| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids RLLTVERDPRTAAVAEKLIRLAGFDEHMVEL were used as the immunogen for the LRTOMT antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
LRTOMT Antibody is a research-use antibody directed against LRTOMT. It is supplied for use in common immunoassay contexts such as WB, IHC-P (RUO).
Key elements and design rationale
- Target: LRTOMT.
- Description (provided): Leucine rich transmembrane and O-methyltransferase domain containing is a protein that in humans is encoded by the LRTOMT gene.
- Antibody type: Rabbit, Polyclonal (rabbit origin), Rabbit IgG.
- Format: Antigen affinity purified; Affinity purified.
- Reported/predicted localization: Cytoplasmic.
- Species reactivity: tested: Human, Mouse, Rat.
- Immunogen (if provided): Amino acids RLLTVERDPRTAAVAEKLIRLAGFDEHMVEL were used as the immunogen for the LRTOMT antibody..
The information above helps you match the antibody format to your assay context, interpret species-dependent differences, and anticipate how epitope context (isoforms, PTMs, or conformational state) may influence signal.
Biological background
Leucine rich transmembrane and O-methyltransferase domain containing is a protein that in humans is encoded by the LRTOMT gene. It is mapped to 11q13.4. This gene has evolved in primates as a fusion of two ancestral neighboring genes, Lrrc51 and Tomt, which exist as two independent genes in rodents. The fusion gene contains some shared exons, but encodes structurally unrelated proteins, LRTOMT1 and LRTOMT2. Those variants that utilize the more centromere-proximal 3' terminal exon (short transcript form) encode LRTOMT1, while those variants that use a more centromere-distal 3' terminal exon (long transcript form) encode the LRTOMT2 protein. There is a small region within one of the exons of this gene that contains overlapping alternate reading frames for both LRTOMT1 and LRTOMT2. LRTOMT1 shares similarity with the protein encoded by mouse Lrrc51, while LRTOMT2 shares similarity with the protein encoded by mouse Tomt. Alternative splicing results in multiple transcript variants, encoding different isoforms of both LRTOMT1 and LRTOMT2. The LRTOMT1 protein is a leucine-rich repeat-containing protein, while the LRTOMT2 protein is a catechol-O-methyltransferase that catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to a hydroxyl group of catechols and is essential for auditory and vestibular function. Mutations in this gene have been associated with nonsyndromic deafness.
For curated annotations (gene/protein naming, domains, isoforms, and pathway links) for LRTOMT, consult primary databases such as UniProt, NCBI Gene, and Ensembl.
Research relevance and current trends
- Context-dependent expression studies: researchers often examine LRTOMT abundance and localization across perturbations (genetic, pharmacologic, or environmental) to connect phenotype to molecular changes.
- Reagent reproducibility: there is growing emphasis on antibody specificity checks using orthogonal approaches (e.g., genetic perturbation or independent antibodies) and transparent reporting of clone/lot information.
- Multi-modal datasets: antibody-based readouts are increasingly combined with transcriptomics and imaging to relate protein-level measurements to cell-state transitions.
Common research applications
- Western blotting (immunoblot) for relative detection of target protein abundance and apparent molecular weight.
- Immunohistochemistry for spatial mapping of target expression across tissues and cell types.
When comparing conditions, interpret changes in signal in the context of sample composition, expected localization, and any known isoform complexity for the target.
Notes for experimental interpretation
- Isoforms and PTMs: alternative splicing or post-translational modifications can change epitope accessibility and apparent molecular weight; interpret bands/signals accordingly.
- Cross-reactivity and matrix effects: background binding can vary by sample type, species, and blocking/detection chemistries; include appropriate negative controls.
- Control concepts: where feasible, use genetic perturbation (KO/KD/overexpression), orthogonal assays, or independent antibodies to support specificity claims.
Antibody considerations: Polyclonal reagents may recognize multiple epitopes and can increase sensitivity but may show broader binding profiles, while monoclonal clones provide a single-epitope readout that can improve consistency across experiments. If a conjugate is listed, the antibody supports more direct detection workflows; otherwise, it is typically used with a compatible secondary antibody.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.