| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids DLTLFDFKQGILCYPAPKAHPVAVASKKRK from the human protein were used as the immunogen for the MBD1 antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
MBD1 Antibody is a research-use primary antibody intended for detection of MBD1 in experimental workflows. It is supplied in Antigen affinity purified format. Key antibody attributes include Rabbit, Polyclonal (rabbit origin), isotype Rabbit IgG. Applications listed for this product include WB, FACS. Species reactivity (as provided): Human, Mouse, Rat.
Key elements and design rationale
- Target: MBD1 — selectivity and interpretation should be considered in the context of isoforms, post-translational modifications, and related family members when applicable.
- Format: Antigen affinity purified — format can influence background, multiplexing compatibility, and downstream detection strategies.
- Antibody identity: Rabbit, Polyclonal (rabbit origin), isotype Rabbit IgG — these attributes help align secondary reagents and controls (e.g., isotype-matched controls) with your assay design.
- Product notes (from provided description): MBD1 (Methyl-CpG-Binding Domain Protein 1), also known as PCM1 or CXXC3, is a protein that in humans is encoded by the MBD1 gene. Using PCR on a hybrid panel and FISH, Hendrich et al.(1999) mapped the MBD1 gene to chromosome 18q21, 2.1 cM distal to MBD2. Using yeast 2-hybrid analysis, reciprocal immunoprecipitation analysis, and protein pull-down assays, Fujita et al.(2003) showed that MBD1 interacted directly with MCAF. Deletion analysis revealed that the C-terminal transcriptional repressor domain(TRD) of MBD1 interacted with a conserved C-terminal domain of MCAF. Reporter gene assays showed that MCAF increased the repressive function of the isolated TRD of MBD1 against SP1. Chromatin immunoprecipitation analysis revealed that MBD1 linked MCAF to methylated promoters. Uchimura et al.(2006) found that MBD1 was multiply sumoylated in HeLa cells. Sumoylation did not alter the intracellular localization of MBD1 at nuclear foci in C-33A human cervical cancer cells.
Where multiple assay formats are possible, align the antibody format, host/isotype, and listed applications with your detection system and controls to support clear interpretation of signal.
Biological background
In this catalog, MBD1 is positioned within Gene Expression & Epigenetics, Cancer research contexts. For authoritative gene/protein nomenclature, domains/isoforms, and curated functional annotations, consult resources such as UniProt, NCBI Gene, and Ensembl.
Research relevance and current trends
- Higher-plex and spatially resolved readouts (e.g., multiplex IF/IHC, spatial omics) are increasing demand for well-characterized primary antibodies with clearly stated host/isotype and labeling strategies.
- Genetic perturbation controls (knockout/knockdown) and orthogonal measurements (e.g., RNA vs protein) are commonly used to strengthen target attribution when interpreting antibody-derived signals.
- Reproducibility initiatives emphasize transparent reporting of antibody identity (clone, host, isotype) and experimental context to improve cross-study comparability.
Common research applications
- WB: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- FACS: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- Typical workflow themes: Western blot validation, Flow cytometry staining, ELISA binding assay, Specificity controls.
- Workflow notes: Validate MBD1 by Western blot in cell/tissue lysates (include controls), Quantify MBD1-positive cells by flow cytometry in single-cell suspensions (include viability gate), Measure binding to MBD1 peptide/protein by E…
When comparing conditions, consistent sample processing and appropriate negative/positive controls support interpretation of qualitative localization differences and quantitative abundance changes.
Notes for experimental interpretation
- Isoforms and post-translational modifications may shift apparent molecular weight or epitope accessibility, especially across cell states or treatments.
- Species and tissue context can affect sequence conservation, expression level, and background binding; predicted reactivity should be verified in your sample.
- Control concepts include isotype-matched controls, secondary-only controls (for indirect detection), and genetic/orthogonal controls (e.g., KO/KD, independent antibodies, or RNA measurements) when feasible.
Monoclonal and polyclonal antibodies can differ in epitope recognition breadth and lot-to-lot characteristics; consider clonality and clone information (when provided) alongside your assay requirements. Conjugated formats may simplify detection but can change background and multiplexing behavior compared with unconjugated primaries.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.
