| Field | Specification |
|---|---|
| Target | |
| UniProt # | |
| Host | |
| Clone | |
| Clonality | |
| Isotype | |
| Reactivity | |
| Applications | |
| Immunogen | C-terminal region amino acids KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ from the human protein were used as the immunogen for the HSPA9 antibody. |
| Purity | |
| Storage | |
| Storage buffer | |
| Catalog no. (Mfr.) | |
| Main SKU |
Overview
HSPA9 (heat shock 70kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.
This anti-GRP75 antibody is supplied as Purified (Mouse, Monoclonal (mouse origin), clone 4I9, Mouse IgG1, Unconjugated) and is designed to support common target-detection workflows after the on-page specifications.
Key elements and design rationale
- Target: GRP75
- Format: Purified
- Localization: Cytoplasmic
- Species reactivity: Human, Mouse, Rat
- Applications (listed): WB, IHC-P, IF, FACS
- Conjugate: Unconjugated
- Clone and antibody class: Monoclonal (mouse origin), clone 4I9, Mouse IgG1
Because antibody performance can depend on epitope context, sample preparation, and biological state, interpret signals using appropriate controls and orthogonal evidence when possible.
Biological background
GRP75 is referenced in public gene/protein resources (e.g., UniProt and NCBI Gene), which provide curated names/synonyms, protein features, and pathway context. When designing assays, consider potential isoforms, post-translational modifications, and cell-type specific expression that may influence observed signal.
Research relevance and current trends
- Profiling GRP75 expression across model systems, perturbations, and time points to support mechanistic hypotheses.
- Combining antibody-based detection with multi-omics or imaging readouts to link GRP75 signal with phenotype.
- Using well-matched controls (isotype controls, genetic perturbations, or independent reagents) to strengthen interpretation of target-associated signal.
Common research applications
- WB
- IHC-P
- IF
- FACS
Use the listed applications as a starting point and tailor experimental design to your sample type and readout requirements.
Notes for experimental interpretation
- Specificity considerations: closely related family members, isoforms, or PTMs can affect apparent specificity; confirm with independent approaches when critical.
- Controls: include negative controls and, when feasible, genetic or pharmacologic perturbations to support target attribution in your system.
- Species and sample context: differences in sequence, expression, fixation, or extraction conditions can change signal behavior across models.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.