| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE from the human protein were used as the immunogen for the RENT1 antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
RENT1 Antibody / hUPF1 is a research-use antibody directed against RENT1. It is supplied for use in common immunoassay contexts such as WB, IHC-P, IF (RUO).
Key elements and design rationale
- Target: RENT1.
- Description (provided): Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene.
- Antibody type: Mouse, clone 11E7., Mouse IgG2b.
- Format: Antigen affinity purified; Affinity purified.
- Reported/predicted localization: Nuclear, cytoplasmic.
- Species reactivity: tested: Human, Mouse, Rat.
- Immunogen (if provided): Amino acids NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE from the human protein were used as the immunogen for the RENT1 antibody..
The information above helps you match the antibody format to your assay context, interpret species-dependent differences, and anticipate how epitope context (isoforms, PTMs, or conformational state) may influence signal.
Biological background
Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. And this protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.
For curated annotations (gene/protein naming, domains, isoforms, and pathway links) for RENT1, consult primary databases such as UniProt, NCBI Gene, and Ensembl.
Research relevance and current trends
- Context-dependent expression studies: researchers often examine RENT1 abundance and localization across perturbations (genetic, pharmacologic, or environmental) to connect phenotype to molecular changes.
- Reagent reproducibility: there is growing emphasis on antibody specificity checks using orthogonal approaches (e.g., genetic perturbation or independent antibodies) and transparent reporting of clone/lot information.
- Multi-modal datasets: antibody-based readouts are increasingly combined with transcriptomics and imaging to relate protein-level measurements to cell-state transitions.
Common research applications
- Western blotting (immunoblot) for relative detection of target protein abundance and apparent molecular weight.
- Immunohistochemistry for spatial mapping of target expression across tissues and cell types.
- Immunofluorescence for subcellular localization and cell-type specific expression patterns.
When comparing conditions, interpret changes in signal in the context of sample composition, expected localization, and any known isoform complexity for the target.
Notes for experimental interpretation
- Isoforms and PTMs: alternative splicing or post-translational modifications can change epitope accessibility and apparent molecular weight; interpret bands/signals accordingly.
- Cross-reactivity and matrix effects: background binding can vary by sample type, species, and blocking/detection chemistries; include appropriate negative controls.
- Control concepts: where feasible, use genetic perturbation (KO/KD/overexpression), orthogonal assays, or independent antibodies to support specificity claims.
Antibody considerations: Polyclonal reagents may recognize multiple epitopes and can increase sensitivity but may show broader binding profiles, while monoclonal clones provide a single-epitope readout that can improve consistency across experiments. If a conjugate is listed, the antibody supports more direct detection workflows; otherwise, it is typically used with a compatible secondary antibody.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.