| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK was used as the immunogen for the HSPA2 antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
HSPA2 Antibody is a research-use antibody directed against HSPA2. It is supplied for use in common immunoassay contexts such as WB, IHC-P (RUO).
Key elements and design rationale
- Target: HSPA2.
- Description (provided): HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3.
- Antibody type: Mouse, clone 4A4, Mouse IgG1.
- Format: Purified; Protein G affinity.
- Reported/predicted localization: Cytoplasm.
- Species reactivity: tested: Human.
- Immunogen (if provided): Amino acids KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK was used as the immunogen for the HSPA2 antibody..
The information above helps you match the antibody format to your assay context, interpret species-dependent differences, and anticipate how epitope context (isoforms, PTMs, or conformational state) may influence signal.
Biological background
HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7% identity in the nucleotide coding sequence and 98.2% in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm. HSPA2 may be critical to sperm maturation through its role as a protein chaperone.
For curated annotations (gene/protein naming, domains, isoforms, and pathway links) for HSPA2, consult primary databases such as UniProt, NCBI Gene, and Ensembl.
Research relevance and current trends
- Context-dependent expression studies: researchers often examine HSPA2 abundance and localization across perturbations (genetic, pharmacologic, or environmental) to connect phenotype to molecular changes.
- Reagent reproducibility: there is growing emphasis on antibody specificity checks using orthogonal approaches (e.g., genetic perturbation or independent antibodies) and transparent reporting of clone/lot information.
- Multi-modal datasets: antibody-based readouts are increasingly combined with transcriptomics and imaging to relate protein-level measurements to cell-state transitions.
Common research applications
- Western blotting (immunoblot) for relative detection of target protein abundance and apparent molecular weight.
- Immunohistochemistry for spatial mapping of target expression across tissues and cell types.
When comparing conditions, interpret changes in signal in the context of sample composition, expected localization, and any known isoform complexity for the target.
Notes for experimental interpretation
- Isoforms and PTMs: alternative splicing or post-translational modifications can change epitope accessibility and apparent molecular weight; interpret bands/signals accordingly.
- Cross-reactivity and matrix effects: background binding can vary by sample type, species, and blocking/detection chemistries; include appropriate negative controls.
- Control concepts: where feasible, use genetic perturbation (KO/KD/overexpression), orthogonal assays, or independent antibodies to support specificity claims.
Antibody considerations: Polyclonal reagents may recognize multiple epitopes and can increase sensitivity but may show broader binding profiles, while monoclonal clones provide a single-epitope readout that can improve consistency across experiments. If a conjugate is listed, the antibody supports more direct detection workflows; otherwise, it is typically used with a compatible secondary antibody.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.
