Bax Antibody

SKU:BHA17106061
Overview
Click light‑blue chips for details
Anti-Bax antibody (Rabbit; polyclonal; Rabbit IgG; antigen affinity–purified) for WB, IHC, FACS, IF in Human, Mouse, Rat samples in research assays (RUO).
Target Bax
Host Rabbit
Reactivity Human, Mouse, Rat
Isotype Rabbit IgG
Application(s) WB, IHC-P, FACS, IF
Conjugate(s) Unconjugated
Options selector
Catalog no. Formulation Size
R32761 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
    Size: 100 ug
  • Lead time: usually 2-3 business days, ; please contact us for current fulfillment timing.
  • Storage: After reconstitution, the Bax antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No R32761
Clonality
  • Polyclonal (rabbit origin)
Conjugate
  • Unconjugated
Host Rabbit
Immunogen Amino acids 17-48 (EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) from the human protein were used as the immunogen for the Bax antibody.
Isotype
  • Rabbit IgG
Product Type
  • Antibodies
  • Primary Antibodies
Purity Antigen affinity
Reactivity
  • Human
  • Mouse
  • Rat
Storage After reconstitution, the Bax antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Target Bax
UniProt # Q07812

Overview

Bax Antibody is a research-use-only Rabbit polyclonal (rabbit origin) Rabbit IgG directed against Bax. It is supplied for interpretation-focused detection and comparative profiling in WB, IHC, FACS, IF. Reported localization context: Cytoplasmic.

Key elements and design rationale

  • Target context: This antibody is raised against Amino acids 17-48 (EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) from the human protein were used as the immunogen for the Bax antibody.. Epitope context matters because isoforms, processing, and post-translational modifications can change what is accessible in a given assay.
  • Format: Antigen affinity purified. Format influences background and compatibility with different detection chemistries; conjugated formats (when present) can simplify multiplexing and reduce reliance on secondary reagents.
  • Species reactivity: Human, Mouse, Rat. Cross-species performance can vary with sequence divergence and epitope conservation, so interpretation should be anchored with appropriate biological controls.
  • Localization: Cytoplasmic. Subcellular compartment context can help guide expectations in imaging assays and informs fractionation-based comparisons in lysate workflows.
  • Applications: WB, IHC, FACS, IF. These indicate assay contexts where the antibody is commonly applied; actual performance depends on sample type and processing.

Polyclonal reagents can differ in how they recognize epitope features. Monoclonal antibodies often provide more consistent epitope targeting across lots, while polyclonal preparations may broaden recognition across related epitope variants.

Biological background

Bax refers to the gene/protein target stated in the product record. Protein targets can exhibit context-dependent expression, regulated turnover, isoform diversity, and post-translational modifications that affect apparent molecular weight and epitope accessibility. For curated functional annotation, sequence features, and expression context, consult UniProtKB Q07812, Ensembl, and Human Protein Atlas.

Research relevance and current trends

  • Integrating antibody-based detection with single-cell and spatial atlasing efforts to connect RNA programs with protein-level abundance and localization in defined cell states.
  • Expanding multiplexed imaging and high-content screening, where reagent specificity, cross-reactivity risk, and channel design (including direct conjugates) become central to interpretation.
  • Growing emphasis on reproducibility and application-specific validation frameworks (e.g., genetic perturbation controls, orthogonal measurements, and independent antibody strategies) when drawing mechanistic conclusions.

Common research applications

  • Western blot (WB): commonly used to compare relative abundance/size (e.g., band intensity or mobility shifts) between conditions.
  • Immunohistochemistry (IHC): commonly used to compare tissue- and cell-type–specific expression patterns in situ.
  • FACS: commonly used for qualitative/quantitative detection where compatible with the assay context.
  • Immunofluorescence (IF): commonly used to compare subcellular localization patterns and redistribution across stimuli or phenotypes.

Interpretation typically focuses on relative differences (presence/absence, fold-changes, compartment shifts, or population-level shifts) rather than absolute quantitation. When signal changes are observed, they may reflect altered expression, altered localization/trafficking, changes in modification state, or differences in sample composition; orthogonal readouts and appropriate controls help distinguish these possibilities.

Application details (record-specific): Western Blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells,Immunofluorescence: 5ug/ml

Application notes (record-specific): Optimal dilution of the Bax antibody should be determined by the researcher.

Notes for experimental interpretation

  • Product description (record-specific): Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
  • Potential confounders: isoforms, proteolytic processing, and PTMs can change epitope presentation and apparent size; fixation/denaturation state can also expose or mask epitopes. Species differences near the epitope may affect cross-reactivity.
  • Control concepts: include genetic perturbation (KO/KD) or overexpression comparisons, orthogonal measurement (e.g., transcript or proteomics), and independent antibody/epitope strategies. For conjugated reagents, include staining-only/background controls appropriate to the detection chemistry.

Immunogen/epitope context is described as: Amino acids 17-48 (EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) from the human protein were used as the immunogen for the Bax antibody.. Monoclonal and polyclonal formats differ in epitope breadth; this can influence sensitivity to sequence variants, isoforms, or PTM-dependent recognition.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Matches this product
15%OFF
15% Off Cancer Antibodies
Ends Sep 30 ONCO15
$50 OFF
$50 Off All ELISA Kits
Limited time ELISA50
10% OFF
10% OFF CELL LINES-Limited-Time Offer
Ends Sep 30 CELL10
FREE SAMPLE
Free Sample – CellTrypase Recombinant Trypsin-Like Enzyme
Limited time offer – availa... FREESAMPLE
FREE SAMPLE
Free Sample – MycoFold™ Growth Factors
Limited time offer – availa... Request Free Sample

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today