CRB1 Antibody

SKU:BHA17128472
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Overview
Click light‑blue chips for details
Anti-CRB1 antibody from Rabbit unconjugated. Designed for target detection, including Western blotting, Immunohistochemistry, Flow cytometry; for Human, Mouse, Rat samples. Commonly used in workflows such as Western blotting, Immunohistochemistry, Flow cytometry.
Target CRB1
Conjugate(s) Unconjugated
Host Rabbit
Reactivity Human, Mouse, Rat
Application WB, IHC-P, FACS
Options selector
Catalog no. Formulation Size
RQ5239 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water; Size: 100 ug
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: Store the CRB1 antibody at -20˚C.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No RQ5239
Clonality
  • Polyclonal (rabbit origin)
Host Rabbit
Immunogen Amino acids FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ from the human protein were used as the immunogen for the CRB1 antibody.
Isotype
  • Rabbit IgG
Product Type
  • Antibodies
  • Primary Antibodies
Purity Affinity purified
Reactivity
  • Human
  • Mouse
  • Rat
Storage Store the CRB1 antibody at -20oC.
Target CRB1
UniProt # P82279

Overview

CRB1 Antibody is an antibody targeting CRB1, raised in Rabbit for protein detection and localization studies where these specifications are required.

Key elements and design rationale

  • Target: CRB1.
  • Antibody identity: Polyclonal (rabbit origin); Rabbit IgG.
  • Conjugate/label: Unconjugated (affects detection chemistry and multiplex compatibility).
  • Format: Antigen affinity purified.
  • Species reactivity: Human, Mouse, Rat.
  • Listed applications: WB, IHC-P, FACS (refer to on-page specifications for application-specific guidance).

Biological background

Crumbs homolog 1 is a protein that in humans is encoded by the CRB1 gene. This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding.

Research relevance and current trends

  • Comparative expression profiling across cell types, tissues, or perturbations (e.g., drug treatment, genetic editing, or differentiation).
  • Subcellular localization and trafficking studies, including co-localization with pathway markers in microscopy-based assays.
  • Integration of protein-level measurements with transcriptomics or proteomics to relate abundance to regulation and phenotype.

Common research applications

  • Western blotting: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
  • Immunohistochemistry: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
  • Flow cytometry: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.

Interpretation should account for antibody-dependent factors such as epitope accessibility, isoforms, and sample preparation differences across workflows.

Notes for experimental interpretation

  • Isoforms and PTMs: many targets have multiple isoforms and post-translational modifications that can shift apparent signal or localization; interpret bands/signals accordingly.
  • Epitope context: binding can depend on protein conformation and sample processing; region information in the title/immunogen can help anticipate what may be detected.
  • Species differences: predicted or validated reactivity may vary by ortholog sequence and sample context; confirm in your model system.
  • Control concepts: include negative controls (no-primary/isotype), and where possible genetic controls (KO/KD) or independent antibodies to strengthen conclusions.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today