Human Glucagon like peptide 2 (GLP2) ELISA Kit

SKU:BHE11407090
Overview
Click light‑blue chips for details
GLP2 (Human) ELISA kit for quantitative measurement, in serum, plasma, cell culture supernatant (Sandwich format). HRP-colorimetric detection with standard-curve quantification. Sensitivity: 52.1 pg/mL.
Assay Type Sandwich ELISA
Sample Type serum
Sensitivity 52.1 pg/mL
Detection Range 123.5-10000 pg/mL
Species Human
Assay Time 3.5–5 hours
Detection Method Colorimetric (TMB/HRP)
Options selector
Catalog no. Size
AE62821HU-48T 48 T
AE62821HU-96T 96 T
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Size (2) - 48 T, 96 T
  • Lead time: varies by selected option.
  • Storage: 4°C (short-term); -20°C (long-term)
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No AE62821HU
Product Type
  • Sandwich ELISA Kit
Sensitivity 52.1 pg/mL

Scientific Background

GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reductio.

Assay Principle

This assay employs a two-site sandwich ELISA to quantitate GLP2 in samples. An antibody specific for GLP2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyGLP2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for GLP2 is added to the wells. After washing, Streptavidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GLP2 bound in the initial step. The color development is stopped and the intensity of the color is measured.

Performance Specifications

Sensitivity 52.1 pg/mL
Detection Range 123.5-10000 pg/mL
Total Assay Time 3.5–5 hours
Compatible Sample Types serum, plasma, cell culture supernatant, tissue homogenate
Species Reactivity Human
Detection Method Colorimetric (TMB/HRP)
Storage 4°C (short-term); -20°C (long-term)

✓ Research-Grade Validation

Safety & Regulatory

Research Use Only (RUO). This product is intended for research purposes only and is not approved for diagnostic, therapeutic, or clinical use.

Handle reagents in accordance with institutional biosafety guidelines. Refer to the Safety Data Sheet (SDS) for complete hazard and handling information. Contains components that may require special disposal procedures per local regulations.

What sample types are compatible with this GLP2 ELISA kit?

This kit is validated for use with serum, plasma, cell culture supernatant, tissue homogenate. For unlisted matrices (e.g., tissue lysate, urine), perform a spike-and-recovery experiment to confirm assay performance before generating reportable data. Sample dilution in the kit's provided diluent is recommended to minimize matrix interference.

What is the detection limit for GLP2?

The minimum detectable concentration (sensitivity) of this kit is 52.1 pg/mL. Values below this threshold should be reported as below the limit of detection (<LOD) and should not be extrapolated from the standard curve.

How long does the complete assay take?

The total assay time from sample addition to absorbance reading is approximately 3.5–5 hours, including all incubation, wash, and substrate steps. Hands-on time is typically 1–2 hours; most steps involve passive plate incubation. Plan the assay as a single uninterrupted session for best results.

What reagents and materials are included in the kit?

Standard components of this Sandwich ELISA Kit typically include: pre-coated microplate (96-well strip format), lyophilized or liquid recombinant GLP2 standard, detection antibody, streptavidin-HRP conjugate, TMB substrate, stop solution, wash buffer concentrate, and sample/standard diluent. Refer to the kit insert or datasheet for the exact component list and storage requirements.

What instrument is required to read the assay?

This kit uses colorimetric (TMB/HRP) detection and requires a standard microplate absorbance reader capable of measuring at 450 nm. A reference wavelength of 570 nm or 630 nm is recommended to reduce background. No specialized fluorescence or luminescence reader is needed. Ensure the instrument is calibrated and the plate is clean and free of condensation before reading.

Can’t Find What You’re Looking For? We can help you source the best match or customize an ELISA solution for your study. Options may include alternative target synonyms, different species reactivity, sample type/matrix compatibility (serum/plasma/lysate/supernatant), assay format (sandwich/competitive), sensitivity/range, detection chemistry (colorimetric/fluorescent/chemiluminescent), plate format (pre-coated/uncoated, strips vs full plate), and bulk or custom packaging. Click Talk to a Scientist to submit a request form, email us at support@biohippo.com, or explore our Research Services for additional support. Our team will be in contact with you shortly.

Matches this product
$50 OFF
$50 Off All ELISA Kits
Limited time ELISA50
15%OFF
15% Off Cancer Antibodies
Ends Sep 30 ONCO15
10% OFF
10% OFF CELL LINES-Limited-Time Offer
Ends Sep 30 CELL10
FREE SAMPLE
Free Sample – CellTrypase Recombinant Trypsin-Like Enzyme
Limited time offer – availa... FREESAMPLE
FREE SAMPLE
Free Sample – MycoFold™ Growth Factors
Limited time offer – availa... Request Free Sample

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today