SMN1/2 Antibody

Overview

SMN1/2 Antibody is a research-use antibody directed against SMN1/2. It is supplied for use in common immunoassay contexts such as WB, IHC-P, ICC (RUO).

Key elements and design rationale

• Target: SMN1/2.
• Description (provided): This gene is part of a 500 kb inverted duplication on chromosome 5q13.
• Antibody type: Mouse, clone 3D10, Mouse IgG1.
• Format: Purified; Protein G affinity.
• Reported/predicted localization: Nuclear, cytoplasmic.
• Species reactivity: tested: Human.
• Immunogen (if provided): Amino acids RRGTGQSDDSDIWDDTALIKAYDKAVASFKH were used as the immunogen for the SMN1/2 antibody..

The information above helps you match the antibody format to your assay context, interpret species-dependent differences, and anticipate how epitope context (isoforms, PTMs, or conformational state) may influence signal.

Biological background

This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein. However, mutations in this gene, the telomeric copy, are associated with spinal muscular atrophy; mutations in the centromeric copy do not lead to disease. The centromeric copy may be a modifier of disease caused by mutation in the telomeric copy. The critical sequence difference between the two genes is a single nucleotide in exon 7, which is thought to be an exon splice enhancer. Note that the nine exons of both the telomeric and centromeric copies are designated historically as exon 1, 2a, 2b, and 3-8. It is thought that gene conversion events may involve the two genes, leading to varying copy numbers of each gene. The protein encoded by this gene localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein. Multiple transcript variants encoding distinct isoforms have been described.

For curated annotations (gene/protein naming, domains, isoforms, and pathway links) for SMN1/2, consult primary databases such as UniProt, NCBI Gene, and Ensembl.

Research relevance and current trends

• Context-dependent expression studies: researchers often examine SMN1/2 abundance and localization across perturbations (genetic, pharmacologic, or environmental) to connect phenotype to molecular changes.
• Reagent reproducibility: there is growing emphasis on antibody specificity checks using orthogonal approaches (e.g., genetic perturbation or independent antibodies) and transparent reporting of clone/lot information.
• Multi-modal datasets: antibody-based readouts are increasingly combined with transcriptomics and imaging to relate protein-level measurements to cell-state transitions.

Common research applications

• Western blotting (immunoblot) for relative detection of target protein abundance and apparent molecular weight.
• Immunohistochemistry for spatial mapping of target expression across tissues and cell types.
• Immunocytochemistry for cellular localization in cultured cells.

When comparing conditions, interpret changes in signal in the context of sample composition, expected localization, and any known isoform complexity for the target.

Notes for experimental interpretation

• Isoforms and PTMs: alternative splicing or post-translational modifications can change epitope accessibility and apparent molecular weight; interpret bands/signals accordingly.
• Cross-reactivity and matrix effects: background binding can vary by sample type, species, and blocking/detection chemistries; include appropriate negative controls.
• Control concepts: where feasible, use genetic perturbation (KO/KD/overexpression), orthogonal assays, or independent antibodies to support specificity claims.

Antibody considerations: Polyclonal reagents may recognize multiple epitopes and can increase sensitivity but may show broader binding profiles, while monoclonal clones provide a single-epitope readout that can improve consistency across experiments. If a conjugate is listed, the antibody supports more direct detection workflows; otherwise, it is typically used with a compatible secondary antibody.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.