SHIP1 Antibody / SH2 domain-containing inositol 5'-phosphatase 1 / INPP5D

Overview

SHIP1 Antibody / SH2 domain-containing inositol 5'-phosphatase 1 / INPP5D is a research-use antibody directed against SHIP1. It is supplied for use in common immunoassay contexts such as WB, IHC-P (RUO).

Key elements and design rationale

• Target: SHIP1.
• Description (provided): osphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1, also called Inositol polyphosphate-5-phosphatase of 145 kDa, SIP-145 and SH2 domain-containing inositol phosphatase 1 (SHIP1), is an enzyme that in humans is encoded by the INPP5D gene.
• Antibody type: Rabbit, Polyclonal (rabbit origin), Rabbit IgG.
• Format: Antigen affinity purified; Antigen affinity purified.
• Reported/predicted localization: Membrane, cytoplasm.
• Species reactivity: tested: Human, Mouse, Rat.
• Immunogen (if provided): Amino acids NEDDKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQ from the human protein were used as the immunogen for the SHIP1 antibody..

The information above helps you match the antibody format to your assay context, interpret species-dependent differences, and anticipate how epitope context (isoforms, PTMs, or conformational state) may influence signal.

Biological background

Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1, also called Inositol polyphosphate-5-phosphatase of 145 kDa, SIP-145 and SH2 domain-containing inositol phosphatase 1 (SHIP1), is an enzyme that in humans is encoded by the INPP5D gene. This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted to hematopoietic cells where its movement from the cytosol to the plasma membrane is mediated by tyrosine phosphorylation. At the plasma membrane, the protein hydrolyzes the 5' phosphate from phosphatidylinositol (3,4,5)-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, thereby affecting multiple signaling pathways. The protein is also partly localized to the nucleus, where it may be involved in nuclear inositol phosphate signaling processes. Overall, the protein functions as a negative regulator of myeloid cell proliferation and survival. Mutations in this gene are associated with defects and cancers of the immune system.

For curated annotations (gene/protein naming, domains, isoforms, and pathway links) for SHIP1, consult primary databases such as UniProt, NCBI Gene, and Ensembl.

Research relevance and current trends

• Context-dependent expression studies: researchers often examine SHIP1 abundance and localization across perturbations (genetic, pharmacologic, or environmental) to connect phenotype to molecular changes.
• Reagent reproducibility: there is growing emphasis on antibody specificity checks using orthogonal approaches (e.g., genetic perturbation or independent antibodies) and transparent reporting of clone/lot information.
• Multi-modal datasets: antibody-based readouts are increasingly combined with transcriptomics and imaging to relate protein-level measurements to cell-state transitions.

Common research applications

• Western blotting (immunoblot) for relative detection of target protein abundance and apparent molecular weight.
• Immunohistochemistry for spatial mapping of target expression across tissues and cell types.

When comparing conditions, interpret changes in signal in the context of sample composition, expected localization, and any known isoform complexity for the target.

Notes for experimental interpretation

• Isoforms and PTMs: alternative splicing or post-translational modifications can change epitope accessibility and apparent molecular weight; interpret bands/signals accordingly.
• Cross-reactivity and matrix effects: background binding can vary by sample type, species, and blocking/detection chemistries; include appropriate negative controls.
• Control concepts: where feasible, use genetic perturbation (KO/KD/overexpression), orthogonal assays, or independent antibodies to support specificity claims.

Antibody considerations: Polyclonal reagents may recognize multiple epitopes and can increase sensitivity but may show broader binding profiles, while monoclonal clones provide a single-epitope readout that can improve consistency across experiments. If a conjugate is listed, the antibody supports more direct detection workflows; otherwise, it is typically used with a compatible secondary antibody.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.