| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD were used as the immunogen for the Ku70/XRCC6 antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
Ku70/XRCC6 Antibody is a research-use primary antibody intended for detection of XRCC6 in experimental workflows. It is supplied in Purified format. Key antibody attributes include Mouse, Monoclonal (mouse origin), clone 3D7, isotype Mouse IgG1. Applications listed for this product include WB, IHC-P, IF, FACS. Species reactivity (as provided): Human.
Key elements and design rationale
- Target: XRCC6 (Ku70) — selectivity and interpretation should be considered in the context of isoforms, post-translational modifications, and related family members when applicable.
- Format: Purified — format can influence background, multiplexing compatibility, and downstream detection strategies.
- Antibody identity: Mouse, Monoclonal (mouse origin), clone 3D7, isotype Mouse IgG1 — these attributes help align secondary reagents and controls (e.g., isotype-matched controls) with your assay design.
- Product notes (from provided description): XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.
Where multiple assay formats are possible, align the antibody format, host/isotype, and listed applications with your detection system and controls to support clear interpretation of signal.
Biological background
In this catalog, XRCC6 is positioned within Molecular & Cellular Biology research contexts. For authoritative gene/protein nomenclature, domains/isoforms, and curated functional annotations, consult resources such as UniProt, NCBI Gene, and Ensembl.
Research relevance and current trends
- Higher-plex and spatially resolved readouts (e.g., multiplex IF/IHC, spatial omics) are increasing demand for well-characterized primary antibodies with clearly stated host/isotype and labeling strategies.
- Genetic perturbation controls (knockout/knockdown) and orthogonal measurements (e.g., RNA vs protein) are commonly used to strengthen target attribution when interpreting antibody-derived signals.
- Reproducibility initiatives emphasize transparent reporting of antibody identity (clone, host, isotype) and experimental context to improve cross-study comparability.
Common research applications
- WB: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- IHC-P: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- IF: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- FACS: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- Typical workflow themes: Western blot validation, IHC on FFPE tissue, IF/ICC localization, Flow cytometry staining, Specificity controls.
- Workflow notes: Validate KU70XRCC6 by Western blot in cell/tissue lysates (include controls), Detect KU70XRCC6 by IHC in FFPE tissue sections (optimize antigen retrieval + dilution), Detect KU70XRCC6 localization by IF/ICC in culture…
When comparing conditions, consistent sample processing and appropriate negative/positive controls support interpretation of qualitative localization differences and quantitative abundance changes.
Notes for experimental interpretation
- Isoforms and post-translational modifications may shift apparent molecular weight or epitope accessibility, especially across cell states or treatments.
- Species and tissue context can affect sequence conservation, expression level, and background binding; predicted reactivity should be verified in your sample.
- Control concepts include isotype-matched controls, secondary-only controls (for indirect detection), and genetic/orthogonal controls (e.g., KO/KD, independent antibodies, or RNA measurements) when feasible.
Monoclonal and polyclonal antibodies can differ in epitope recognition breadth and lot-to-lot characteristics; consider clonality and clone information (when provided) alongside your assay requirements. Conjugated formats may simplify detection but can change background and multiplexing behavior compared with unconjugated primaries.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.
