| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK were used as the immunogen for the DNA Polymerase iota antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
DNA Polymerase iota Antibody / POLI is a research-use antibody directed against DNA POLYMERASE IOTA. It is supplied for use in common immunoassay contexts such as WB (RUO).
Key elements and design rationale
- Target: DNA POLYMERASE IOTA.
- Description (provided): DNA polymerase iota is an enzyme that in humans is encoded by the POLI gene.
- Antibody type: Rabbit, Polyclonal (rabbit origin), Rabbit IgG.
- Format: Antigen affinity purified; Antigen affinity purified.
- Reported/predicted localization: Nucleus.
- Species reactivity: tested: Human, Mouse, Rat.
- Immunogen (if provided): Amino acids DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK were used as the immunogen for the DNA Polymerase iota antibody..
The information above helps you match the antibody format to your assay context, interpret species-dependent differences, and anticipate how epitope context (isoforms, PTMs, or conformational state) may influence signal.
Biological background
DNA polymerase iota is an enzyme that in humans is encoded by the POLI gene. The protein encoded by this gene is an error-prone DNA polymerase involved in DNA repair. The encoded protein promotes DNA synthesis across lesions in the template DNA, which other polymerases cannot do. The encoded polymerase inserts deoxynucleotides across lesions and then relies on DNA polymerase zeta to extend the nascent DNA strand to bypass the lesion.
For curated annotations (gene/protein naming, domains, isoforms, and pathway links) for DNA POLYMERASE IOTA, consult primary databases such as UniProt, NCBI Gene, and Ensembl.
Research relevance and current trends
- Context-dependent expression studies: researchers often examine DNA POLYMERASE IOTA abundance and localization across perturbations (genetic, pharmacologic, or environmental) to connect phenotype to molecular changes.
- Reagent reproducibility: there is growing emphasis on antibody specificity checks using orthogonal approaches (e.g., genetic perturbation or independent antibodies) and transparent reporting of clone/lot information.
- Multi-modal datasets: antibody-based readouts are increasingly combined with transcriptomics and imaging to relate protein-level measurements to cell-state transitions.
Common research applications
- Western blotting (immunoblot) for relative detection of target protein abundance and apparent molecular weight.
When comparing conditions, interpret changes in signal in the context of sample composition, expected localization, and any known isoform complexity for the target.
Notes for experimental interpretation
- Isoforms and PTMs: alternative splicing or post-translational modifications can change epitope accessibility and apparent molecular weight; interpret bands/signals accordingly.
- Cross-reactivity and matrix effects: background binding can vary by sample type, species, and blocking/detection chemistries; include appropriate negative controls.
- Control concepts: where feasible, use genetic perturbation (KO/KD/overexpression), orthogonal assays, or independent antibodies to support specificity claims.
Antibody considerations: Polyclonal reagents may recognize multiple epitopes and can increase sensitivity but may show broader binding profiles, while monoclonal clones provide a single-epitope readout that can improve consistency across experiments. If a conjugate is listed, the antibody supports more direct detection workflows; otherwise, it is typically used with a compatible secondary antibody.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.