Recombinant hCD40-muIg

SKU:BHP14700004
Research Validated
Overview
Click light‑blue chips for details
Recombinant human Murine IgG Fc Fusion (muIg) expressed in CHO Cells cells. Validated for ELISA and Flow Cytometry. Human origin. Available unconjugated and conjugated (Biotin, FITC, PE).
Expression System CHO Cells
Fusion Format Murine IgG Fc Fusion
Molecular Weight 45.6 kDa
Species Reactivity Human
Storage 2–5°C
Validated Applications ELISA, Flow Cytometry
Options selector
Catalog no. Form Size
504-020 Purified (with Antibiotic)
504-820 Purified (Preservative-free)
504-030 Biotin conjugate
504-050 PE (Phycoerythrin) conjugate
504-060 APC (Allophycocyanin) conjugate
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Form (5) – Purified (with Antibiotic), Purified (Preservative-free), Biotin conjugate, PE (Phycoerythrin) conjugate, APC (Allophycocyanin) conjugate | Size: 25 µg
  • Lead time: options listed in "Availability Content"; other statuses may take longer.
  • Storage: Store at 2 - 5°C. Freeze/Thawing is not recommended.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: refrigerate upon receipt.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No 504
Alternative Names TNFRSF5
Conjugate
  • APC
  • Biotin
  • PE
  • Unconjugated
Formulation 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate
Host CHO cells
Product Type
  • Recombinant Protein
Shipping Shipped on blue ice
Storage Store at 2 - 5°C. Freeze/Thawing is not recommended.

Scientific Background

Human CD40 is a member of the tumor necrosis factor (TNF) receptor family and is present on all B cells except plasma cells. CD40 is also found on some epithelial cells, carcinomas and lymphoid dendritic cells. CD40 plays an important role in B cell activation and the interaction with its ligand CD154 (CD40 Ligand) is essential for isotype switching (1).

Product Description

CHO Cells

Recombinant hCD40-muIg is a recombinant human fusion protein produced in CHO Cells cells. Molecular Structure: A soluble fusion protein consisting of the mature extracellular (173aa) domain of human CD40: epptacrekqylinsqccslcqpgqklvsdctefteteclpcgesefldtwnrethchqhkycdpnlglrvqqkgtsetdtictceegwhctseacescvlhrscspgfgvkqiatgvsdticepcpvgffsnvssafekchpwtscetkdlvvqqagtnktdvvcgpqdrlr

Alternative names: TNFRSF5

Protein Specifications

Fusion Format Murine IgG Fc Fusion (muIg)
Expression System CHO Cells
Molecular Weight 45.6 kDa
Formulation 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate
Storage Store at 2 - 5°C. Freeze/Thawing is not recommended.
Species Reactivity Human
Validated Applications ELISA, Flow Cytometry
Available Conjugates APC, Biotin, PE, Unconjugated

✔ Research Use Only (RUO)

Functional Activity

CD40-muIg fusion protein blocks binding of anti-human CD40 to Raji human tumor cells. It has proven to be a useful tool in identifying CD154 mutations such as Hyper M syndrome(4).

Safety & Handling

Research Use Only. Not intended for diagnostic, therapeutic, or clinical use. Handle according to good laboratory practice (GLP). Consult the Safety Data Sheet (SDS) prior to use.

Related Products

Browse our full collection of recombinant proteins and antibodies for immunology and immune checkpoint research.

What expression system was used to produce Recombinant hCD40-muIg?

This protein was expressed in CHO Cells cells. Mammalian expression is critical for this Fc fusion protein because it ensures proper glycosylation and tertiary folding of the extracellular immunoglobulin-like domains, preserving native receptor-binding activity.

Which applications has this product been validated for?

Recombinant hCD40-muIg has been validated for: ELISA, Flow Cytometry. It is produced as a Murine IgG Fc Fusion (muIg), making it suitable as a blocking reagent, binding standard, or functional stimulant/inhibitor in immunology assays.

How should I store this product?

Recommended storage: Store at 2 - 5°C. Freeze/Thawing is not recommended.. Formulation: 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate. Avoid repeated freeze-thaw cycles. If long-term storage is needed, aliquot upon first use.

What species does this fusion protein cross-react with?

Species reactivity includes: human. Cross-reactivity was confirmed by functional binding assays (e.g., ELISA and/or FACS) against cells or recombinant proteins from the indicated species.

What conjugate formats are available for this product?

Available formats include: APC, Biotin, PE, Unconjugated. Conjugated forms are ready-to-use without secondary detection reagents for flow cytometry. Unconjugated (purified) forms can be used with anti-Fc secondary antibodies in ELISA.

Can't Find What You're Looking For? We can help you source the best match or customize a recombinant protein solution for your study. Options may include species (human/mouse/rat), protein region/domain (full-length vs fragment), tag or label (His/GST/FLAG/biotin/fluorescent), expression system (E. coli/HEK293/insect), purity grade, formulation (buffer, carrier-free, glycerol-free), activity/functional validation (binding or enzymatic assays), endotoxin level (low-endotoxin for cell-based work), mutants/variants (point mutations, isoforms), and bulk or custom packaging. Click Talk to a Scientist to submit a request form, email us at support@biohippo.com, or explore our Research Services for additional support. Our team will be in contact with you shortly.

  1. T.A. Foy, et al, (1996) Annu Rev Immunol 14: 591-617.
  2. M.E. Ozaki, et al, (1997) J Immunol 159: 214-221
  3. N. Hubbard, T. R. Torgerson, et al. (2016) Blood :blood-2015-11-683235; doi: https://doi.org/10.1182/blood-2015-11-683235
  4. Takuro Nishikawa, Hirokazu Kanegane, et al. (04 May 2025) Front Immunol 16:1572791. doi: 10.3389/fimmunol.2025.1572791 PMID: 40391217
Matches this product
FREE SAMPLE
Free Sample – MycoFold™ Growth Factors
Limited time offer – availa... Request Free Sample
Matches this product
15% OFF
15% Off Proteins from Trusted Suppliers — Limited Time
Limited Time PT15OFF
15%OFF
15% Off Cancer Antibodies
Ends Sep 30 ONCO15
$50 OFF
$50 Off All ELISA Kits
Limited time ELISA50
10% OFF
10% OFF CELL LINES-Limited-Time Offer
Ends Sep 30 CELL10
FREE SAMPLE
Free Sample – CellTrypase Recombinant Trypsin-Like Enzyme
Limited time offer – availa... FREESAMPLE

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today