| Field | Specification |
|---|---|
| Mfr No | |
| Alternative Names | 4-1BBL |
| Conjugate | |
| Formulation | |
| Host | |
| Product Type | |
| Shipping | |
| Storage |
Scientific Background
Human CD137L (4-1BB Ligand) is a type II transmembrane protein constitutively expressed by monocytes, B cells and neuroblastoma cells (1). Binding of CD137 (4-1BB) to CD137L induces monocyte activation (2).
Product Description
CHO CellsRecombinant hCD137L-muCD8 is a recombinant human fusion protein produced in CHO Cells cells. Molecular Structure: A soluble molecule consisting of the extracellular domain of murine CD8 alpha(167aa): kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvnstttkpvlrtpspvhptgtsqpqrpedcrprgsvkgtgldfacd
Alternative names: 4-1BBL
Protein Specifications
| Fusion Format | Murine CD8α Fusion (muCD8) |
|---|---|
| Expression System | CHO Cells |
| Molecular Weight | 38.2 kDa |
| Formulation | 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate |
| Storage | Store at 2 - 5°C. Freeze/Thawing is not recommended. |
| Species Reactivity | Human |
| Validated Applications | ELISA, Flow Cytometry |
| Available Conjugates | Biotin, Unconjugated |
✔ Research Use Only (RUO)
Functional Activity
Human CD137L-muCD8 binds to CD137 in FACS (3) and EIA(4). It blocks binding of anti-CD137 monoclonal antibody (clone 4B4-1) to CD137 expressing cells in FACS. Immobilzed CD137L can induce cytokine expression (IL-4, IL-10, IL-13) by CD137 expressing T cells (5).
Safety & Handling
Research Use Only. Not intended for diagnostic, therapeutic, or clinical use. Handle according to good laboratory practice (GLP). Consult the Safety Data Sheet (SDS) prior to use.
Related Products
Browse our full collection of recombinant proteins and antibodies for immunology and immune checkpoint research.
This protein was expressed in CHO Cells cells. Mammalian expression is critical for this Fc fusion protein because it ensures proper glycosylation and tertiary folding of the extracellular immunoglobulin-like domains, preserving native receptor-binding activity.
Recombinant hCD137L-muCD8 has been validated for: ELISA, Flow Cytometry. It is produced as a Murine CD8α Fusion (muCD8), making it suitable as a blocking reagent, binding standard, or functional stimulant/inhibitor in immunology assays.
Recommended storage: Store at 2 - 5°C. Freeze/Thawing is not recommended.. Formulation: 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate. Avoid repeated freeze-thaw cycles. If long-term storage is needed, aliquot upon first use.
Species reactivity includes: human. Cross-reactivity was confirmed by functional binding assays (e.g., ELISA and/or FACS) against cells or recombinant proteins from the indicated species.
Available formats include: Biotin, Unconjugated. Conjugated forms are ready-to-use without secondary detection reagents for flow cytometry. Unconjugated (purified) forms can be used with anti-Fc secondary antibodies in ELISA.
Can't Find What You're Looking For? We can help you source the best match or customize a recombinant protein solution for your study. Options may include species (human/mouse/rat), protein region/domain (full-length vs fragment), tag or label (His/GST/FLAG/biotin/fluorescent), expression system (E. coli/HEK293/insect), purity grade, formulation (buffer, carrier-free, glycerol-free), activity/functional validation (binding or enzymatic assays), endotoxin level (low-endotoxin for cell-based work), mutants/variants (point mutations, isoforms), and bulk or custom packaging. Click Talk to a Scientist to submit a request form, email us at support@biohippo.com, or explore our Research Services for additional support. Our team will be in contact with you shortly.
- M.R. Alderson, et al, (1994) Eur J Immunol 24: 2219-2227.
- J. Langstein, et al, (1998) J Immunol 160: 2488-2494.
- W.Lin, S.E. Strome, et al. (2008) Blood 112: 699-707. PMID: 18519814
- M Cho, J Myoung (Dec 2015) J General Virology 96(12): 3635-3645. PMID: 26467721
- Alfaro C, Melero I, et al. (2015) OncoImmunology 4(12): e1054597. doi: 10.1080/2162402X.2015.1054597.
