| Field | Specification |
|---|---|
| Mfr No | |
| Alternative Names | Tp44, T44 |
| Conjugate | |
| Formulation | |
| Host | |
| Product Type | |
| Shipping | |
| Storage |
Scientific Background
Human CD28 is an important costimulatory molecule found on all CD4+ T cells and on about half of the CD8+T cells. T cell activities attributed to CD28 include prevention of anergy, induction of cytokine gene transcription, stabilization of cytokine mRNAs and activation of CD8+ cytotoxic T lymphocytes. The ligands for CD28 identified as CD80 (B7-1) and CD86 (B7-2), are immunoglobulin superfamily monomeric transmembrane glycoprotein of 60 kd and 80 kd, respectively. Monovalency of the CD28 receptor for its natural ligands is essential to provide costimulation without inducing responses in the absense of TCR engagement (5)
Product Description
CHO CellsRecombinant hCD28-muIg is a recombinant human fusion protein produced in CHO Cells cells. Molecular Structure: A soluble fusion protein consisting of the mature extracellular (134aa) domain of human CD28: nkilvkqspmlvaydnavnlsckysynlfsrefraslhkgldsavevcvvygnysqqlqvysktgfncdgklgnesvtfylqnlyvnqtdiyfckievmypppyldneksngtiihvkgkhlcpsplfpgpskp
Alternative names: Tp44, T44
Protein Specifications
| Fusion Format | Murine IgG Fc Fusion (muIg) |
|---|---|
| Expression System | CHO Cells |
| Molecular Weight | 60 kDa |
| Formulation | 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate |
| Storage | Store at 2 - 5°C. Freeze/Thawing is not recommended. |
| Species Reactivity | Human |
| Validated Applications | ELISA |
| Available Conjugates | Biotin, Unconjugated |
✔ Research Use Only (RUO)
Functional Activity
Recombinant human CD28 -muIg fusion protein blocks binding of anti-human CD28 to human tumor cells. In combination with IFN-gamma, CD28-muIg can stimulate dendritic cells in when a crosslinking agent is included (6).
Safety & Handling
Research Use Only. Not intended for diagnostic, therapeutic, or clinical use. Handle according to good laboratory practice (GLP). Consult the Safety Data Sheet (SDS) prior to use.
Related Products
Browse our full collection of recombinant proteins and antibodies for immunology and immune checkpoint research.
This protein was expressed in CHO Cells cells. Mammalian expression is critical for this Fc fusion protein because it ensures proper glycosylation and tertiary folding of the extracellular immunoglobulin-like domains, preserving native receptor-binding activity.
Recombinant hCD28-muIg has been validated for: ELISA. It is produced as a Murine IgG Fc Fusion (muIg), making it suitable as a blocking reagent, binding standard, or functional stimulant/inhibitor in immunology assays.
Recommended storage: Store at 2 - 5°C. Freeze/Thawing is not recommended.. Formulation: 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate. Avoid repeated freeze-thaw cycles. If long-term storage is needed, aliquot upon first use.
Species reactivity includes: human. Cross-reactivity was confirmed by functional binding assays (e.g., ELISA and/or FACS) against cells or recombinant proteins from the indicated species.
Available formats include: Biotin, Unconjugated. Conjugated forms are ready-to-use without secondary detection reagents for flow cytometry. Unconjugated (purified) forms can be used with anti-Fc secondary antibodies in ELISA.
Can't Find What You're Looking For? We can help you source the best match or customize a recombinant protein solution for your study. Options may include species (human/mouse/rat), protein region/domain (full-length vs fragment), tag or label (His/GST/FLAG/biotin/fluorescent), expression system (E. coli/HEK293/insect), purity grade, formulation (buffer, carrier-free, glycerol-free), activity/functional validation (binding or enzymatic assays), endotoxin level (low-endotoxin for cell-based work), mutants/variants (point mutations, isoforms), and bulk or custom packaging. Click Talk to a Scientist to submit a request form, email us at support@biohippo.com, or explore our Research Services for additional support. Our team will be in contact with you shortly.
- M.K. Jenkins & J.G. Johnson, (1993) Curr Opin Immunol 5: 361-367.
- 61st Forum in Immunology, (1995) Res Immunol 146: 127-205.
- I. Kariv, A. Truneh & R.W. Sweet, (1996) J Immunol 157: 29-38.
- R.J. Peach, Linsley P.S., et al. J Biol Chem (1995) 270(36): 21181-21187.
- K M Dennehy, T Hunig, et al, (2006) J Immunol 176: 5725-5729.
- D H Munn, M D Sharma, A L Mellor (2004) J immunol 172(7): 4100-10. PMID: 15034022
