| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK from the human protein were used as the immunogen for the Isocitrate Dehydrogenase antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
Isocitrate Dehydrogenase Antibody / IDH1 is a research-use primary antibody intended for detection of IDH1 in experimental workflows. It is supplied in Purified format. Key antibody attributes include Mouse, Monoclonal (mouse origin), clone 16H7, isotype Mouse IgG1. Applications listed for this product include WB, IF, FACS. Species reactivity (as provided): Human, Mouse, Rat.
Key elements and design rationale
- Target: IDH1 (Isocitrate Dehydrogenase) — selectivity and interpretation should be considered in the context of isoforms, post-translational modifications, and related family members when applicable.
- Format: Purified — format can influence background, multiplexing compatibility, and downstream detection strategies.
- Antibody identity: Mouse, Monoclonal (mouse origin), clone 16H7, isotype Mouse IgG1 — these attributes help align secondary reagents and controls (e.g., isotype-matched controls) with your assay design.
- Product notes (from provided description): Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Where multiple assay formats are possible, align the antibody format, host/isotype, and listed applications with your detection system and controls to support clear interpretation of signal.
Biological background
In this catalog, IDH1 is positioned within Metabolism & Enzymology research contexts. For authoritative gene/protein nomenclature, domains/isoforms, and curated functional annotations, consult resources such as UniProt, NCBI Gene, and Ensembl.
Research relevance and current trends
- Higher-plex and spatially resolved readouts (e.g., multiplex IF/IHC, spatial omics) are increasing demand for well-characterized primary antibodies with clearly stated host/isotype and labeling strategies.
- Genetic perturbation controls (knockout/knockdown) and orthogonal measurements (e.g., RNA vs protein) are commonly used to strengthen target attribution when interpreting antibody-derived signals.
- Reproducibility initiatives emphasize transparent reporting of antibody identity (clone, host, isotype) and experimental context to improve cross-study comparability.
Common research applications
- WB: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- IF: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- FACS: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- Typical workflow themes: Western blot validation, IF/ICC localization, Flow cytometry staining, Specificity controls.
- Workflow notes: Validate IDH1 by Western blot in cell/tissue lysates (include controls), Detect IDH1 localization by IF/ICC in cultured cells (optimize fixation + dilution), Quantify IDH1-positive cells by flow cytometry in single-ce…
When comparing conditions, consistent sample processing and appropriate negative/positive controls support interpretation of qualitative localization differences and quantitative abundance changes.
Notes for experimental interpretation
- Isoforms and post-translational modifications may shift apparent molecular weight or epitope accessibility, especially across cell states or treatments.
- Species and tissue context can affect sequence conservation, expression level, and background binding; predicted reactivity should be verified in your sample.
- Control concepts include isotype-matched controls, secondary-only controls (for indirect detection), and genetic/orthogonal controls (e.g., KO/KD, independent antibodies, or RNA measurements) when feasible.
Monoclonal and polyclonal antibodies can differ in epitope recognition breadth and lot-to-lot characteristics; consider clonality and clone information (when provided) alongside your assay requirements. Conjugated formats may simplify detection but can change background and multiplexing behavior compared with unconjugated primaries.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.