| Field | Specification |
|---|---|
| Mfr No | |
| Conjugate | |
| Formulation | |
| Host | |
| Product Type | |
| Shipping | |
| Storage |
Scientific Background
Human CD155 (Polio Virus Receptor, PVR, Necl-5) is a 70 kd type I Ig superfamily molecule (1).1 It is involved in formation of intracellular junctions between epithelial cells. Its ligands include CD226(DNAM-1), and CD96(TACTILE). CD155 expression by tumor has been shown to be upregulated by Nitric Oxide(2). High CD155 expression has recently been exploited to use engineered poliovirus to treat glioblastoma. (3)
Product Description
CHO CellsRecombinant hCD155(PVR)-muIg is a recombinant human fusion protein produced in CHO Cells cells. Molecular Structure: A soluble molecule consisting of the extracellular domain of mature human CD155 fused to murine IgG2a Fc.Mature CD155(EC) (316aa): dvvvqaptqvpgflgdsvtlpcylqvpnmevthvsqltwarhgesgsmavfhqtqgpsyseskrlefvaarlgaelrnaslrmfglrvedegnytclfvtfpqgsrsvdiwlrvlakpqntaevqkvqltgepvpmarcvstggrppaqitwhsdlggmpntsqvpgflsgtvtvtslwilvpssqvdgknvtckvehesfekpqlltvnltvyyppevsisgydnnwylgqneatltcdarsnpeptgynwsttmgplppfavaqgaqllirpvdkpinttlicnvtnalgarqaeltvqvkegppsehsgteha
Protein Specifications
| Fusion Format | Murine IgG Fc Fusion (muIg) |
|---|---|
| Expression System | CHO Cells |
| Molecular Weight | 70 kDa |
| Formulation | 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate |
| Storage | Store at 2 - 5°C. Freeze/Thawing is not recommended. |
| Species Reactivity | Human |
| Validated Applications | ELISA, Flow Cytometry |
| Available Conjugates | Biotin, Unconjugated |
✔ Research Use Only (RUO)
Safety & Handling
Research Use Only. Not intended for diagnostic, therapeutic, or clinical use. Handle according to good laboratory practice (GLP). Consult the Safety Data Sheet (SDS) prior to use.
Related Products
Browse our full collection of recombinant proteins and antibodies for immunology and immune checkpoint research.
This protein was expressed in CHO Cells cells. Mammalian expression is critical for this Fc fusion protein because it ensures proper glycosylation and tertiary folding of the extracellular immunoglobulin-like domains, preserving native receptor-binding activity.
Recombinant hCD155(PVR)-muIg has been validated for: ELISA, Flow Cytometry. It is produced as a Murine IgG Fc Fusion (muIg), making it suitable as a blocking reagent, binding standard, or functional stimulant/inhibitor in immunology assays.
Recommended storage: Store at 2 - 5°C. Freeze/Thawing is not recommended.. Formulation: 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate. Avoid repeated freeze-thaw cycles. If long-term storage is needed, aliquot upon first use.
Species reactivity includes: human. Cross-reactivity was confirmed by functional binding assays (e.g., ELISA and/or FACS) against cells or recombinant proteins from the indicated species.
Available formats include: Biotin, Unconjugated. Conjugated forms are ready-to-use without secondary detection reagents for flow cytometry. Unconjugated (purified) forms can be used with anti-Fc secondary antibodies in ELISA.
Can't Find What You're Looking For? We can help you source the best match or customize a recombinant protein solution for your study. Options may include species (human/mouse/rat), protein region/domain (full-length vs fragment), tag or label (His/GST/FLAG/biotin/fluorescent), expression system (E. coli/HEK293/insect), purity grade, formulation (buffer, carrier-free, glycerol-free), activity/functional validation (binding or enzymatic assays), endotoxin level (low-endotoxin for cell-based work), mutants/variants (point mutations, isoforms), and bulk or custom packaging. Click Talk to a Scientist to submit a request form, email us at support@biohippo.com, or explore our Research Services for additional support. Our team will be in contact with you shortly.
- Medelsohn CL, Racaniello VR, et al. (1989) Cell 56(5): 855-65.
- C Fionda, M Cippitelli, et al. (2015) BMC Cancer 15(1):17 PMID: 25609078.
- Gromeier M, Bigner D, et al. (2014) Neuro-Oncology 16(supp3): iii41.
