| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids 84-117 (NGLSQPVQDARFQIIQLPNRHDFHMNILDTRRND) from the mouse protein were used as the immunogen for the PD-1 antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
PD-1 Antibody / PDCD1 is an antibody targeting PDCD1, raised in Rabbit for protein detection and localization studies where these specifications are required.
Key elements and design rationale
- Target: PDCD1 (reported localization: Cell surface & cytoplasmic).
- Antibody identity: Polyclonal (rabbit origin); Rabbit IgG.
- Conjugate/label: Unconjugated (affects detection chemistry and multiplex compatibility).
- Format: Antigen affinity purified.
- Species reactivity: Mouse, Rat.
- Listed applications: WB, IHC-P, IF, FACS (refer to on-page specifications for application-specific guidance).
Biological background
PDCD1 (Programmed cell death 1), also called PD1, encodes a cell surface receptor that is a member of the B7 superfamily involved in immunomodulation. This gene is mapped to 2q37.3. PDCD1 acts as an inhibitory molecule on T cells after interacting with its ligands PDL1 and PDL2. The PDCD1 gene contains 5 exons. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. Using flow cytometric analysis, it has been found that expression of PDCD1 was upregulated on CD16-positive and CD16-negative monocytes, but not on dendritic cells, in viremic HIV-positive patients, but not in highly active antiretroviral therapy (HAART)-treated HIV-positive patients. PDCD1 upregulation in monocytes was induced by microbial Toll-like receptor ligands and inflammatory cytokines.
Research relevance and current trends
- Comparative expression profiling across cell types, tissues, or perturbations (e.g., drug treatment, genetic editing, or differentiation).
- Subcellular localization and trafficking studies, including co-localization with pathway markers in microscopy-based assays.
- Integration of protein-level measurements with transcriptomics or proteomics to relate abundance to regulation and phenotype.
Common research applications
- Western blotting: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
- Immunohistochemistry: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
- Immunofluorescence: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
- Flow cytometry: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
Interpretation should account for antibody-dependent factors such as epitope accessibility, isoforms, and sample preparation differences across workflows.
Notes for experimental interpretation
- Isoforms and PTMs: many targets have multiple isoforms and post-translational modifications that can shift apparent signal or localization; interpret bands/signals accordingly.
- Epitope context: binding can depend on protein conformation and sample processing; region information in the title/immunogen can help anticipate what may be detected.
- Species differences: predicted or validated reactivity may vary by ortholog sequence and sample context; confirm in your model system.
- Control concepts: include negative controls (no-primary/isotype), and where possible genetic controls (KO/KD) or independent antibodies to strengthen conclusions.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.