Recombinant hCD275-muIg

SKU:BHP14700035
Research Validated
Overview
Click light‑blue chips for details
Recombinant human Murine IgG Fc Fusion (muIg) expressed in CHO Cells cells. Validated for ELISA and Flow Cytometry. Human origin. Available unconjugated and conjugated (Biotin, FITC, PE).
Expression System CHO Cells
Fusion Format Murine IgG Fc Fusion
Molecular Weight 50.4 kDa
Species Reactivity Human
Storage 2–5°C
Validated Applications ELISA, Flow Cytometry
Options selector
Catalog no. Form Size
575-020 Purified (with Antibiotic)
575-820 Purified (Preservative-free)
575-030 Biotin conjugate
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Form (3) – Purified (with Antibiotic), Purified (Preservative-free), Biotin conjugate | Size: 25 µg
  • Lead time: options listed in "Availability Content"; other statuses may take longer.
  • Storage: Store at 2 - 5°C. Freeze/Thawing is not recommended.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: refrigerate upon receipt.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No 575
Conjugate
  • Biotin
  • Unconjugated
Formulation 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate
Host CHO cells
Product Type
  • Recombinant Protein
Shipping Shipped on blue ice
Storage Store at 2 - 5°C. Freeze/Thawing is not recommended.

Scientific Background

The inducible costimulator CD278 (ICOS, T cell activation molecule H4) is similar to human CD28 (24% homology), and plays an analogous role in the T cell activation process, each secondary signal resulting in a discrete cytokine secretion profile displayed by the activated T cell.1 Both processes are effectively down regulated by CD152 (CTLA-4) engagement.2 Human CD275(ICOSL, GL50, B7RP-1, B7-H2) is a member of the B7 family sharing ~20% homology with CD80 (B7-1) and CD86 (B7-2), and has been shown to be the ligand for CD278(ICOS).3 It has recently been shown that at least two RNA splice variants exist for this molecule in mouse and human, possibly serving to regulate this costimulatory process. 4

Product Description

CHO Cells

Recombinant hCD275-muIg is a recombinant human fusion protein produced in CHO Cells cells. Molecular Structure: A soluble dimeric fusion protein consisting of a portion of the extracellular domain of human CD275 (GL50, ICOSL, B7-H2, B7RP-1) (213aa): dtqekevramvgsdvelscacpegsrfdlndvyvywqtsesktvvtyhipqnsslenvdsryrnralmspagmlrgdfslrlfnvtpqdeqkfhclvlsqslgfqevlsvevtlhvaanfsvpvvsaphspsqdeltftctsingyprpnvywinktdnslldqalqndtvflnmrglydvvsvlriartpsvnigccienvllqqnltvgsq with linking amino acids: gt

Protein Specifications

Fusion Format Murine IgG Fc Fusion (muIg)
Expression System CHO Cells
Molecular Weight 50.4 kDa
Formulation 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate
Storage Store at 2 - 5°C. Freeze/Thawing is not recommended.
Species Reactivity Human
Validated Applications ELISA, Flow Cytometry
Available Conjugates Biotin, Unconjugated

✔ Research Use Only (RUO)

Functional Activity

CD275-muIg binds with high affinity to cell surface CD278 (ICOS) expressed on CD8 positive human T cells. It’s binding is blocked by pre incubation with recombinant 278-muIg (cat.no. 517-020)

Safety & Handling

Research Use Only. Not intended for diagnostic, therapeutic, or clinical use. Handle according to good laboratory practice (GLP). Consult the Safety Data Sheet (SDS) prior to use.

Related Products

Browse our full collection of recombinant proteins and antibodies for immunology and immune checkpoint research.

What expression system was used to produce Recombinant hCD275-muIg?

This protein was expressed in CHO Cells cells. Mammalian expression is critical for this Fc fusion protein because it ensures proper glycosylation and tertiary folding of the extracellular immunoglobulin-like domains, preserving native receptor-binding activity.

Which applications has this product been validated for?

Recombinant hCD275-muIg has been validated for: ELISA, Flow Cytometry. It is produced as a Murine IgG Fc Fusion (muIg), making it suitable as a blocking reagent, binding standard, or functional stimulant/inhibitor in immunology assays.

How should I store this product?

Recommended storage: Store at 2 - 5°C. Freeze/Thawing is not recommended.. Formulation: 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate. Avoid repeated freeze-thaw cycles. If long-term storage is needed, aliquot upon first use.

What species does this fusion protein cross-react with?

Species reactivity includes: human. Cross-reactivity was confirmed by functional binding assays (e.g., ELISA and/or FACS) against cells or recombinant proteins from the indicated species.

What conjugate formats are available for this product?

Available formats include: Biotin, Unconjugated. Conjugated forms are ready-to-use without secondary detection reagents for flow cytometry. Unconjugated (purified) forms can be used with anti-Fc secondary antibodies in ELISA.

Can't Find What You're Looking For? We can help you source the best match or customize a recombinant protein solution for your study. Options may include species (human/mouse/rat), protein region/domain (full-length vs fragment), tag or label (His/GST/FLAG/biotin/fluorescent), expression system (E. coli/HEK293/insect), purity grade, formulation (buffer, carrier-free, glycerol-free), activity/functional validation (binding or enzymatic assays), endotoxin level (low-endotoxin for cell-based work), mutants/variants (point mutations, isoforms), and bulk or custom packaging. Click Talk to a Scientist to submit a request form, email us at support@biohippo.com, or explore our Research Services for additional support. Our team will be in contact with you shortly.

  1. Beier, K.C., R.A. Kroczek, et al. 2000, Eur J Immunol . 30(12):3707-3717.
  2. Riley, J.L., C.H. June, et al. 2001, J. Immunol. 166: 4943-4948.
  3. Ling, V., M. Collins, et al. 2000, J. Immunol. 164: 1653-1657.
  4. Ling, V., M. Collins, et al. 2001, J. Immunol. 166: 7300-7308.
Matches this product
FREE SAMPLE
Free Sample – MycoFold™ Growth Factors
Limited time offer – availa... Request Free Sample
Matches this product
15% OFF
15% Off Proteins from Trusted Suppliers — Limited Time
Limited Time PT15OFF
15%OFF
15% Off Cancer Antibodies
Ends Sep 30 ONCO15
$50 OFF
$50 Off All ELISA Kits
Limited time ELISA50
10% OFF
10% OFF CELL LINES-Limited-Time Offer
Ends Sep 30 CELL10
FREE SAMPLE
Free Sample – CellTrypase Recombinant Trypsin-Like Enzyme
Limited time offer – availa... FREESAMPLE

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today