| Field | Specification |
|---|---|
| Mfr No | |
| Conjugate | |
| Formulation | |
| Host | |
| Product Type | |
| Shipping | |
| Storage |
Scientific Background
The inducible costimulator CD278 (ICOS, T cell activation molecule H4) is similar to human CD28 (24% homology), and plays an analogous role in the T cell activation process, each secondary signal resulting in a discrete cytokine secretion profile displayed by the activated T cell.1 Both processes are effectively down regulated by CD152 (CTLA-4) engagement.2 Human CD275(ICOSL, GL50, B7RP-1, B7-H2) is a member of the B7 family sharing ~20% homology with CD80 (B7-1) and CD86 (B7-2), and has been shown to be the ligand for CD278(ICOS).3 It has recently been shown that at least two RNA splice variants exist for this molecule in mouse and human, possibly serving to regulate this costimulatory process. 4
Product Description
CHO CellsRecombinant hCD275-muIg is a recombinant human fusion protein produced in CHO Cells cells. Molecular Structure: A soluble dimeric fusion protein consisting of a portion of the extracellular domain of human CD275 (GL50, ICOSL, B7-H2, B7RP-1) (213aa): dtqekevramvgsdvelscacpegsrfdlndvyvywqtsesktvvtyhipqnsslenvdsryrnralmspagmlrgdfslrlfnvtpqdeqkfhclvlsqslgfqevlsvevtlhvaanfsvpvvsaphspsqdeltftctsingyprpnvywinktdnslldqalqndtvflnmrglydvvsvlriartpsvnigccienvllqqnltvgsq with linking amino acids: gt
Protein Specifications
| Fusion Format | Murine IgG Fc Fusion (muIg) |
|---|---|
| Expression System | CHO Cells |
| Molecular Weight | 50.4 kDa |
| Formulation | 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate |
| Storage | Store at 2 - 5°C. Freeze/Thawing is not recommended. |
| Species Reactivity | Human |
| Validated Applications | ELISA, Flow Cytometry |
| Available Conjugates | Biotin, Unconjugated |
✔ Research Use Only (RUO)
Functional Activity
CD275-muIg binds with high affinity to cell surface CD278 (ICOS) expressed on CD8 positive human T cells. It’s binding is blocked by pre incubation with recombinant 278-muIg (cat.no. 517-020)
Safety & Handling
Research Use Only. Not intended for diagnostic, therapeutic, or clinical use. Handle according to good laboratory practice (GLP). Consult the Safety Data Sheet (SDS) prior to use.
Related Products
Browse our full collection of recombinant proteins and antibodies for immunology and immune checkpoint research.
This protein was expressed in CHO Cells cells. Mammalian expression is critical for this Fc fusion protein because it ensures proper glycosylation and tertiary folding of the extracellular immunoglobulin-like domains, preserving native receptor-binding activity.
Recombinant hCD275-muIg has been validated for: ELISA, Flow Cytometry. It is produced as a Murine IgG Fc Fusion (muIg), making it suitable as a blocking reagent, binding standard, or functional stimulant/inhibitor in immunology assays.
Recommended storage: Store at 2 - 5°C. Freeze/Thawing is not recommended.. Formulation: 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate. Avoid repeated freeze-thaw cycles. If long-term storage is needed, aliquot upon first use.
Species reactivity includes: human. Cross-reactivity was confirmed by functional binding assays (e.g., ELISA and/or FACS) against cells or recombinant proteins from the indicated species.
Available formats include: Biotin, Unconjugated. Conjugated forms are ready-to-use without secondary detection reagents for flow cytometry. Unconjugated (purified) forms can be used with anti-Fc secondary antibodies in ELISA.
Can't Find What You're Looking For? We can help you source the best match or customize a recombinant protein solution for your study. Options may include species (human/mouse/rat), protein region/domain (full-length vs fragment), tag or label (His/GST/FLAG/biotin/fluorescent), expression system (E. coli/HEK293/insect), purity grade, formulation (buffer, carrier-free, glycerol-free), activity/functional validation (binding or enzymatic assays), endotoxin level (low-endotoxin for cell-based work), mutants/variants (point mutations, isoforms), and bulk or custom packaging. Click Talk to a Scientist to submit a request form, email us at support@biohippo.com, or explore our Research Services for additional support. Our team will be in contact with you shortly.
- Beier, K.C., R.A. Kroczek, et al. 2000, Eur J Immunol . 30(12):3707-3717.
- Riley, J.L., C.H. June, et al. 2001, J. Immunol. 166: 4943-4948.
- Ling, V., M. Collins, et al. 2000, J. Immunol. 164: 1653-1657.
- Ling, V., M. Collins, et al. 2001, J. Immunol. 166: 7300-7308.
