| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids EKPKVTPNPDLLDLVQTADEKRRQRDHGEVGMEEE from the human protein were used as the immunogen for the SYNPO antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
SYNPO Antibody / Synaptopodin is a research-use primary antibody intended for detection of SYNPO in experimental workflows. It is supplied in Antigen affinity purified format. Key antibody attributes include Rabbit, Polyclonal (rabbit origin), isotype Rabbit IgG. Applications listed for this product include WB, IHC-P, IF, FACS. Species reactivity (as provided): Human, Mouse, Rat.
Key elements and design rationale
- Target: SYNPO — selectivity and interpretation should be considered in the context of isoforms, post-translational modifications, and related family members when applicable.
- Format: Antigen affinity purified — format can influence background, multiplexing compatibility, and downstream detection strategies.
- Antibody identity: Rabbit, Polyclonal (rabbit origin), isotype Rabbit IgG — these attributes help align secondary reagents and controls (e.g., isotype-matched controls) with your assay design.
- Product notes (from provided description): The spine apparatus (SA) is a specialized form of endoplasmic reticulum (ER) that is found in a subpopulation of dendritic spines in central neurons. The SA consists of a series of stacked discs that are though to be connected to each other and to the dendritic system of ER-tubules. The actin binding protein synaptopodin (which has originally been described in podocytes of the kidney) is an essential component of the SA. Mice that lack the gene for synaptopodin do not form a spine apparatus. The SA is believed to play a critical role in learning and memory. In summary, an important function of the spine apparatus is the regulation of plasticity at individual synapses, a process known as metaplasticity. The International Radiation Hybrid Mapping Consortium mapped the SYNPO gene to chromosome 5.
Where multiple assay formats are possible, align the antibody format, host/isotype, and listed applications with your detection system and controls to support clear interpretation of signal.
Biological background
In this catalog, SYNPO is positioned within Oncology & Angiogenesis, Cytoskeleton & Motility, Kidney disease research contexts. For authoritative gene/protein nomenclature, domains/isoforms, and curated functional annotations, consult resources such as UniProt, NCBI Gene, and Ensembl.
Research relevance and current trends
- Higher-plex and spatially resolved readouts (e.g., multiplex IF/IHC, spatial omics) are increasing demand for well-characterized primary antibodies with clearly stated host/isotype and labeling strategies.
- Genetic perturbation controls (knockout/knockdown) and orthogonal measurements (e.g., RNA vs protein) are commonly used to strengthen target attribution when interpreting antibody-derived signals.
- Reproducibility initiatives emphasize transparent reporting of antibody identity (clone, host, isotype) and experimental context to improve cross-study comparability.
Common research applications
- WB: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- IHC-P: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- IF: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- FACS: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- Typical workflow themes: Western blot validation, IHC on FFPE tissue, IF/ICC localization, Flow cytometry staining, Specificity controls.
- Workflow notes: Validate SYNAPTOPODIN by Western blot in cell/tissue lysates (include controls), Detect SYNAPTOPODIN by IHC in FFPE tissue sections (optimize antigen retrieval + dilution), Detect SYNAPTOPODIN localization by IF/ICC i…
When comparing conditions, consistent sample processing and appropriate negative/positive controls support interpretation of qualitative localization differences and quantitative abundance changes.
Notes for experimental interpretation
- Isoforms and post-translational modifications may shift apparent molecular weight or epitope accessibility, especially across cell states or treatments.
- Species and tissue context can affect sequence conservation, expression level, and background binding; predicted reactivity should be verified in your sample.
- Control concepts include isotype-matched controls, secondary-only controls (for indirect detection), and genetic/orthogonal controls (e.g., KO/KD, independent antibodies, or RNA measurements) when feasible.
Monoclonal and polyclonal antibodies can differ in epitope recognition breadth and lot-to-lot characteristics; consider clonality and clone information (when provided) alongside your assay requirements. Conjugated formats may simplify detection but can change background and multiplexing behavior compared with unconjugated primaries.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.
