Nuclear factor 1 B-type Antibody / NFIB

SKU:BHA17119160
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Overview
Click light‑blue chips for details
Anti-NFIB antibody from Mouse, Monoclonal (mouse origin), clone 4D6E4, Mouse IgG2b. Listed for WB, IF, FACS; supplied as purified; reactive with Human, Mouse, Rat. Commonly used in Cell Signaling, Developmental Biology research, including workflows such as Validate NFIB by WB.
Target NFIB
Clone Number 4D6E4
Conjugate(s) Unconjugated
Host Mouse
Reactivity Human, Mouse, Rat
Options selector
Catalog no. Formulation Size
RQ6747 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
    Size: 100 ug
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: After reconstitution, the Nuclear factor 1 B-type antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No RQ6747
Clonality
  • Monoclonal (mouse origin)
Host Mouse
Immunogen Amino acids ELVRVS RTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR from the human protein were used as the immunogen for the Nuclear factor 1 B-type antibody.
Isotype
  • Mouse IgG2b
Product Type
  • Antibodies
  • Primary Antibodies
Purity Antigen affinity purified
Reactivity
  • Human
  • Mouse
  • Rat
Storage After reconstitution, the Nuclear factor 1 B-type antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Target NFIB
UniProt # O00712

Overview

Nuclear factor 1 B-type is a protein that in humans is encoded by the NFIB gene. The NFIB gene is a part of the NFI gene complex that includes three other genes (NFIA, NFIC and NFIX). The NFIB gene is a protein coding gene that also serves as a transcription factor. This gene is essential in embryonic development and it works together with its gene complex to initiate tissue differentiation in the fetus. Through knockout experiments, researchers found that mice without the NFIB gene have severely underdeveloped lungs. This mutation does not seem to cause spontaneous abortions because in utero the fetus does not use its lungs for respiration. However, this becomes lethal once the fetus is born and has to take its first breath. It is thought that NFIB plays a role in down regulating the transcription factors TGF-?1 and Shh in normal gestation because they remained high in knockout experiments. The absence of NFIB also leads to insufficient amounts of surfactant being produced which is one reason why the mice cannot breathe once it is born. The knockout experiments demonstrated that NFIB has a significant role in fore-brain development. NFIB is typically found in pontine nuclei of the CNS, the cerebral cortex and the white matter of the brain and without NFIB these areas are dramatically affected.

This anti-NFIB antibody is supplied as Purified (Mouse, Monoclonal (mouse origin), clone 4D6E4, Mouse IgG2b, Unconjugated) and is designed to support common target-detection workflows after the on-page specifications.

Key elements and design rationale

  • Target: NFIB
  • Format: Purified
  • Localization: Nuclear
  • Species reactivity: Human, Mouse, Rat
  • Applications (listed): WB, IF, FACS
  • Conjugate: Unconjugated
  • Clone and antibody class: Monoclonal (mouse origin), clone 4D6E4, Mouse IgG2b

Because antibody performance can depend on epitope context, sample preparation, and biological state, interpret signals using appropriate controls and orthogonal evidence when possible.

Biological background

NFIB is referenced in public gene/protein resources (e.g., UniProt and NCBI Gene), which provide curated names/synonyms, protein features, and pathway context. When designing assays, consider potential isoforms, post-translational modifications, and cell-type specific expression that may influence observed signal.

Research relevance and current trends

  • Profiling NFIB expression across model systems, perturbations, and time points to support mechanistic hypotheses.
  • Combining antibody-based detection with multi-omics or imaging readouts to link NFIB signal with phenotype.
  • Using well-matched controls (isotype controls, genetic perturbations, or independent reagents) to strengthen interpretation of target-associated signal.

Common research applications

  • WB
  • IF
  • FACS

Use the listed applications as a starting point and tailor experimental design to your sample type and readout requirements.

Notes for experimental interpretation

  • Specificity considerations: closely related family members, isoforms, or PTMs can affect apparent specificity; confirm with independent approaches when critical.
  • Controls: include negative controls and, when feasible, genetic or pharmacologic perturbations to support target attribution in your system.
  • Species and sample context: differences in sequence, expression, fixation, or extraction conditions can change signal behavior across models.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today