 Antibody (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-455D, RRID: AB_2701937)
  • SMC-455D-A390 — Size: 100 ug: Ataxin-1 Antibody: ATTO 390 (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-455D-A390, RRID: AB_2701938)
  • SMC-455D-A488 — Size: 100 ug: Ataxin-1 Antibody: ATTO 488 (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-455D-A488, RRID: AB_2701939)
  • SMC-455D-A594 — Size: 100 ug: Ataxin-1 Antibody: ATTO 594 (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-455D-A594, RRID: AB_2701941)
  • SMC-455D-APC — Size: 100 ug: Ataxin-1 Antibody: APC (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-455D-APC, RRID: AB_2701947)
  • SMC-455D-BI — Size: 100 ug: Ataxin-1 Antibody: Biotin (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-455D-BI, RRID: AB_2701948)
  • SMC-455D-FITC — Size: 100 ug: Ataxin-1 Antibody: FITC (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-455D-FITC, RRID: AB_2701949)
  • SMC-455D-HRP — Size: 100 ug: Ataxin-1 Antibody: HRP (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-455D-HRP, RRID: AB_2701950)
  • SMC-455D-PCP — Size: 100 ug: Ataxin-1 Antibody: PerCP (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-455D-PCP, RRID: AB_2701952)
  • SMC-455D-RPE — Size: 100 ug: Ataxin-1 Antibody: RPE (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-455D-RPE, RRID: AB_2701953)
  • SMC-455S — Size: 12 ug: Ataxin-1 Antibody (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-455S, RRID: AB_2701937)

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today